2OYIC

Crystal structure of fragment d of gammad298,301a fibrinogen with the peptide ligand gly-pro-arg-pro-amide
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
299
structure length
299
Chain Sequence
YEASILTHDSSIRYLQEIYNSNNQKIVNLKEKVAQLEAQCQEPCKDTVQIHDITGKDCQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQSAIPYALRVELEDWNGRTSTADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDAPSAKFFTSHNGMQFSTWDNDNDKFEGNCAEQDGSGWWMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIPFNRLTI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Probing the gamma2 Calcium-Binding Site: Studies with gammaD298,301A Fibrinogen Reveal Changes in the gamma294-301 Loop that Alter the Integrity of the "a" Polymerization Site.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
molecule keywords Fibrinogen alpha chain
total genus 85
structure length 299
sequence length 299
chains with identical sequence F
ec nomenclature
pdb deposition date 2007-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2oyiC01
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 2oyiC02
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 2oyiC03
1FIBA 1N86C 2A45G 2Q9IC 1RF1B 2XNXA 2HLOC 1LT9C 2JHKF 3E1IB 2HODC 2FFDC 1RE3C 1FZFB 3BVHB 2WNPF 2J5ZA 4R9TA 1LWUA 2H43A 2OYIB 3HUSB 2OYIA 2J61B 1N73C 1LT9B 1RE4B 1RE4A 2D39A 1JY2O 1JY3N 2FFDB 3FIBA 2OYIC 2HODA 1RE3B 2J3FA 2JHLF 1FZGA 3GHGB 1RF0A 1JC9A 1FZDA 1RF0B 1JY3P 2JHHC 1N73B 2A45H 2A45I 4EPUA 2GY7A 2OYHB 3H32C 2FIBA 2Z4EC 3GHGC 1Z3SA 2J0GA 2JHIF 2HPCB 1FZCC 2J1GA 1FZBC 1FZAC 1Z3UA 2HLOB 1M1JC 1N86B 1FZCB 2HPCC 3E1IC 1RF1A 2H43B 1FICA 1JY2P 2JHMF 3BVHC 2XNXC 4M7FA 3E1IA 1LTJA 3HUSC 1FZCA 4JZCA 1M1JB 2OYHA 1M1JA 1RE4C 3GHGA 4R9JA 2XNXB 1FZFA 4NYTA 2J0HA 1FZAA 1FZBA 1FZEC 2J2PA 1FIDA 2Z4EA 1W2EA 1RE3A 2HODB 1LWUB 1RF0C 1FZEB 1FZGB 4ZFGA 2J60A 1FZFC 2Q9IA 2OYHC 1FZGC 1LTJB 1LWUC 1N73A 2J0YA 1FZBB 1FZAB 2J3UA 4JYOX 1LTJC 3HUSA 2H43C 1JY3O 2J3OA 3BVHA 2J64A 2HLOA 3H32B 2FFDA 1T3UA 1RF1C 2J3GA 1JY2N 2HPCA 1FZEA 1LT9A 2J61A 2Q9IB 2J3FD 4M7HA 2Z4EB 3H32A 1N86A
chains in the Genus database with same CATH superfamily
4D6TJ 2GUVA 1N86C 1GU4A 2BCCE 1S1CX 2XNXA 3AE8C 1KB9H 1YBKA 5B66H 2YXQB 3BVHB 3JC22 4Y99C 5KJ7C 3HUSB 1SQVJ 5TISH 2E74B 2WTYA 4PJ0H 1Q82Q 2K1AA 1FZGA 5AW7B 3B5NA 4KT0J 2AEFA 3AE4C 3P8CD 1MKMA 1ZN5A 1BDCA 4ASWA 2OARA 3NMDA 3O6QA 2R44A 3WU2E 3OAKA 4OGQC 2N1TD 3GG2A 1HGVA 2HFED 2K9YA 2K37A 1SQQE 1J1DB 2HR3A 2E74D 1SQVE 4IFFA 1ZOYC 2MKVA 3TYYA 3H1JG 2ZT9C 2KIKA 3RL0g 1Q7YQ 1SLQA 2M0BA 1KN7A 5BU8B 2WITA 1FZEB 2BCCD 2QRXA 2J60A 1KYOI 1NGMB 2Z5IA 2ZYAA 3L71E 2BEQD 3PJSK 1YITP 2ZXEB 1LTJC 1RH5B 2O01H 2RN0A 2CK3H 2J3OA 3HRNA 2KYVA 3BATA 5AW2B 1J1EC 2AXCA 1X22A 2J3FD 4WY4D 1VQ6P 1USDA 3PLNA 5AVSB 3Q3DA 5DJUB 5GTHE 4TLFA 5AW3B 4WWIA 1RE3C 5KLVG 2WPQA 2YKOA 1NTZG 2H43A 1EXJA 1EDIA 3EFGA 3PH0A 3WUTA 1YQ3C 3L70E 4H0LC 2C0XA 2A45I 2P2UA 4OGQB 1H8AA 3L73D 1ZR4A 2RKLA 1SQXD 3G4SP 4EI2A 4N78D 1G1JA 1NU1J 3E1IC 3A5TA 2A06G 4M7FA 1VF5C 3FWNA 3CCLP 2JDIH 3V6IA 3AECC 2IBZE 2JP3A 3VMXA 2J2PA 3KZIE 1KB9I 4W7YA 4Y99B 3L71G 2Y9YA 1URQD 1PP9G 2E74C 3IR9A 3BCCG 1ZMEC 2KSEA 1J1EB 1RQUA 3C9IA 1LTBC 1NU1K 1VQPP 2LR2A 3CX5H 3RK2C 2OQQA 2FFDA 5CBOA 3WUUA 5CJ0A 4I7ZC 5APYA 1IK9A 1HTLC 2C0WA 1HF9A 2QJPC 3H1ID 3HD7B 3N4XA 4YPCA 1OW6A 1NU1G 2K88A 2E5TA 1NAFA 4EOTA 2WSEH 5H2FH 5AVUB 3H1JD 2WT7A 2HODA 2C9LY 2N1TC 1RF0B 1GDTA 2I1JA 2A45H 3A0BH 1GU5A 3W67A 4HJGH 3I56P 4GT1A 1PP9J 1SQXJ 3M0DC 2E75B 2KS1B 3GLMA 1VQ7P 5AW1B 4ZKPA 3A0HE 1FICA 5KAFE 4WBAA 1H88A 3HUSC 1KQLA 4EYYQ 1GZLA 1LTTC 3R2PA 4NYTA 1FZAA 4LC1A 1EZVE 2NPSC 1M8OB 3H1IJ 4H44D 1FAVA 3H1KG 3MD0A 3VTPC 4GKGA 4HH2A 2IFMA 1FJKA 4B86A 3U59A 1NTZD 1PP9E 5CCHA 2YIUC 1NVOA 1M7LA 1SQQD 1N2DC 1N73A 1FBMA 1KYOH 2W27A 4I1LA 1J1DC 5KTBA 2VRSA 2KUBA 2HPCA 1SQBJ 4U7JA 2YMYA 2WPVB 5CMZA 3GF3A 1S5LX 4QMAA 3USSA 5AVVB 1GL2D 4H13B 1S2EA 2HODC 1AV1A 2IDBA 1LT9B 3KHUA 2XZRA 1GK4A 1JC9A 2M3BA 1YJ9P 2GY7A 1NU1E 1M1KQ 2OYHB 1CI6A 2W8ZA 1N7SB 2M5AA 2KSJA 3VMAA 3BCCE 4U3FG 2BCCJ 1FZCC 2PP6A 4W80A 2B87A 1KYOE 1M1JC 4AYCA 1FZCB 3H1LJ 3D71A 