2J0HA

L-ficolin complexed to acetyl-choline
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
214
structure length
214
Chain Sequence
TGPRTCKDLLDRGHFLSGWHTIYLPDCRPLTVLCDMDTDGGGWTVFQRRVDGSVDFYRDWATYKQGFGSRLGEFWLGNDNIHALTAQGTSELRTDLVDFEDNYQFAKYRSFKVADEAEKYNLVLGAFVEGSAGDSLTFHNNQSFSTKDQDNDLNTGNCAVMFQGAWWYKNCHTSNLNGRYLRGTHGSFANGINWKSGKGYNYSYKVSEMKVRPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FICOLIN-2
publication title Structural Insights Into the Innate Immune Recognition Specificities of L- and H-Ficolins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lectin
total genus 66
structure length 214
sequence length 214
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2006-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 2j0hA01
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 2j0hA02
2HPCC 2J3OA 2JHLF 1FZAB 2J60A 1FZEC 1LWUC 1FZFB 2OYIB 1RF1B 2J64A 1LTJC 3BVHB 4M7HA 2H43C 2J61B 2J3GA 1LT9C 1FZCC 2Z4EC 3H32C 2Z4EB 2OYHC 2XNXB 2J2PA 3H32B 2J0YA 1FZGB 1FZBB 2Q9IB 2JHMF 3HUSB 1FZAC 2J0HA 1FZFC 3E1IB 4R9TA 2OYIC 1RF1C 4JZCA 2J5ZA 1RE4B 3BVHC 1RF0B 1N73B 1M1JC 1M1JB 2JHIF 4M7FA 2XNXC 3FIBA 3GHGC 1FZGC 1FZBC 1N86B 2FFDB 2HLOB 4NYTA 2FIBA 1RE3B 2JHHC 2Q9IC 3HUSC 2J0GA 2J61A 3E1IC 1FIDA 4EPUA 2J3FD 1RE4C 1RF0C 1Z3SA 1N73C 1FZDA 2J1GA 2HPCB 4JYOX 1FICA 2FFDC 1N86C 2HLOC 2HODC 1RE3C 2HODB 1JC9A 2J3UA 1FZEB 1LWUB 4R9JA 1FIBA 4ZFGA 2WNPF 1LTJB 1Z3UA 2GY7A 2H43B 1LT9B 2J3FA 2D39A 1FZCB 2JHKF 2OYHB
chains in the Genus database with same CATH superfamily
2HPCC 2J3OA 2JHLF 1FZAB 2J60A 1FZEC 1LWUC 1FZFB 2OYIB 1RF1B 2J64A 1LTJC 3BVHB 4M7HA 2H43C 2J61B 2J3GA 1LT9C 1FZCC 2Z4EC 3H32C 2Z4EB 2OYHC 2XNXB 2J2PA 3H32B 2J0YA 3GHGB 1FZGB 1FZBB 2Q9IB 2JHMF 3HUSB 1FZAC 2J0HA 1FZFC 3E1IB 4R9TA 2OYIC 1RF1C 4JZCA 2J5ZA 1RE4B 3BVHC 1RF0B 1N73B 1M1JC 1M1JB 2JHIF 4M7FA 2XNXC 3FIBA 3GHGC 1FZGC 1FZBC 1N86B 2FFDB 2HLOB 4NYTA 2FIBA 1RE3B 2JHHC 2Q9IC 3HUSC 2J0GA 2J61A 3E1IC 1FIDA 4EPUA 2J3FD 1RE4C 1RF0C 1Z3SA 1N73C 1FZDA 2J1GA 2HPCB 4JYOX 1FICA 2FFDC 1N86C 2HLOC 2HODC 1RE3C 2HODB 1JC9A 2J3UA 1FZEB 1LWUB 4R9JA 1FIBA 4ZFGA 2WNPF 1LTJB 1Z3UA 2GY7A 2H43B 1LT9B 2J3FA 2D39A 1FZCB 2JHKF 2OYHB
chains in the Genus database with same CATH topology
2HPCC 2J3OA 2JHLF 1FZAB 2J60A 1FZEC 1LWUC 1FZFB 2OYIB 1RF1B 2J64A 1LTJC 3BVHB 4M7HA 2H43C 2J61B 2J3GA 1LT9C 1FZCC 2Z4EC 3H32C 2Z4EB 2OYHC 2XNXB 2J2PA 3H32B 2J0YA 1FZGB 1FZBB 2Q9IB 2JHMF 3HUSB 1FZAC 2J0HA 1FZFC 3E1IB 4R9TA 2OYIC 1RF1C 4JZCA 2J5ZA 1RE4B 3BVHC 1RF0B 1N73B 1M1JC 1M1JB 2JHIF 4M7FA 2XNXC 3FIBA 3GHGC 1FZGC 1FZBC 1N86B 2FFDB 2HLOB 4NYTA 2FIBA 1RE3B 2JHHC 2Q9IC 3HUSC 2J0GA 2J61A 3E1IC 1FIDA 4EPUA 2J3FD 1RE4C 1RF0C 1Z3SA 1N73C 1FZDA 2J1GA 2HPCB 4JYOX 1FICA 2FFDC 1N86C 2HLOC 2HODC 1RE3C 2HODB 1JC9A 2J3UA 1FZEB 1LWUB 4R9JA 1FIBA 4ZFGA 2WNPF 1LTJB 1Z3UA 2GY7A 2H43B 1LT9B 2J3FA 2D39A 1FZCB 2JHKF 2OYHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HPC C;  2J3O A;  2JHL F;  1FZA B;  2J60 A;  1FZE