2J2PA

L-ficolin complexed to n-acetyl-cystein (150mm)
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
214
structure length
214
Chain Sequence
TGPRTCKDLLDRGHFLSGWHTIYLPDCRPLTVLCDMDTDGGGWTVFQRRVDGSVDFYRDWATYKQGFGSRLGEFWLGNDNIHALTAQGTSELRTDLVDFEDNYQFAKYRSFKVADEAEKYNLVLGAFVEGSAGDSLTFHNNQSFSTKDQDNDLNTGNCAVMFQGAWWYKNCHTSNLNGRYLRGTHGSFANGINWKSGKGYNYSYKVSEMKVRPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lectin
molecule keywords FICOLIN-2
publication title Structural Insights Into the Innate Immune Recognition Specificities of L- and H-Ficolins.
pubmed doi rcsb
source organism Homo sapiens
total genus 65
structure length 214
sequence length 214
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2006-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 2j2pA01
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 2j2pA02
2WNPF 4ZFGA 2HODC 1JC9A 1FZCC 2XNXC 2H43C 1LWUB 2J0YA 1RE4C 2J64A 4R9TA 1RF0B 4JZCA 2OYHC 1N73C 1FIDA 1M1JB 1FZFB 2Z4EC 1FICA 2D39A 1FZEB 2J3OA 3E1IB 1RF1B 2Q9IC 1FZAB 2JHHC 4EPUA 3BVHC 2JHLF 4M7HA 2OYIC 1FZGB 3HUSB 1Z3UA 1RE3B 2JHMF 2FFDB 2HPCB 1LT9B 2FIBA 2J0GA 1FZCB 1LWUC 1LTJB 2JHKF 1FIBA 4JYOX 1RF0C 2J3FA 3GHGC 1N86B 3H32B 4R9JA 1M1JC 1FZFC 2J60A 2HLOB 1FZEC 4NYTA 1FZBB 2J0HA 3E1IC 1RF1C 1FZAC 2J5ZA 2J3UA 2JHIF 3FIBA 2HODB 1FZDA 1FZGC 3HUSC 2XNXB 1RE3C 1Z3SA 2H43B 2FFDC 1RE4B 2HPCC 1LT9C 2OYHB 2J61A 1LTJC 1N73B 2Z4EB 2J3FD 4M7FA 1N86C 2J2PA 3H32C 2J3GA 2Q9IB 2HLOC 1FZBC 2J61B 2GY7A 2J1GA 3BVHB 2OYIB
chains in the Genus database with same CATH superfamily
2WNPF 4ZFGA 2HODC 1JC9A 1FZCC 2XNXC 2H43C 1LWUB 2J0YA 1RE4C 2J64A 4R9TA 1RF0B 4JZCA 2OYHC 3GHGB 1N73C 1FIDA 1M1JB 1FZFB 2Z4EC 1FICA 2D39A 1FZEB 2J3OA 3E1IB 1RF1B 2Q9IC 1FZAB 2JHHC 4EPUA 3BVHC 2JHLF 4M7HA 2OYIC 1FZGB 3HUSB 1Z3UA 1RE3B 2JHMF 2FFDB 2HPCB 1LT9B 2FIBA 2J0GA 1FZCB 1LWUC 1LTJB 2JHKF 1FIBA 4JYOX 1RF0C 2J3FA 3GHGC 1N86B 3H32B 4R9JA 1M1JC 1FZFC 2J60A 2HLOB 1FZEC 4NYTA 1FZBB 2J0HA 3E1IC 1RF1C 1FZAC 2J5ZA 2J3UA 2JHIF 3FIBA 2HODB 1FZDA 1FZGC 3HUSC 2XNXB 1RE3C 1Z3SA 2H43B 2FFDC 1RE4B 2HPCC 1LT9C 2OYHB 2J61A 1LTJC 1N73B 2Z4EB 2J3FD 4M7FA 1N86C 2J2PA 3H32C 2J3GA 2Q9IB 2HLOC 1FZBC 2J61B 2GY7A 2J1GA 3BVHB 2OYIB
chains in the Genus database with same CATH topology
2WNPF 4ZFGA 2HODC 1JC9A 1FZCC 2XNXC 2H43C 1LWUB 2J0YA 1RE4C 2J64A 4R9TA 1RF0B 4JZCA 2OYHC 1N73C 1FIDA 1M1JB 1FZFB 2Z4EC 1FICA 2D39A 1FZEB 2J3OA 3E1IB 1RF1B 2Q9IC 1FZAB 2JHHC 4EPUA 3BVHC 2JHLF 4M7HA 2OYIC 1FZGB 3HUSB 1Z3UA 1RE3B 2JHMF 2FFDB 2HPCB 1LT9B 2FIBA 2J0GA 1FZCB 1LWUC 1LTJB 2JHKF 1FIBA 4JYOX 1RF0C 2J3FA 3GHGC 1N86B 3H32B 4R9JA 1M1JC 1FZFC 2J60A 2HLOB 1FZEC 4NYTA 1FZBB 2J0HA 3E1IC 1RF1C 1FZAC 2J5ZA 2J3UA 2JHIF 3FIBA 2HODB 1FZDA 1FZGC 3HUSC 2XNXB 1RE3C 1Z3SA 2H43B 2FFDC 1RE4B 2HPCC 1LT9C 2OYHB 2J61A 1LTJC 1N73B 2Z4EB 2J3FD 4M7FA 1N86C 2J2PA 3H32C 2J3GA 2Q9IB 2HLOC 1FZBC 2J61B 2GY7A 2J1GA 3BVHB 2OYIB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WNP F;  4ZFG A;  2HOD C;  1JC9 A;  1FZC