2H7HA 1BCCG 1KMIZ 1ZRTD 3S1KA 1A02J 4JZCA 2ZT9D 3CL3D 1K9MQ 3HD7D 2DW3A 1SQBG 2IYPA 3HD7C 1NOHA 1SFCD 1E5WA 1PGQA 3UIAA 1W2EA 2C9NY 1RF0C 1KQSO 3L74D 2Q9IA 2KK7A 3EQ2A 3AEDC 2Q1KA 2PRRA 3CWBD 3ITKA 1JO5A 4GIFA 2A06E 3CD6P 1Q86Q 1VDFA 1NHLA 2YKQA 1HH0A 2Q9IB 1QLED 3IFMA 1L0NJ 4U3FJ 2Q9IC 1D7MA 3SWYA 1PPJE 1LP1A 2QJKB 4H44B 5E79H 3H1LG 3SSUA 2Q3EA 2QJKC 1LTAC 1FU1A 1EDJA 2KP8A 1JY2O 2J3FA 1NTKD 2AEJA 1BE3G 2E5YA 3BASA 3TGUD 2E76B 1K04A 3AE6C 3CCVP 1OVRA 3RBXA 1OXZA 3H6PA 2FXOA 3RK3B 2QM8A 1S4XA 1SQVG 1IK7A 4YXDC 3H1JE 3CWBE 5CCGD 1KB9D 4R9JA 2XNXB 1G2CA 2O3JA 2WSCJ 3B4SA 2W6AA 1L0NG 2Z4EA 3BCCD 1IFJA 1CW5A 1OVUA 2B9BA 1G1IA 4PD4H 1DEEG 2WSSH 3D6ZA 1LT1A 2WT7B 3LIDA 1SQBE 1MV8A 3AEEC 1ZP0C 1FZAB 2J3UA 2Y0CA 4A7PA 3H1JJ 4GOFA 1J2JB 1W2BO 2WVRA 3OA7A 2FXPA 1L0LK 1BCCD 1S9KD 1T6AA 3BRTB 1FIBA 1Q2NA 1EZVI 5AVTB 1PPJG 2QJYB 3B5NC 1NTZE 4JF7A 1DD3A 1PGPA 1KC8Q 2WNPF 1FOSF 3KYQA 1KFNA 1Y9BA 3V5BA 1P84I 4IL6X 1PGJA 3MZWB 3P8CE 3GHGB 3RK3E 1RF0A 5KLVK 3M0AA 1FZDA 1JY3P 1Y47A 5AW0B 3C1LA 2JKVA 3II6A 2R5BA 1KQGB 1YJNP 3L4FA 2FIBA 3U1CA 2XDJA 4DCKA 3AEAC 3KDPB 1DD4A 1NTZJ 2FYUE 3P7KA 2K9JA 2OTKE 1M90Q 1W5CE 2Y0DA 1NTMD 3BVHC 2H8PD 2YO3A 2IBZG 1SFCB 1FZCA 1PL5A 3TGUE 1NTZK 1L0ND 3P8MC 1S9KE 1FC2C 4RKUJ 1FS0E 1GD2E 2V7QH 1SQQG 3SFEC 4D6TD 4H0LB 3CCSP 1RHZB 2FYUJ 3GMAA 3JSVC 3AE9C 5AVWB 1OX3A 3NFQA 4N78E 2ZVNB 3BVHA 5AVRB 5APWA 2IBZD 1T3UA 3H25A 3SFDC 3RK3C 1VF5B 4JPZB 4H13C 1DIPA 5AW5B 3SWKA 2PGDA 1GW4A 1SQPD 3H1HD 3VOPA 4ZNCA 5KJ7D 2FYNB 3HE5A 1VQ4P 1RE4B 2D39A 5E79E 1N73B 4OH8B 5KAIE 1SQQJ 2H88C 3CXHI 2L5GB 5AW6B 1FE6A 1YI2P 3AE7C 5AVYB 2J1GA 3U1AA 3V4QA 3KQGA 2V7QJ 3CXHH 2H43B 2JHMF 3M9BA 3M0DA 3BRVB 1SQPJ 1X8YA 1URQA 3V2RA 1TU3F 3O6QB 1NKZB 5CCHD 3CC7P 1FZEC 2QJYC 1YJWP 1Q90D 1RE3A 1SQXG 1N8RQ 2D2CC 4ZFGA 2WPSA 1LP1B 2JO1A 1PIXA 4CPGA 2IBZI 2M8RA 3FX0A 1KQFB 5AVQB 3H1IG 2K9JB 1Q81Q 4N3YB 3EWKA 3L72E 1FZEA 1GMJA 2R3CA 2J61A 2O1KA 2WPRA 1FOSE 3H32A 2NZ2A 2E43A 4L74A 2ZJSE 2CPSA 1ZR2A 1IFDA 1P84D 4GOEA 1LT9C 2W90A 1L4AD 1HBWA 1SQPG 2SPZA 1A02F 2B87B 1JY3N 5CCGA 3CI9A 5KLIB 2WSFJ 4IOIH 3E1RA 4EIJA 2NPSA 4UB8E 1OZHA 3I55P 5B5EH 3N7NA 3CWBJ 2I1KA 2AXTE 4GODA 3G3ZA 1N86B 1WRGA 2FXMA 3FWLA 4DZOA 1S3JA 4UB6H 3SWFA 1BSHA 2QSIA 4EDFA 1FZBA 1VQ9P 1AQ5A 1VQMP 1LWUB 1HWTC 2B88A 2KXPB 1FZFC 2UWJE 3AE1C 1KORA 1JM0A 2OYHC 3AE2C 3KXDA 4NPEA 1NU1D 2KLVA 1BGYD 2P1JA 3HD7A 3MGNA 3W68A 2XKMA 4ZMDA 3C8VA 5B5EE 1IJDB 1HJ0A 1SS1A 1IFIA 2R32A 2GUSA 1R5SA 3RK2B 5GTIE 1ZRTE 2W6JH 2A45G 1FDMA 1QL1A 1S72P 1SVFA 3LIEA 2JHKF 1EC5A 4O9BA 4XA4A 3RL0C 2OYIB 4C7RA 1JCCA 2R3SA 1IFMA 3MTUE 3RBZA 4BRYB 3S9OA 2IFNA 1N7LA 3QH9A 2WWWA 1KYOD 4U3FE 2KS1A 3FXEA 1SQPE 2H89C 1FZBC 1Z3UA 3T97A 1M56D 3F89A 3L35A 2HPCC 1NWQA 2OYOA 3HTKA 1R5LA 4JYBA 3L72G 1BE3J 5APQA 2E75C 3L75D 1RE4C 3Q5PA 2FYZA 2OGUA 1PFIA 2J0HA 4MN4C 3TGUG 1M57D 4RESB 1FIDA 1NYHA 1N7SD 5CCHC 3CCEP 2ZFCA 1LGHB 2IZ1A 3CXHD 1QX8A 2RH0A 1L0NK 2GM4A 4L76A 2W6BA 3HUSA 3A7OA 3A0BE 1NTKK 3CLQA 1IO4A 4NPDA 3A2AA 1HGZA 1LT9A 3B5NB 3L73G 2XNDH 1LTSC 4I7ZB 4L73A 2OTLP 1T3JA 3E1IB 1OW8A 3AE3C 5BU5A 2N1TA 1NTKE 2YO2A 1PZQA 3IAOA 2NRGA 1SQBD 3L75E 1IZNB 5L8RJ 3EFFK 4NPFX 4HYTB 2JHHC 1Z56A 3L70D 3L71D 2KNCA 3D6YA 2PAJA 3AEFC 1KFMA 3MUDC 1QL2A 4YXWH 1PV3A 1URQC 3L74J 4DOJA 3ZDMA 1JY2P 1Y8AA 1YTZI 1EQ7A 2FYUK 1IFPA 4PD4E 2JWDA 3IN6A 1KILE 4HKZH 2BASA 4AQRD 1JEKA 1VF5D 2J5UA 1NTKG 3CX5E 1KILA 3M91A 2JWAA 3Q5RA 2WZ7A 1LTJB 5AW9B 4WB4A 1GTWA 3CC4P 1FZBB 1BGYJ 3E7KA 4TT3H 3L73E 2L91A 2HLOA 2M3EA 4H0LD 2ITAA 3L70J 2MJZA 2JJLA 4LGDE 3H1IE 3TNUA 2WSCH 3M9HA 1X0TA 1UIXA 2FYUG 4GDOA 3IF4A 3L74G 5EFWB 3R4YA 4IFDK 2O01J 3Q1MA 1FZFB 3TDKA 1VL2A 2HG5D 1E79H 4PV1B 3HE4A 1SQVK 1NTMK 1PGOA 4IFMA 1MFTA 4PD4D 4EPUA 5KAFH 1NTKJ 3Q5SA 1DX7A 3TSIA 2KZJA 3PRJA 2FKWB 1H89A 1USEA 2JHIF 1LJ2A 2XU6A 3KPEA 2HLOB 2ZAEB 1JMBA 1VQOP 1YYCA 4RJTA 1YTZT 5GTHH 2QIWA 1HJBA 4XFJA 2GA1A 3PTZA 3VYIA 3A0HH 2J59M 1HVVA 1VQKP 1BDDA 4U3FD 3H1HJ 3QWOC 1ZW0A 3B71A 2KI7B 3M06A 1NJIQ 4YTPC 1S5LH 1NKNA 2BEZF 2FY8A 4RO0A 3MHVA 1EXIA 1ZXGA 3G6EP 1MZ9A 2J3GA 1OIPA 1ZLLA 1NTMG 2IZ0A 3CX5I 4N6JA 5TISE 2KOGA 4I2LC 1RF1B 