C;  1LWU C;  1FZF B;  2OYI B;  1RF1 B;  2J64 A;  1LTJ C;  3BVH B;  4M7H A;  2H43 C;  2J61 B;  2J3G A;  1LT9 C;  1FZC C;  2Z4E C;  3H32 C;  2Z4E B;  2OYH C;  2XNX B;  2J2P A;  3H32 B;  2J0Y A;  1FZG B;  1FZB B;  2Q9I B;  2JHM F;  3HUS B;  1FZA C;  2J0H A;  1FZF C;  3E1I B;  4R9T A;  2OYI C;  1RF1 C;  4JZC A;  2J5Z A;  1RE4 B;  3BVH C;  1RF0 B;  1N73 B;  1M1J C;  1M1J B;  2JHI F;  4M7F A;  2XNX C;  3FIB A;  3GHG C;  1FZG C;  1FZB C;  1N86 B;  2FFD B;  2HLO B;  4NYT A;  2FIB A;  1RE3 B;  2JHH C;  2Q9I C;  3HUS C;  2J0G A;  2J61 A;  3E1I C;  1FID A;  4EPU A;  2J3F D;  1RE4 C;  1RF0 C;  1Z3S A;  1N73 C;  1FZD A;  2J1G A;  2HPC B;  4JYO X;  1FIC A;  2FFD C;  1N86 C;  2HLO C;  2HOD C;  1RE3 C;  2HOD B;  1JC9 A;  2J3U A;  1FZE B;  1LWU B;  4R9J A;  1FIB A;  4ZFG A;  2WNP F;  1LTJ B;  1Z3U A;  2GY7 A;  2H43 B;  1LT9 B;  2J3F A;  2D39 A;  1FZC B;  2JHK F;  2OYH B; 
#chains in the Genus database with same CATH topology
 2HPC C;  2J3O A;  2JHL F;  1FZA B;  2J60 A;  1FZE C;  1LWU C;  1FZF B;  2OYI B;  1RF1 B;  2J64 A;  1LTJ C;  3BVH B;  4M7H A;  2H43 C;  2J61 B;  2J3G A;  1LT9 C;  1FZC C;  2Z4E C;  3H32 C;  2Z4E B;  2OYH C;  2XNX B;  2J2P A;  3H32 B;  2J0Y A;  3GHG B;  1FZG B;  1FZB B;  2Q9I B;  2JHM F;  3HUS B;  1FZA C;  2J0H A;  1FZF C;  3E1I B;  4R9T A;  2OYI C;  1RF1 C;  4JZC A;  2J5Z A;  1RE4 B;  3BVH C;  1RF0 B;  1N73 B;  1M1J C;  1M1J B;  2JHI F;  4M7F A;  2XNX C;  3FIB A;  3GHG C;  1FZG C;  1FZB C;  1N86 B;  2FFD B;  2HLO B;  4NYT A;  2FIB A;  1RE3 B;  2JHH C;  2Q9I C;  3HUS C;  2J0G A;  2J61 A;  3E1I C;  1FID A;  4EPU A;  2J3F D;  1RE4 C;  1RF0 C;  1Z3S A;  1N73 C;  1FZD A;  2J1G A;  2HPC B;  4JYO X;  1FIC A;  2FFD C;  1N86 C;  2HLO C;  2HOD C;  1RE3 C;  2HOD B;  1JC9 A;  2J3U A;  1FZE B;  1LWU B;  4R9J A;  1FIB A;  4ZFG A;  2WNP F;  1LTJ B;  1Z3U A;  2GY7 A;  2H43 B;  1LT9 B;  2J3F A;  2D39 A;  1FZC B;  2JHK F;  2OYH B; 
#chains in the Genus database with same CATH homology
 2HPC C;  2J3O A;  2JHL F;  1FZA B;  2J60 A;  1FZE C;  1LWU C;  1FZF B;  2OYI B;  1RF1 B;  2J64 A;  1LTJ C;  3BVH B;  4M7H A;  2H43 C;  2J61 B;  2J3G A;  1LT9 C;  1FZC C;  2Z4E C;  3H32 C;  2Z4E B;  2OYH C;  2XNX B;  2J2P A;  3H32 B;  2J0Y A;  1FZG B;  1FZB B;  2Q9I B;  2JHM F;  3HUS B;  1FZA C;  2J0H A;  1FZF C;  3E1I B;  4R9T A;  2OYI C;  1RF1 C;  4JZC A;  2J5Z A;  1RE4 B;  3BVH C;  1RF0 B;  1N73 B;  1M1J C;  1M1J B;  2JHI F;  4M7F A;  2XNX C;  3FIB A;  3GHG C;  1FZG C;  1FZB C;  1N86 B;  2FFD B;  2HLO B;  4NYT A;  2FIB A;  1RE3 B;  2JHH C;  2Q9I C;  3HUS C;  2J0G A;  2J61 A;  3E1I C;  1FID A;  4EPU A;  2J3F D;  1RE4 C;  1RF0 C;  1Z3S A;  1N73 C;  1FZD A;  2J1G A;  2HPC B;  4JYO X;  1FIC A;  2FFD C;  1N86 C;  2HLO C;  2HOD C;  1RE3 C;  2HOD B;  1JC9 A;  2J3U A;  1FZE B;  1LWU B;  4R9J A;  1FIB A;  4ZFG A;  2WNP F;  1LTJ B;  1Z3U A;  2GY7 A;  2H43 B;  1LT9 B;  2J3F A;  2D39 A;  1FZC B;  2JHK F;  2OYH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...