2GY7A

Angiopoietin-2/tie2 complex crystal structure
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
216
structure length
216
Chain Sequence
EFRDCAEVFKSGHTTNGIYTLTFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDGDNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLKATTMMIRPAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Angiopoietin-2
publication title Crystal structures of the Tie2 receptor ectodomain and the angiopoietin-2-Tie2 complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 46
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 2006-05-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 2gy7A01
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 2gy7A02
2Z4EB 1FZDA 4EPUA 2J3FA 1LWUC 1N86B 3H32C 2D39A 1LT9B 2JHHC 2WNPF 1RF0B 3E1IC 1N73B 4JZCA 1JC9A 2OYHB 1FZFC 2H43C 2HPCB 1RE4C 1FZBC 1LTJB 4JYOX 2Q9IB 3BVHB 4R9TA 1FZAC 2HODB 1FZGB 1FZCB 1M1JB 2J3UA 2J3GA 3HUSB 2JHLF 1RF1B 2FFDB 2XNXB 1RE3C 2JHIF 2J64A 1LWUB 3FIBA 3H32B 2JHKF 2J3FD 2J3OA 3E1IB 2J2PA 2J61A 1FZEB 1LTJC 2OYIC 1Z3SA 1FZFB 2H43B 1RE4B 2Z4EC 1FZGC 1FZBB 2J0YA 2HLOB 1N86C 1FZAB 2GY7A 1LT9C 2J60A 4M7HA 4NYTA 4M7FA 1RF0C 2JHMF 2J0GA 4ZFGA 1N73C 2OYHC 1FIDA 1RE3B 2FIBA 2HPCC 2J5ZA 1FIBA 1Z3UA 1FICA 2Q9IC 3BVHC 2HODC 2J0HA 4R9JA 1FZCC 2J61B 1FZEC 2J1GA 1M1JC 3HUSC 1RF1C 3GHGC 2FFDC 2OYIB 2XNXC 2HLOC
chains in the Genus database with same CATH superfamily
2Z4EB 1FZDA 4EPUA 2J3FA 1LWUC 1N86B 3H32C 2D39A 1LT9B 2JHHC 2WNPF 1RF0B 3E1IC 1N73B 4JZCA 1JC9A 2OYHB 1FZFC 2H43C 2HPCB 1RE4C 1FZBC 1LTJB 4JYOX 2Q9IB 3BVHB 4R9TA 1FZAC 2HODB 1FZGB 1FZCB 1M1JB 2J3UA 2J3GA 3HUSB 2JHLF 1RF1B 2FFDB 2XNXB 1RE3C 2JHIF 2J64A 1LWUB 3FIBA 3H32B 2JHKF 2J3FD 2J3OA 3E1IB 2J2PA 2J61A 1FZEB 1LTJC 2OYIC 1Z3SA 1FZFB 2H43B 1RE4B 2Z4EC 1FZGC 1FZBB 3GHGB 2J0YA 2HLOB 1N86C 1FZAB 2GY7A 1LT9C 2J60A 4M7HA 4NYTA 4M7FA 1RF0C 2JHMF 2J0GA 4ZFGA 1N73C 2OYHC 1FIDA 1RE3B 2FIBA 2HPCC 2J5ZA 1FIBA 1Z3UA 1FICA 2Q9IC 3BVHC 2HODC 2J0HA 4R9JA 1FZCC 2J61B 1FZEC 2J1GA 1M1JC 3HUSC 1RF1C 3GHGC 2FFDC 2OYIB 2XNXC 2HLOC
chains in the Genus database with same CATH topology
2Z4EB 1FZDA 4EPUA 2J3FA 1LWUC 1N86B 3H32C 2D39A 1LT9B 2JHHC 2WNPF 1RF0B 3E1IC 1N73B 4JZCA 1JC9A 2OYHB 1FZFC 2H43C 2HPCB 1RE4C 1FZBC 1LTJB 4JYOX 2Q9IB 3BVHB 4R9TA 1FZAC 2HODB 1FZGB 1FZCB 1M1JB 2J3UA 2J3GA 3HUSB 2JHLF 1RF1B 2FFDB 2XNXB 1RE3C 2JHIF 2J64A 1LWUB 3FIBA 3H32B 2JHKF 2J3FD 2J3OA 3E1IB 2J2PA 2J61A 1FZEB 1LTJC 2OYIC 1Z3SA 1FZFB 2H43B 1RE4B 2Z4EC 1FZGC 1FZBB 2J0YA 2HLOB 1N86C 1FZAB 2GY7A 1LT9C 2J60A 4M7HA 4NYTA 4M7FA 1RF0C 2JHMF 2J0GA 4ZFGA 1N73C 2OYHC 1FIDA 1RE3B 2FIBA 2HPCC 2J5ZA 1FIBA 1Z3UA 1FICA 2Q9IC 3BVHC 2HODC 2J0HA 4R9JA 1FZCC 2J61B 1FZEC 2J1GA 1M1JC 3HUSC 1RF1C 3GHGC 2FFDC 2OYIB 2XNXC 2HLOC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z4E B;  1FZD A;  4EPU A;  2J3F A;  1LWU C;  1N86 B;  3H32 C;  2D39 A;  1LT9 B;  2JHH C;  2WNP F;  1RF0 B;  