1CSBA 2J58A 2P67A 2Q6QA 2E42A 4UB6E 1CI6B 5APVA 1GK6A 4R9TA 1LWUA 1RY3A 1JNMA 3HE4B 3V2NA 3NTNA 3FIBA 3WU2H 2JHLF 5KJ7A 1GL2A 2WSEJ 1XTGB 4OVNF 1R8EA 4K35A 1S5LE 2Z4EC 1BE3E 3GHGC 3V4WA 1Z3SA 1SQQK 2N1TB 2A06D 2RMZA 3S4RA 2CPBA 1EDLA 2IX7C 2FYNC 2HYNA 1SQPK 1X79B 1LTJA 3H1KE 1GW3A 1NTMJ 3MP7B 3P32A 1SQVD 2AEMA 2E75D 3CWBG 1OFCX 2QVAA 2QEXP 2HODB 1YIJP 1HUCA 1JCDA 5CJ4A 2IYOA 3CCJP 1SFCA 5APSA 4DJGA 3JCUH 3G9RA 4WVZA 5KLIC 1N7SA 2J64A 3T97B 1L0LG 1N7SC 1KILD 2K3RA 2QE7H 2QM7A 2E76C 4WY4B 1QVFO 2QG4A 2B89A 2Q5UA 2P7JA 1NO4A 4BWNA 3O8ZA 2ZYGA 4M7HA 1P84E 1AA0A 1LTIC 4LLHA 1H0TB 1BE3D 1KV4A 2QJPB 1OVVA 3D70A 2YXRB 5AW4B 1T2KC 1U57A 1CZQA 2P10A 1L4AB 1JUNA 4R4MA 2JEEA 1OMIA 1GL2B 4JYCA 3L74E 3AEBC 4C7NB 1KILB 2J0GA 2P58A 1VQLP 1BCCE 1VQ5P 2NPSD 3KZIH 1RF1A 1KB9E 1U7MA 4UB8H 3CCMP 3A3YB 1L0LJ 1DH3A 1P84H 1OW7A 1M1JA 1ZV8A 2FBWC 3VP9A 1YHQP 1K73Q 1JTHA 4H13D 4H44C 2M5AB 2W83C 3HE5B 3RK3D 1BGYE 2IPPA 3CMEP 1VQ8P 2G3AA 3L72J 4WY4C 5GTIH 3H1KD 5KLVJ 3LW5J 1AVOA 3TGUJ 3H32B 2V4HA 2N9BA 4JQ0D 1JY2N 3L75G 4M3LA 5M1BA 3RGUA 5H2FE 3HTKB 3CXHE 3WMM0 4C46A 5APTA 2YKPA 2Z5HA 1JMMA 4D6TE 1SFCC 2OYIA 1N73C 3L73J 2FFDB 1RE3B 4KHXA 2POHA 5CHXA 4R4LA 1UIIA 2YMKA 3CCQP 5C39A 1LNQA 1AVYA 4I6MC 1MUUA 1FZAC 3CMAP 1NTME 1LTGC 1SQXK 4IL6H 3L71J 2ZVOB 5APXA 1AJYA 1JOCA 2FYUD 2XNXC 1K8AQ 3BCCJ 3F5HA 5AVXB 3RL0D 2OYHA 2LXBA 1FZFA 3L75J 3V2PA 1IC2A 3I5CA 3H1LE 4Y28J 1KD1Q 5B66E 1EZVD 1RQVA 3B8EB 4BRYA 1GL2C 3G71P 1L0LE 2Y0EA 2O1JA 3AEGC 2E76D 4KJMA 4PJ0E 1LWUC 5DJTB 1IFNA 1QGKB 3CPWO 1L2PA 2KB7P 1JY3O 1SQBK 1G2CB 2Q3IA 2OTJP 3GF7A 2NPSB 5KLVE 2LKMA 3H1HE 1URQB 2KNCB 1JTHB 2D2CD 1FDIA 5CCGC 2FFDC 1QEXA 3CX5D 1BGYG 5KAIH 1L0NE 1AFOA 3L70G 3MIWA 1EZVG 3PHLA 2I8DA 4OGQD 2ZT9B 3PP5A 1QVGO 3RL0B 3JCUE 3Q2YA 2O01N 1PP9D 3H1LD 3H32C 2YIUB 3ABVC 3L72D 2JR8A 3H1KJ 2HPCB 3L36A 3GW6A 1L4AA 3OW2O 2R5DA 5KKZC 3NXSA 3E1IA 1FDOA 2G8YA 3CC2P 3VN0A 3GHGA 4PV1C 5KKZB 3L37A 4WY4A 4BXLA 2N9YB 1NAYA 3WUVA 1H0TA 3TK1A 1WT6A 3LW5H 2QA4P 1WMKA 1KZUB 2Y9ZA 1VPCA 4AUWA 4PD4I 2H43C 5BVZA 1U7JA 3VP8A 1RF1C 1KTMA 3FXDA 3H1HG 1YQ4C 1L0LD 4C7NA 1BSNA 2HLOC 3VMZA 1SQXE 2ZYDA 2PFXA 2BCCG 1L4AC 2J5ZA 3AE5C 1DEBA 2J61B 4PV1D 1RE4A 2OYIC 1NH4A 2XV5A 1BCCJ 3M9QA 4XE5B 5AVZB 2ZXXA 2Q7CA 2D2CB 4ASVA 1KILC 4K3AA 3RK2D 5KLVD 1OWAA 1MFZA 2WMMA 2YNYA 5AW8B 4D6TG 4ZKUA 1SP4A 2KZIA 1T8ZA 2WSFH 5TJHA 4Z1MH 3B5ND 3FGAD 1AQTA 1T2KD 3MUDA 4JBZA 5APUA 1M1JB 1K05A 2AXTH 3CCRP 1X9VA 4IL6E 3OJAB 2WQYC 1XTCC 4L75A 1FZGB 3CCUP 2KLUA 4DT0A 2LXCB 1JB0J 1PPJD 1FZGC 5CBNA 2J0YA 4JYOX 4HB1A 4OWFA 1VQNP 4W7ZA 3K5BA 3TNUB 1EDKA 3TF5A 3V2QA 5K5GB 2Z4EB 1FJPA 1N86A 3VMYA
chains in the Genus database with same CATH topology
2GUVA 3IFMA 4LLHA 1N86C 2A45G 2Q9IC 1GU4A 1FDMA 1QL1A 2XNXA 3SWYA 1SVFA 3LIEA 2JHKF 5AW4B 4O9BA 1T2KC 4XA4A 3BVHB 3RL0C 4Y99C 5KJ7C 2OYIB 4C7RA 3HUSB 1CZQA 1LTAC 1FU1A 1JCCA 1L4AB 2KP8A 1JUNA 2WTYA 1IFMA 1JY2O 3MTUE 2J3FA 2JEEA 1FZGA 5AW7B 3BASA 3B5NA 1GL2B 4JYCA 2IFNA 3P8CD 1N7LA 1ZN5A 4C7NB 2WWWA 1OXZA 1KILB 3H6PA 2OARA 2J0GA 3NMDA 3RK3B 3OAKA 1FZBC 2QM8A 2N1TD 1HGVA 3T97A 1Z3UA 2NPSD 3L35A 2HFED 2HPCC 1NWQA 1RF1A 3HTKA 4JYBA 1J1DB 3A3YB 4IFFA 5APQA 1DH3A 5CCGD 1M1JA 1RE4C 4R9JA 1ZV8A 2XNXB 1G2CA 2FYZA 1PFIA 3TYYA 3VP9A 2J0HA 1JTHA 4RESB 1SLQA 2W6AA 1FIDA 5CCHC 1N7SD 2Z4EA 1IFJA 1CW5A 5BU8B 3HE5B 2WITA 1FZEB 2ZFCA 3RK3D 1LGHB 1G1IA 2J60A 2IPPA 2WT7B 2Z5IA 3LIDA 1L0NK 1MV8A 2GM4A 4WY4C 2W6BA 2ZXEB 1FZAB 2J3UA 1LTJC 3HUSA 3A7OA 2O01H 1J2JB 2J3OA 3HRNA 1NTKK 2KYVA 3H32B 3BATA 5AW2B 1J1EC 3CLQA 2N9BA 3OA7A 1IO4A 1JY2N 3A2AA 1HGZA 1L0LK 1LT9A 3B5NB 1S9KD 2J3FD 4WY4D 4M3LA 3BRTB 1LTSC 1FIBA 3HTKB 5AVSB 5AVTB 3WMM0 3B5NC 4JF7A 1T3JA 5AW3B 4C46A 3E1IB 5APTA 2YKPA 1RE3C 2Z5HA 1JMMA 2WNPF 2WPQA 2YKOA 2N1TA 5BU5A 2H43A 1FOSF 3KYQA 1SFCC 2OYIA 2YO2A 1KFNA 3V5BA 1N73C 3EFGA 2FFDB 1RE3B 4KHXA 2POHA 3P8CE 5CHXA 3GHGB 1RF0A 5KLVK 3M0AA 1FZDA 1JY3P 4HYTB 2JHHC 2C0XA 2A45I 2P2UA 1H8AA 5AW0B 3II6A 1Z56A 2R5BA 2FIBA 3L4FA 1ZR4A 3U1CA 2XDJA 4I6MC 1MUUA 2PAJA 1KFMA 3KDPB 1FZAC 3P7KA 1QL2A 1URQC 4N78D 1LTGC 1SQXK 5APXA 4DOJA 1G1JA 1JOCA 3E1IC 1JY2P 1YTZI 