C;  2XNX C;  2H43 C;  1LWU B;  2J0Y A;  1RE4 C;  2J64 A;  4R9T A;  1RF0 B;  4JZC A;  2OYH C;  1N73 C;  1FID A;  1M1J B;  1FZF B;  2Z4E C;  1FIC A;  2D39 A;  1FZE B;  2J3O A;  3E1I B;  1RF1 B;  2Q9I C;  1FZA B;  2JHH C;  4EPU A;  3BVH C;  2JHL F;  4M7H A;  2OYI C;  1FZG B;  3HUS B;  1Z3U A;  1RE3 B;  2JHM F;  2FFD B;  2HPC B;  1LT9 B;  2FIB A;  2J0G A;  1FZC B;  1LWU C;  1LTJ B;  2JHK F;  1FIB A;  4JYO X;  1RF0 C;  2J3F A;  3GHG C;  1N86 B;  3H32 B;  4R9J A;  1M1J C;  1FZF C;  2J60 A;  2HLO B;  1FZE C;  4NYT A;  1FZB B;  2J0H A;  3E1I C;  1RF1 C;  1FZA C;  2J5Z A;  2J3U A;  2JHI F;  3FIB A;  2HOD B;  1FZD A;  1FZG C;  3HUS C;  2XNX B;  1RE3 C;  1Z3S A;  2H43 B;  2FFD C;  1RE4 B;  2HPC C;  1LT9 C;  2OYH B;  2J61 A;  1LTJ C;  1N73 B;  2Z4E B;  2J3F D;  4M7F A;  1N86 C;  2J2P A;  3H32 C;  2J3G A;  2Q9I B;  2HLO C;  1FZB C;  2J61 B;  2GY7 A;  2J1G A;  3BVH B;  2OYI B; 
#chains in the Genus database with same CATH topology
 2WNP F;  4ZFG A;  2HOD C;  1JC9 A;  1FZC C;  2XNX C;  2H43 C;  1LWU B;  2J0Y A;  1RE4 C;  2J64 A;  4R9T A;  1RF0 B;  4JZC A;  2OYH C;  3GHG B;  1N73 C;  1FID A;  1M1J B;  1FZF B;  2Z4E C;  1FIC A;  2D39 A;  1FZE B;  2J3O A;  3E1I B;  1RF1 B;  2Q9I C;  1FZA B;  2JHH C;  4EPU A;  3BVH C;  2JHL F;  4M7H A;  2OYI C;  1FZG B;  3HUS B;  1Z3U A;  1RE3 B;  2JHM F;  2FFD B;  2HPC B;  1LT9 B;  2FIB A;  2J0G A;  1FZC B;  1LWU C;  1LTJ B;  2JHK F;  1FIB A;  4JYO X;  1RF0 C;  2J3F A;  3GHG C;  1N86 B;  3H32 B;  4R9J A;  1M1J C;  1FZF C;  2J60 A;  2HLO B;  1FZE C;  4NYT A;  1FZB B;  2J0H A;  3E1I C;  1RF1 C;  1FZA C;  2J5Z A;  2J3U A;  2JHI F;  3FIB A;  2HOD B;  1FZD A;  1FZG C;  3HUS C;  2XNX B;  1RE3 C;  1Z3S A;  2H43 B;  2FFD C;  1RE4 B;  2HPC C;  1LT9 C;  2OYH B;  2J61 A;  1LTJ C;  1N73 B;  2Z4E B;  2J3F D;  4M7F A;  1N86 C;  2J2P A;  3H32 C;  2J3G A;  2Q9I B;  2HLO C;  1FZB C;  2J61 B;  2GY7 A;  2J1G A;  3BVH B;  2OYI B; 
#chains in the Genus database with same CATH homology
 2WNP F;  4ZFG A;  2HOD C;  1JC9 A;  1FZC C;  2XNX C;  2H43 C;  1LWU B;  2J0Y A;  1RE4 C;  2J64 A;  4R9T A;  1RF0 B;  4JZC A;  2OYH C;  1N73 C;  1FID A;  1M1J B;  1FZF B;  2Z4E C;  1FIC A;  2D39 A;  1FZE B;  2J3O A;  3E1I B;  1RF1 B;  2Q9I C;  1FZA B;  2JHH C;  4EPU A;  3BVH C;  2JHL F;  4M7H A;  2OYI C;  1FZG B;  3HUS B;  1Z3U A;  1RE3 B;  2JHM F;  2FFD B;  2HPC B;  1LT9 B;  2FIB A;  2J0G A;  1FZC B;  1LWU C;  1LTJ B;  2JHK F;  1FIB A;  4JYO X;  1RF0 C;  2J3F A;  3GHG C;  1N86 B;  3H32 B;  4R9J A;  1M1J C;  1FZF C;  2J60 A;  2HLO B;  1FZE C;  4NYT A;  1FZB B;  2J0H A;  3E1I C;  1RF1 C;  1FZA C;  2J5Z A;  2J3U A;  2JHI F;  3FIB A;  2HOD B;  1FZD A;  1FZG C;  3HUS C;  2XNX B;  1RE3 C;  1Z3S A;  2H43 B;  2FFD C;  1RE4 B;  2HPC C;  1LT9 C;  2OYH B;  2J61 A;  1LTJ C;  1N73 B;  2Z4E B;  2J3F D;  4M7F A;  1N86 C;  2J2P A;  3H32 C;  2J3G A;  2Q9I B;  2HLO C;  1FZB C;  2J61 B;  2GY7 A;  2J1G A;  3BVH B;  2OYI B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...