3E1I C;  1N73 B;  4JZC A;  1JC9 A;  2OYH B;  1FZF C;  2H43 C;  2HPC B;  1RE4 C;  1FZB C;  1LTJ B;  4JYO X;  2Q9I B;  3BVH B;  4R9T A;  1FZA C;  2HOD B;  1FZG B;  1FZC B;  1M1J B;  2J3U A;  2J3G A;  3HUS B;  2JHL F;  1RF1 B;  2FFD B;  2XNX B;  1RE3 C;  2JHI F;  2J64 A;  1LWU B;  3FIB A;  3H32 B;  2JHK F;  2J3F D;  2J3O A;  3E1I B;  2J2P A;  2J61 A;  1FZE B;  1LTJ C;  2OYI C;  1Z3S A;  1FZF B;  2H43 B;  1RE4 B;  2Z4E C;  1FZG C;  1FZB B;  2J0Y A;  2HLO B;  1N86 C;  1FZA B;  2GY7 A;  1LT9 C;  2J60 A;  4M7H A;  4NYT A;  4M7F A;  1RF0 C;  2JHM F;  2J0G A;  4ZFG A;  1N73 C;  2OYH C;  1FID A;  1RE3 B;  2FIB A;  2HPC C;  2J5Z A;  1FIB A;  1Z3U A;  1FIC A;  2Q9I C;  3BVH C;  2HOD C;  2J0H A;  4R9J A;  1FZC C;  2J61 B;  1FZE C;  2J1G A;  1M1J C;  3HUS C;  1RF1 C;  3GHG C;  2FFD C;  2OYI B;  2XNX C;  2HLO C; 
#chains in the Genus database with same CATH topology
 2Z4E B;  1FZD A;  4EPU A;  2J3F A;  1LWU C;  1N86 B;  3H32 C;  2D39 A;  1LT9 B;  2JHH C;  2WNP F;  1RF0 B;  3E1I C;  1N73 B;  4JZC A;  1JC9 A;  2OYH B;  1FZF C;  2H43 C;  2HPC B;  1RE4 C;  1FZB C;  1LTJ B;  4JYO X;  2Q9I B;  3BVH B;  4R9T A;  1FZA C;  2HOD B;  1FZG B;  1FZC B;  1M1J B;  2J3U A;  2J3G A;  3HUS B;  2JHL F;  1RF1 B;  2FFD B;  2XNX B;  1RE3 C;  2JHI F;  2J64 A;  1LWU B;  3FIB A;  3H32 B;  2JHK F;  2J3F D;  2J3O A;  3E1I B;  2J2P A;  2J61 A;  1FZE B;  1LTJ C;  2OYI C;  1Z3S A;  1FZF B;  2H43 B;  1RE4 B;  2Z4E C;  1FZG C;  1FZB B;  3GHG B;  2J0Y A;  2HLO B;  1N86 C;  1FZA B;  2GY7 A;  1LT9 C;  2J60 A;  4M7H A;  4NYT A;  4M7F A;  1RF0 C;  2JHM F;  2J0G A;  4ZFG A;  1N73 C;  2OYH C;  1FID A;  1RE3 B;  2FIB A;  2HPC C;  2J5Z A;  1FIB A;  1Z3U A;  1FIC A;  2Q9I C;  3BVH C;  2HOD C;  2J0H A;  4R9J A;  1FZC C;  2J61 B;  1FZE C;  2J1G A;  1M1J C;  3HUS C;  1RF1 C;  3GHG C;  2FFD C;  2OYI B;  2XNX C;  2HLO C; 
#chains in the Genus database with same CATH homology
 2Z4E B;  1FZD A;  4EPU A;  2J3F A;  1LWU C;  1N86 B;  3H32 C;  2D39 A;  1LT9 B;  2JHH C;  2WNP F;  1RF0 B;  3E1I C;  1N73 B;  4JZC A;  1JC9 A;  2OYH B;  1FZF C;  2H43 C;  2HPC B;  1RE4 C;  1FZB C;  1LTJ B;  4JYO X;  2Q9I B;  3BVH B;  4R9T A;  1FZA C;  2HOD B;  1FZG B;  1FZC B;  1M1J B;  2J3U A;  2J3G A;  3HUS B;  2JHL F;  1RF1 B;  2FFD B;  2XNX B;  1RE3 C;  2JHI F;  2J64 A;  1LWU B;  3FIB A;  3H32 B;  2JHK F;  2J3F D;  2J3O A;  3E1I B;  2J2P A;  2J61 A;  1FZE B;  1LTJ C;  2OYI C;  1Z3S A;  1FZF B;  2H43 B;  1RE4 B;  2Z4E C;  1FZG C;  1FZB B;  2J0Y A;  2HLO B;  1N86 C;  1FZA B;  2GY7 A;  1LT9 C;  2J60 A;  4M7H A;  4NYT A;  4M7F A;  1RF0 C;  2JHM F;  2J0G A;  4ZFG A;  1N73 C;  2OYH C;  1FID A;  1RE3 B;  2FIB A;  2HPC C;  2J5Z A;  1FIB A;  1Z3U A;  1FIC A;  2Q9I C;  3BVH C;  2HOD C;  2J0H A;  4R9J A;  1FZC C;  2J61 B;  1FZE C;  2J1G A;  1M1J C;  3HUS C;  1RF1 C;  3GHG C;  2FFD C;  2OYI B;  2XNX C;  2HLO C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...