3A5TA 3BVHC 2XNXC 2H8PD 2YO3A 5AVXB 4M7FA 1EQ7A 1SFCB 2FYUK 3RL0D 1FZCA 2OYHA 1NTZK 1FZFA 3V2PA 1IC2A 3VMXA 2J2PA 3P8MC 2BASA 3I5CA 1S9KE 4AQRD 1GD2E 1KILA 3M91A 4W7YA 3B8EB 1GL2C 4Y99B 2O1JA 1URQD 2WZ7A 3IR9A 1LTJB 5AW9B 1J1EB 1LWUC 3C9IA 1LTBC 5AVWB 1NU1K 4WB4A 1GTWA 1IFNA 1FZBB 2KB7P 3NFQA 3RK2C 1JY3O 4N78E 3BVHA 5AVRB 2HLOA 5APWA 1SQBK 2FFDA 1G2CB 1T3UA 2MJZA 5CJ0A 2Q3IA 2JJLA 4LGDE 3RK3C 3TNUA 5APYA 1IK9A 2WSCH 3M9HA 1HTLC 2NPSB 2C0WA 2LKMA 3HD7B 1URQB 5AW5B 3N4XA 1GW4A 1JTHB 4IFDK 5CCGC 2FFDC 3VOPA 1FZFB 5KJ7D 3HE5A 2HG5D 3HE4A 1NAFA 1SQVK 2WSEH 4EOTA 1NTMK 1AFOA 1RE4B 3MIWA 4IFMA 2D39A 5AVUB 2WT7A 2HODA 3PP5A 3RL0B 2C9LY 2N1TC 1RF0B 1GDTA 2I1JA 1N73B 2A45H 4EPUA 1DX7A 3TSIA 4OH8B 3H32C 1GU5A 2FKWB 2L5GB 1H89A 5AW6B 2JHIF 2XU6A 4GT1A 3KPEA 2HPCB 5AVYB 2J1GA 3L36A 3U1AA 3M0DC 1FJPA 2HLOB 1L4AA 3V4QA 3KQGA 5AW1B 4ZKPA 2H43B 1YYCA 1FICA 2JHMF 1YTZT 4WBAA 3M9BA 2R5DA 3M0DA 1H88A 1HJBA 3BRVB 3NXSA 3E1IA 3HUSC 1KQLA 1X8YA 1GZLA 1LTTC 3R2PA 3VN0A 3GHGA 1URQA 4NYTA 3V2RA 3L37A 4WY4A 1FZAA 4LC1A 2NPSC 3VYIA 1NKZB 5CCHD 1FZEC 1FAVA 2J59M 1HVVA 1RE3A 3MD0A 3VTPC 4GKGA 3TK1A 4HH2A 1WT6A 3LW5H 2IFMA 4ZFGA 1FJKA 4B86A 3U59A 2WPSA 1KZUB 5CCHA 3M06A 1NKNA 1M7LA 1VPCA 1N2DC 2M8RA 1N73A 1FBMA 4AUWA 5AVQB 2W27A 2H43C 4I1LA 1J1DC 5BVZA 5KTBA 2VRSA 4N3YB 3VP8A 1RF1C 1MZ9A 2J3GA 2HPCA 1FZEA 1ZLLA 2R3CA 2J61A 2O1KA 2WPRA 1FOSE 2YMYA 3H32A 3VMYA 4N6JA 4C7NA 2E43A 5CMZA 2KOGA 4I2LC 1RF1B 2CPSA 1ZR2A 1IFDA 2HLOC 3VMZA 1CSBA 2J58A 2P67A 1LT9C 5AVVB 1GL2D 2E42A 2HODC 1CI6B 5APVA 1L4AC 1GK6A 2J5ZA 4R9TA 1LWUA 1RY3A 1L4AD 1JNMA 1DEBA 3HE4B 2J61B 1LT9B 3V2NA 1HBWA 1RE4A 1A02F 3NTNA 1JY3N 3FIBA 5CCGA 2OYIC 3CI9A 1NH4A 2XV5A 3M9QA 4XE5B 2XZRA 2JHLF 1GK4A 5KJ7A 1GL2A 5AVZB 2Q7CA 1XTGB 1JC9A 1KILC 2M3BA 3RK2D 2GY7A 4EIJA 2NPSA 2OYHB 1CI6A 1N7SB 1OWAA 2KSJA 2Z4EC 1MFZA 2YNYA 3GHGC 5AW8B 3V4WA 1Z3SA 1SQQK 2N1TB 3N7NA 2I1KA 4ZKUA 1SP4A 1FZCC 3G3ZA 2PP6A 4W80A 1T8ZA 2WSFH 2CPBA 1M1JC 1N86B 4AYCA 1FZCB 1WRGA 2FXMA 3B5ND 2H7HA 4DZOA 2IX7C 2HYNA 1SQPK 1X79B 1T2KD 3MUDA 1LTJA 1A02J 3SWFA 4JZCA 1GW3A 5APUA 1M1JB 3CL3D 3HD7D 3P32A 1FZBA 3HD7C 1NOHA 1SFCD 1X9VA 1AQ5A 1E5WA 3OJAB 3UIAA 1W2EA 2HODB 2C9NY 1LWUB 1RF0C 1XTCC 1FZGB 1HUCA 1JCDA 1HWTC 1FZFC 2Q9IA 5CJ4A 2OYHC 3EQ2A 2KLVA 1FZGC 2P1JA 1SFCA 5APSA 3HD7A 3MGNA 2J0YA 4JYOX 1N7SA 4W7ZA 3TNUB 2XKMA 1JO5A 2J64A 1N7SC 4GIFA 1KILD 2QM7A 4WY4B 2Q5UA 3V2QA 1NHLA 2YKQA 1VDFA 1NO4A 1HH0A 1IJDB 2P7JA 2Q9IB 3O8ZA 4M7HA 1IFIA 2Z4EB 2R32A 2GUSA 3RK2B 1N86A 1LTIC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FIB A;  1N86 C;  2A45 G;  2Q9I C;  1RF1 B;  2XNX A;  2HLO C;  1LT9 C;  2JHK F;  3E1I B;  2HOD C;  2FFD C;  1RE3 C;  1FZF B;  3BVH B;  2WNP F;  2J5Z A;  4R9T A;  1LWU A;  2H43 A;  2OYI B;  3HUS B;  2OYI A;  2J61 B;  1N73 C;  1LT9 B;  1RE4 B;  1RE4 A;  2D39 A;  1JY2 O;  1JY3 N;  2FFD B;  3FIB A;  2OYI C;  2HOD A;  1RE3 B;  2J3F A;  2JHL F;  1FZG A;  3GHG B;  1RF0 A;  1JC9 A;  1FZD A;  1RF0 B;  1JY3 P;  2JHH C;  1N73 B;  2A45 H;  2A45 I;  4EPU A;  2GY7 A;  2OYH B;  3H32 C;  2FIB A;  2Z4E C;  3GHG C;  1Z3S A;  2J0G A;  2JHI F;  2HPC B;  1FZC C;  2J1G A;  1FZB C;  1FZA C;  1Z3U A;  2HLO B;  1M1J C;  1N86 B;  1FZC B;  2HPC C;  3E1I C;  1RF1 A;  2H43 B;  1FIC A;  1JY2 P;  2JHM F;  3BVH C;  2XNX C;  4M7F A;  3E1I A;  1LTJ A;  3HUS C;  1FZC A;  4JZC A;  1M1J B;  2OYH A;  1M1J A;  1RE4 C;  3GHG A;  4R9J A;  2XNX B;  1FZF A;  4NYT A;  2J0H A;  1FZA A;  1FZB A;  1FZE C;  2J2P A;  1FID A;  2Z4E A;  1W2E A;  1RE3 A;  2HOD B;  1LWU B;  1RF0 C;  1FZE B;  1FZG B;  4ZFG A;  2J60 A;  1FZF C;  2Q9I A;  2OYH C;  1FZG C;  1LTJ B;  1LWU C;  1N73 A;  2J0Y A;  1FZB B;  1FZA B;  2J3U A;  4JYO X;  1LTJ C;  3HUS A;  2H43 C;  1JY3 O;  2J3O A;  3BVH A;  2J64 A;  2HLO A;  3H32 B;  2FFD A;  1T3U A;  1RF1 C;  2J3G A;  1JY2 N;  2HPC A;  1FZE A;  1LT9 A;  2J61 A;  2Q9I B;  2J3F D;  4M7H A;  2Z4E B;  3H32 A;  1N86 A; 
#chains in the Genus database with same CATH topology
 4D6T J;  2GUV A;  1N86 C;  1GU4 A;  2BCC E;  1S1C X;  2XNX A;  3AE8 C;  1KB9 H;  1YBK A;  5B66 H;  2YXQ B;  3BVH B;  3JC2 2;  4Y99 C;  5KJ7 C;  3HUS B;  1SQV J;  5TIS H;  2E74 B;  2WTY A;  4PJ0 H;  1Q82 Q;  2K1A A;  1FZG A;  5AW7 B;  3B5N A;  4KT0 J;  2AEF A;  3AE4 C;  3P8C D;  1MKM A;  1ZN5 A;  1BDC A;  4ASW A;  2OAR A;  3NMD A;  3O6Q A;  2R44 A;  3WU2 E;  3OAK A;  4OGQ C;  2N1T D;  3GG2 A;  1HGV A;  2HFE D;  2K9Y A;  2K37 A;  1SQQ E;  1J1D B;  2HR3 A;  2E74 D;  1SQV E;  4IFF A;  1ZOY C;  2MKV A;  3TYY A;  3H1J G;  2ZT9 C;  2KIK A;  3RL0 g;  1Q7Y Q;  1SLQ A;  2M0B A;  1KN7 A;  5BU8 B;  2WIT A;  1FZE B;  2BCC D;  2QRX A;  2J60 A;  1KYO I;  1NGM B;  2Z5I A;  2ZYA A;  3L71 E;  2BEQ D;  3PJS K;  1YIT P;  2ZXE B;  1LTJ C;  1RH5 B;  2O01 H;  2RN0 A;  2CK3 H;  2J3O A;  3HRN A;  2KYV A;  3BAT A;  5AW2 B;  1J1E C;  2AXC A;  1X22 A;  2J3F D;  4WY4 D;  1VQ6 P;  1USD A;  3PLN A;  5AVS B;  3Q3D A;  5DJU B;  5GTH E;  4TLF A;  5AW3 B;  4WWI A;  1RE3 C;  5KLV G;  2WPQ A;  2YKO A;  1NTZ G;  2H43 A;  1EXJ A;  1EDI A;  3EFG A;  3PH0 A;  3WUT A;  1YQ3 C;  3L70 E;  4H0L C;  2C0X A;  2A45 I;  2P2U A;  4OGQ B;  1H8A A;  3L73 D;  1ZR4 A;  2RKL A;  1SQX D;  3G4S P;  4EI2 A;  4N78 D;  1G1J A;  1NU1 J;  3E1I C;  3A5T A;  2A06 G;  4M7F A;  1VF5 C;  3FWN A;  3CCL P;  2JDI H;  3V6I A;  3AEC C;  2IBZ E;  2JP3 A;  3VMX A;  2J2P A;  3KZI E;  1KB9 I;  4W7Y A;  4Y99 B;  3L71 G;  2Y9Y A;  1URQ D;  1PP9 G;  2E74 C;  3IR9 A;  3BCC G;  1ZME C;  2KSE A;  1J1E B;  1RQU A;  3C9I A;  1LTB C;  1NU1 K;  1VQP P;  2LR2 A;  3CX5 H;  3RK2 C;  2OQQ A;  2FFD A;  5CBO A;  3WUU A;  5CJ0 A;  4I7Z C;  5APY A;  1IK9 A;  1HTL C;  2C0W A;  1HF9 A;  2QJP C;  3H1I D;  3HD7 B;  3N4X A;  4YPC A;  1OW6 A;  1NU1 G;  2K88 A;  2E5T A;  1NAF A;  4EOT A;  2WSE H;  5H2F H;  5AVU B;  3H1J D;  2WT7 A;  2HOD A;  2C9L Y;  2N1T C;  1RF0 B;  1GDT A;  2I1J A;  2A45 H;  3A0B H;  1GU5 A;  3W67 A;  4HJG H;  3I56 P;  4GT1 A;  1PP9 J;  1SQX J;  3M0D C;  2E75 B;  2KS1 B;  3GLM A;  1VQ7 P;  5AW1 B;  4ZKP A;  3A0H E;  1FIC A;  5KAF E;  4WBA A;  1H88 A;  3HUS C;  1KQL A;  4EYY Q;  1GZL A;  1LTT C;  3R2P A;  4NYT A;  1FZA A;  4LC1 A;  1EZV E;  2NPS C;  1M8O B;  3H1I J;  4H44 D;  1FAV A;  3H1K G;  3MD0 A;  3VTP C;  4GKG A;  4HH2 A;  2IFM A;  1FJK A;  4B86 A;  3U59 A;  1NTZ D;  1PP9 E;  5CCH A;  2YIU C;  1NVO A;  1M7L A;  1SQQ D;  1N2D C;  1N73 A;  1FBM A;  1KYO H;  2W27 A;  4I1L A;  1J1D C;  5KTB A;  2VRS A;  2KUB A;  2HPC A;  1SQB J;  4U7J A;  2YMY A;  2WPV B;  5CMZ A;  3GF3 A;  1S5L X;  4QMA A;  3USS A;  5AVV B;  1GL2 D;  4H13 B;  1S2E A;  2HOD C;  1AV1 A;  2IDB A;  1LT9 B;  3KHU A;  2XZR A;  1GK4 A;  1JC9 A;  2M3B A;  1YJ9 P;  2GY7 A;  1NU1 E;  1M1K Q;  2OYH B;  1CI6 A;  2W8Z A;  1N7S B;  2M5A A;  2KSJ A;  3VMA A;  3BCC E;  4U3F G;  2BCC J;  1FZC C;  2PP6 A;  4W80 A;  2B87 A;  1KYO E;  1M1J C;  4AYC A;  1FZC B;  3H1L J;  3D71 A;  2H7H A;  1BCC G;  1KMI Z;  1ZRT D;  3S1K A;  1A02 J;  4JZC A;  2ZT9 D;  3CL3 D;  1K9M Q;  3HD7 D;  2DW3 A;  1SQB G;  2IYP A;  3HD7 C;  1NOH A;  1SFC D;  1E5W A;  1PGQ A;  3UIA A;  1W2E A;  2C9N Y;  1RF0 C;  1KQS O;  3L74 D;  2Q9I A;  2KK7 A;  3EQ2 A;  3AED C;  2Q1K A;  2PRR A;  3CWB D;  3ITK A;  1JO5 A;  4GIF A;  2A06 E;  3CD6 P;  1Q86 Q;  1VDF A;  1NHL A;  2YKQ A;  1HH0 A;  2Q9I B;  1QLE D;  3IFM A;  1L0N J;  4U3F J;  2Q9I C;  1D7M A;  3SWY A;  1PPJ E;  1LP1 A;  2QJK B;  4H44 B;  5E79 H;  3H1L G;  3SSU A;  2Q3E A;  2QJK C;  1LTA C;  1FU1 A;  1EDJ A;  2KP8 A;  1JY2 O;  2J3F A;  1NTK D;  2AEJ A;  1BE3 G;  2E5Y A;  3BAS A;  3TGU D;  2E76 B;  1K04 A;  3AE6 C;  3CCV P;  1OVR A;  3RBX A;  1OXZ A;  3H6P A;  2FXO A;  3RK3 B;  2QM8 A;  1S4X A;  1SQV G;  1IK7 A;  4YXD C;  3H1J E;  3CWB E;  5CCG D;  1KB9 D;  4R9J A;  2XNX B;  1G2C A;  2O3J A;  2WSC J;  3B4S A;  2W6A A;  1L0N G;  2Z4E A;  3BCC D;  1IFJ A;  1CW5 A;  1OVU A;  2B9B A;  1G1I A;  4PD4 H;  1DEE G;  2WSS H;  3D6Z A;  1LT1 A;  2WT7 B;  3LID A;  1SQB E;  1MV8 A;  3AEE C;  1ZP0 C;  1FZA B;  2J3U A;  2Y0C A;  4A7P A;  3H1J J;  4GOF A;  1J2J B;  1W2B O;  2WVR A;  3OA7 A;  2FXP A;  1L0L K;  1BCC D;  1S9K D;  1T6A A;  3BRT B;  1FIB A;  1Q2N A;  1EZV I;  5AVT B;  1PPJ G;  2QJY B;  3B5N C;  1NTZ E;  4JF7 A;  1DD3 A;  1PGP A;  1KC8 Q;  2WNP F;  1FOS F;  3KYQ A;  1KFN A;  1Y9B A;  3V5B A;  1P84 I;  4IL6 X;  1PGJ A;  3MZW B;  3P8C E;  3GHG B;  3RK3 E;  1RF0 A;  5KLV K;  3M0A A;  1FZD A;  1JY3 P;  1Y47 A;  5AW0 B;  3C1L A;  2JKV A;  3II6 A;  2R5B A;  1KQG B;  1YJN P;  3L4F A;  2FIB A;  3U1C A;  2XDJ A;  4DCK A;  3AEA C;  3KDP B;  1DD4 A;  1NTZ J;  2FYU E;  3P7K A;  2K9J A;  2OTK E;  1M90 Q;  1W5C E;  2Y0D A;  1NTM D;  3BVH C;  2H8P D;  2YO3 A;  2IBZ G;  1SFC B;  1FZC A;  1PL5 A;  3TGU E;  1NTZ K;  1L0N D;  3P8M C;  1S9K E;  1FC2 C;  4RKU J;  1FS0 E;  1GD2 E;  2V7Q H;  1SQQ G;  3SFE C;  4D6T D;  4H0L B;  3CCS P;  1RHZ B;  2FYU J;  3GMA A;  3JSV C;  3AE9 C;  5AVW B;  1OX3 A;  3NFQ A;  4N78 E;  2ZVN B;  3BVH A;  5AVR B;  5APW A;  2IBZ D;  1T3U A;  3H25 A;  3SFD C;  3RK3 C;  1VF5 B;  4JPZ B;  4H13 C;  1DIP A;  5AW5 B;  3SWK A;  2PGD A;  1GW4 A;  1SQP D;  3H1H D;  3VOP A;  4ZNC A;  5KJ7 D;  2FYN B;  3HE5 A;  1VQ4 P;  1RE4 B;  2D39 A;  5E79 E;  1N73 B;  4OH8 B;  5KAI E;  1SQQ J;  2H88 C;  3CXH I;  2L5G B;  5AW6 B;  1FE6 A;  1YI2 P;  3AE7 C;  5AVY B;  2J1G A;  3U1A A;  3V4Q A;  3KQG A;  2V7Q J;  3CXH H;  2H43 B;  2JHM F;  3M9B A;  3M0D A;  3BRV B;  1SQP J;  1X8Y A;  1URQ A;  3V2R A;  1TU3 F;  3O6Q B;  1NKZ B;  5CCH D;  3CC7 P;  1FZE C;  2QJY C;  1YJW P;  1Q90 D;  1RE3 A;  1SQX G;  1N8R Q;  2D2C C;  4ZFG A;  2WPS A;  1LP1 B;  2JO1 A;  1PIX A;  4CPG A;  2IBZ I;  2M8R A;  3FX0 A;  1KQF B;  5AVQ B;  3H1I G;  2K9J B;  1Q81 Q;  4N3Y B;  3EWK A;  3L72 E;  1FZE A;  1GMJ A;  2R3C A;  2J61 A;  2O1K A;  2WPR A;  1FOS E;  3H32 A;  2NZ2 A;  2E43 A;  4L74 A;  2ZJS E;  2CPS A;  1ZR2 A;  1IFD A;  1P84 D;  4GOE A;  1LT9 C;  2W90 A;  1L4A D;  1HBW A;  1SQP G;  2SPZ A;  1A02 F;  2B87 B;  1JY3 N;  5CCG A;  3CI9 A;  5KLI B;  2WSF J;  4IOI H;  3E1R A;  4EIJ A;  2NPS A;  4UB8 E;  1OZH A;  3I55 P;  5B5E H;  3N7N A;  3CWB J;  2I1K A;  2AXT E;  4GOD A;  3G3Z A;  1N86 B;  1WRG A;  2FXM A;  3FWL A;  4DZO A;  1S3J A;  4UB6 H;  3SWF A;  1BSH A;  2QSI A;  4EDF A;  1FZB A;  1VQ9 P;  1AQ5 A;  1VQM P;  1LWU B;  1HWT C;  2B88 A;  2KXP B;  1FZF C;  2UWJ E;  3AE1 C;  1KOR A;  1JM0 A;  2OYH C;  3AE2 C;  3KXD A;  4NPE A;  1NU1 D;  2KLV A;  1BGY D;  2P1J A;  3HD7 A;  3MGN A;  3W68 A;  2XKM A;  4ZMD A;  3C8V A;  5B5E E;  1IJD B;  1HJ0 A;  1SS1 A;  1IFI A;  2R32 A;  2GUS A;  1R5S A;  3RK2 B;  5GTI E;  1ZRT E;  2W6J H;  2A45 G;  1FDM A;  1QL1 A;  1S72 P;  1SVF A;  3LIE A;  2JHK F;  1EC5 A;  4O9B A;  4XA4 A;  3RL0 C;  2OYI B;  4C7R A;  1JCC A;  2R3S A;  1IFM A;  3MTU E;  3RBZ A;  4BRY B;  3S9O A;  2IFN A;  1N7L A;  3QH9 A;  2WWW A;  1KYO D;  4U3F E;  2KS1 A;  3FXE A;  1SQP E;  2H89 C;  1FZB C;  1Z3U A;  3T97 A;  1M56 D;  3F89 A;  3L35 A;  2HPC C;  1NWQ A;  2OYO A;  3HTK A;  1R5L A;  4JYB A;  3L72 G;  1BE3 J;  5APQ A;  2E75 C;  3L75 D;  1RE4 C;  3Q5P A;  2FYZ A;  2OGU A;  1PFI A;  2J0H A;  4MN4 C;  3TGU G;  1M57 D;  4RES B;  1FID A;  1NYH A;  1N7S D;  5CCH C;  3CCE P;  2ZFC A;  1LGH B;  2IZ1 A;  3CXH D;  1QX8 A;  2RH0 A;  1L0N K;  2GM4 A;  4L76 A;  2W6B A;  3HUS A;  3A7O A;  3A0B E;  1NTK K;  3CLQ A;  1IO4 A;  4NPD A;  3A2A A;  1HGZ A;  1LT9 A;  3B5N B;  3L73 G;  2XND H;  1LTS C;  4I7Z B;  4L73 A;  2OTL P;  1T3J A;  3E1I B;  1OW8 A;  3AE3 C;  5BU5 A;  2N1T A;  1NTK E;  2YO2 A;  1PZQ A;  3IAO A;  2NRG A;  1SQB D;  3L75 E;  1IZN B;  5L8R J;  3EFF K;  4NPF X;  4HYT B;  2JHH C;  1Z56 A;  3L70 D;  3L71 D;  2KNC A;  3D6Y A;  2PAJ A;  3AEF C;  1KFM A;  3MUD C;  1QL2 A;  4YXW H;  1PV3 A;  1URQ C;  3L74 J;  4DOJ A;  3ZDM A;  1JY2 P;  1Y8A A;  1YTZ I;  1EQ7 A;  2FYU K;  1IFP A;  4PD4 E;  2JWD A;  3IN6 A;  1KIL E;  4HKZ H;  2BAS A;  4AQR D;  1JEK A;  1VF5 D;  2J5U A;  1NTK G;  3CX5 E;  1KIL A;  3M91 A;  2JWA A;  3Q5R A;  2WZ7 A;  1LTJ B;  5AW9 B;  4WB4 A;  1GTW A;  3CC4 P;  1FZB B;  1BGY J;  3E7K A;  4TT3 H;  3L73 E;  2L91 A;  2HLO A;  2M3E A;  4H0L D;  2ITA A;  3L70 J;  2MJZ A;  2JJL A;  4LGD E;  3H1I E;  3TNU A;  2WSC H;  3M9H A;  1X0T A;  1UIX A;  2FYU G;  4GDO A;  3IF4 A;  3L74 G;  5EFW B;  3R4Y A;  4IFD K;  2O01 J;  3Q1M A;  1FZF B;  3TDK A;  1VL2 A;  2HG5 D;  1E79 H;  4PV1 B;  3HE4 A;  1SQV K;  1NTM K;  1PGO A;  4IFM A;  1MFT A;  4PD4 D;  4EPU A;  5KAF H;  1NTK J;  3Q5S A;  1DX7 A;  3TSI A;  2KZJ A;  3PRJ A;  2FKW B;  1H89 A;  1USE A;  2JHI F;  1LJ2 A;  2XU6 A;  3KPE A;  2HLO B;  2ZAE B;  1JMB A;  1VQO P;  1YYC A;  4RJT A;  1YTZ T;  5GTH H;  2QIW A;  1HJB A;  4XFJ A;  2GA1 A;  3PTZ A;  3VYI A;  3A0H H;  2J59 M;  1HVV A;  1VQK P;  1BDD A;  4U3F D;  3H1H J;  3QWO C;  1ZW0 A;  3B71 A;  2KI7 B;  3M06 A;  1NJI Q;  4YTP C;  1S5L H;  1NKN A;  2BEZ F;  2FY8 A;  4RO0 A;  3MHV A;  1EXI A;  1ZXG A;  3G6E P;  1MZ9 A;  2J3G A;  1OIP A;  1ZLL A;  1NTM G;  2IZ0 A;  3CX5 I;  4N6J A;  5TIS E;  2KOG A;  4I2L C;  1RF1 B;  1CSB A;  2J58 A;  2P67 A;  2Q6Q A;  2E42 A;  4UB6 E;  1CI6 B;  5APV A;  1GK6 A;  4R9T A;  1LWU A;  1RY3 A;  1JNM A;  3HE4 B;  3V2N A;  3NTN A;  3FIB A;  3WU2 H;  2JHL F;  5KJ7 A;  1GL2 A;  2WSE J;  1XTG B;  4OVN F;  1R8E A;  4K35 A;  1S5L E;  2Z4E C;  1BE3 E;  3GHG C;  3V4W A;  1Z3S A;  1SQQ K;  2N1T B;  2A06 D;  2RMZ A;  3S4R A;  2CPB A;  1EDL A;  2IX7 C;  2FYN C;  2HYN A;  1SQP K;  1X79 B;  1LTJ A;  3H1K E;  1GW3 A;  1NTM J;  3MP7 B;  3P32 A;  1SQV D;  2AEM A;  2E75 D;  3CWB G;  1OFC X;  2QVA A;  2QEX P;  2HOD B;  1YIJ P;  1HUC A;  1JCD A;  5CJ4 A;  2IYO A;  3CCJ P;  1SFC A;  5APS A;  4DJG A;  3JCU H;  3G9R A;  4WVZ A;  5KLI C;  1N7S A;  2J64 A;  3T97 B;  1L0L G;  1N7S C;  1KIL D;  2K3R A;  2QE7 H;  2QM7 A;  2E76 C;  4WY4 B;  1QVF O;  2QG4 A;  2B89 A;  2Q5U A;  2P7J A;  1NO4 A;  4BWN A;  3O8Z A;  2ZYG A;  4M7H A;  1P84 E;  1AA0 A;  1LTI C;  4LLH A;  1H0T B;  1BE3 D;  1KV4 A;  2QJP B;  1OVV A;  3D70 A;  2YXR B;  5AW4 B;  1T2K C;  1U57 A;  1CZQ A;  2P10 A;  1L4A B;  1JUN A;  4R4M A;  2JEE A;  1OMI A;  1GL2 B;  4JYC A;  3L74 E;  3AEB C;  4C7N B;  1KIL B;  2J0G A;  2P58 A;  1VQL P;  1BCC E;  1VQ5 P;  2NPS D;  3KZI H;  1RF1 A;  1KB9 E;  1U7M A;  4UB8 H;  3CCM P;  3A3Y B;  1L0L J;  1DH3 A;  1P84 H;  1OW7 A;  1M1J A;  1ZV8 A;  2FBW C;  3VP9 A;  1YHQ P;  1K73 Q;  1JTH A;  4H13 D;  4H44 C;  2M5A B;  2W83 C;  3HE5 B;  3RK3 D;  1BGY E;  2IPP A;  3CME P;  1VQ8 P;  2G3A A;  3L72 J;  4WY4 C;  5GTI H;  3H1K D;  5KLV J;  3LW5 J;  1AVO A;  3TGU J;  3H32 B;  2V4H A;  2N9B A;  4JQ0 D;  1JY2 N;  3L75 G;  4M3L A;  5M1B A;  3RGU A;  5H2F E;  3HTK B;  3CXH E;  3WMM 0;  4C46 A;  5APT A;  2YKP A;  2Z5H A;  1JMM A;  4D6T E;  1SFC C;  2OYI A;  1N73 C;  3L73 J;  2FFD B;  1RE3 B;  4KHX A;  2POH A;  5CHX A;  4R4L A;  1UII A;  2YMK A;  3CCQ P;  5C39 A;  1LNQ A;  1AVY A;  4I6M C;  1MUU A;  1FZA C;  3CMA P;  1NTM E;  1LTG C;  1SQX K;  4IL6 H;  3L71 J;  2ZVO B;  5APX A;  1AJY A;  1JOC A;  2FYU D;  2XNX C;  1K8A Q;  3BCC J;  3F5H A;  5AVX B;  3RL0 D;  2OYH A;  2LXB A;  1FZF A;  3L75 J;  3V2P A;  1IC2 A;  3I5C A;  3H1L E;  4Y28 J;  1KD1 Q;  5B66 E;  1EZV D;  1RQV A;  3B8E B;  4BRY A;  1GL2 C;  3G71 P;  1L0L E;  2Y0E A;  2O1J A;  3AEG C;  2E76 D;  4KJM A;  4PJ0 E;  1LWU C;  5DJT B;  1IFN A;  1QGK B;  3CPW O;  1L2P A;  2KB7 P;  1JY3 O;  1SQB K;  1G2C B;  2Q3I A;  2OTJ P;  3GF7 A;  2NPS B;  5KLV E;  2LKM A;  3H1H E;  1URQ B;  2KNC B;  1JTH B;  2D2C D;  1FDI A;  5CCG C;  2FFD C;  1QEX A;  3CX5 D;  1BGY G;  5KAI H;  1L0N E;  1AFO A;  3L70 G;  3MIW A;  1EZV G;  3PHL A;  2I8D A;  4OGQ D;  2ZT9 B;  3PP5 A;  1QVG O;  3RL0 B;  3JCU E;  3Q2Y A;  2O01 N;  1PP9 D;  3H1L D;  3H32 C;  2YIU B;  3ABV C;  3L72 D;  2JR8 A;  3H1K J;  2HPC B;  3L36 A;  3GW6 A;  1L4A A;  3OW2 O;  2R5D A;  5KKZ C;  3NXS A;  3E1I A;  1FDO A;  2G8Y A;  3CC2 P;  3VN0 A;  3GHG A;  4PV1 C;  5KKZ B;  3L37 A;  4WY4 A;  4BXL A;  2N9Y B;  1NAY A;  3WUV A;  1H0T A;  3TK1 A;  1WT6 A;  3LW5 H;  2QA4 P;  1WMK A;  1KZU B;  2Y9Z A;  1VPC A;  4AUW A;  4PD4 I;  2H43 C;  5BVZ A;  1U7J A;  3VP8 A;  1RF1 C;  1KTM A;  3FXD A;  3H1H G;  1YQ4 C;  1L0L D;  4C7N A;  1BSN A;  2HLO C;  3VMZ A;  1SQX E;  2ZYD A;  2PFX A;  2BCC G;  1L4A C;  2J5Z A;  3AE5 C;  1DEB A;  2J61 B;  4PV1 D;  1RE4 A;  2OYI C;  1NH4 A;  2XV5 A;  1BCC J;  3M9Q A;  4XE5 B;  5AVZ B;  2ZXX A;  2Q7C A;  2D2C B;  4ASV A;  1KIL C;  4K3A A;  3RK2 D;  5KLV D;  1OWA A;  1MFZ A;  2WMM A;  2YNY A;  5AW8 B;  4D6T G;  4ZKU A;  1SP4 A;  2KZI A;  1T8Z A;  2WSF H;  5TJH A;  4Z1M H;  3B5N D;  3FGA D;  1AQT A;  1T2K D;  3MUD A;  4JBZ A;  5APU A;  1M1J B;  1K05 A;  2AXT H;  3CCR P;  1X9V A;  4IL6 E;  3OJA B;  2WQY C;  1XTC C;  4L75 A;  1FZG B;  3CCU P;  2KLU A;  4DT0 A;  2LXC B;  1JB0 J;  1PPJ D;  1FZG C;  5CBN A;  2J0Y A;  4JYO X;  4HB1 A;  4OWF A;  1VQN P;  4W7Z A;  3K5B A;  3TNU B;  1EDK A;  3TF5 A;  3V2Q A;  5K5G B;  2Z4E B;  1FJP A;  1N86 A;  3VMY A; 
#chains in the Genus database with same CATH homology
 2GUV A;  3IFM A;  4LLH A;  1N86 C;  2A45 G;  2Q9I C;  1GU4 A;  1FDM A;  1QL1 A;  2XNX A;  3SWY A;  1SVF A;  3LIE A;  2JHK F;  5AW4 B;  4O9B A;  1T2K C;  4XA4 A;  3BVH B;  3RL0 C;  4Y99 C;  5KJ7 C;  2OYI B;  4C7R A;  3HUS B;  1CZQ A;  1LTA C;  1FU1 A;  1JCC A;  1L4A B;  2KP8 A;  1JUN A;  2WTY A;  1IFM A;  1JY2 O;  3MTU E;  2J3F A;  2JEE A;  1FZG A;  5AW7 B;  3BAS A;  3B5N A;  1GL2 B;  4JYC A;  2IFN A;  3P8C D;  1N7L A;  1ZN5 A;  4C7N B;  2WWW A;  1OXZ A;  1KIL B;  3H6P A;  2OAR A;  2J0G A;  3NMD A;  3RK3 B;  3OAK A;  1FZB C;  2QM8 A;  2N1T D;  1HGV A;  3T97 A;  1Z3U A;  2NPS D;  3L35 A;  2HFE D;  2HPC C;  1NWQ A;  1RF1 A;  3HTK A;  4JYB A;  1J1D B;  3A3Y B;  4IFF A;  5APQ A;  1DH3 A;  5CCG D;  1M1J A;  1RE4 C;  4R9J A;  1ZV8 A;  2XNX B;  1G2C A;  2FYZ A;  1PFI A;  3TYY A;  3VP9 A;  2J0H A;  1JTH A;  4RES B;  1SLQ A;  2W6A A;  1FID A;  5CCH C;  1N7S D;  2Z4E A;  1IFJ A;  1CW5 A;  5BU8 B;  3HE5 B;  2WIT A;  1FZE B;  2ZFC A;  3RK3 D;  1LGH B;  1G1I A;  2J60 A;  2IPP A;  2WT7 B;  2Z5I A;  3LID A;  1L0N K;  1MV8 A;  2GM4 A;  4WY4 C;  2W6B A;  2ZXE B;  1FZA B;  2J3U A;  1LTJ C;  3HUS A;  3A7O A;  2O01 H;  1J2J B;  2J3O A;  3HRN A;  1NTK K;  2KYV A;  3H32 B;  3BAT A;  5AW2 B;  1J1E C;  3CLQ A;  2N9B A;  3OA7 A;  1IO4 A;  1JY2 N;  3A2A A;  1HGZ A;  1L0L K;  1LT9 A;  3B5N B;  1S9K D;  2J3F D;  4WY4 D;  4M3L A;  3BRT B;  1LTS C;  1FIB A;  3HTK B;  5AVS B;  5AVT B;  3WMM 0;  3B5N C;  4JF7 A;  1T3J A;  5AW3 B;  4C46 A;  3E1I B;  5APT A;  2YKP A;  1RE3 C;  2Z5H A;  1JMM A;  2WNP F;  2WPQ A;  2YKO A;  2N1T A;  5BU5 A;  2H43 A;  1FOS F;  3KYQ A;  1SFC C;  2OYI A;  2YO2 A;  1KFN A;  3V5B A;  1N73 C;  3EFG A;  2FFD B;  1RE3 B;  4KHX A;  2POH A;  3P8C E;  5CHX A;  3GHG B;  1RF0 A;  5KLV K;  3M0A A;  1FZD A;  1JY3 P;  4HYT B;  2JHH C;  2C0X A;  2A45 I;  2P2U A;  1H8A A;  5AW0 B;  3II6 A;  1Z56 A;  2R5B A;  2FIB A;  3L4F A;  1ZR4 A;  3U1C A;  2XDJ A;  4I6M C;  1MUU A;  2PAJ A;  1KFM A;  3KDP B;  1FZA C;  3P7K A;  1QL2 A;  1URQ C;  4N78 D;  1LTG C;  1SQX K;  5APX A;  4DOJ A;  1G1J A;  1JOC A;  3E1I C;  1JY2 P;  1YTZ I;  3A5T A;  3BVH C;  2XNX C;  2H8P D;  2YO3 A;  5AVX B;  4M7F A;  1EQ7 A;  1SFC B;  2FYU K;  3RL0 D;  1FZC A;  2OYH A;  1NTZ K;  1FZF A;  3V2P A;  1IC2 A;  3VMX A;  2J2P A;  3P8M C;  2BAS A;  3I5C A;  1S9K E;  4AQR D;  1GD2 E;  1KIL A;  3M91 A;  4W7Y A;  3B8E B;  1GL2 C;  4Y99 B;  2O1J A;  1URQ D;  2WZ7 A;  3IR9 A;  1LTJ B;  5AW9 B;  1J1E B;  1LWU C;  3C9I A;  1LTB C;  5AVW B;  1NU1 K;  4WB4 A;  1GTW A;  1IFN A;  1FZB B;  2KB7 P;  3NFQ A;  3RK2 C;  1JY3 O;  4N78 E;  3BVH A;  5AVR B;  2HLO A;  5APW A;  1SQB K;  2FFD A;  1G2C B;  1T3U A;  2MJZ A;  5CJ0 A;  2Q3I A;  2JJL A;  4LGD E;  3RK3 C;  3TNU A;  5APY A;  1IK9 A;  2WSC H;  3M9H A;  1HTL C;  2NPS B;  2C0W A;  2LKM A;  3HD7 B;  1URQ B;  5AW5 B;  3N4X A;  1GW4 A;  1JTH B;  4IFD K;  5CCG C;  2FFD C;  3VOP A;  1FZF B;  5KJ7 D;  3HE5 A;  2HG5 D;  3HE4 A;  1NAF A;  1SQV K;  2WSE H;  4EOT A;  1NTM K;  1AFO A;  1RE4 B;  3MIW A;  4IFM A;  2D39 A;  5AVU B;  2WT7 A;  2HOD A;  3PP5 A;  3RL0 B;  2C9L Y;  2N1T C;  1RF0 B;  1GDT A;  2I1J A;  1N73 B;  2A45 H;  4EPU A;  1DX7 A;  3TSI A;  4OH8 B;  3H32 C;  1GU5 A;  2FKW B;  2L5G B;  1H89 A;  5AW6 B;  2JHI F;  2XU6 A;  4GT1 A;  3KPE A;  2HPC B;  5AVY B;  2J1G A;  3L36 A;  3U1A A;  3M0D C;  1FJP A;  2HLO B;  1L4A A;  3V4Q A;  3KQG A;  5AW1 B;  4ZKP A;  2H43 B;  1YYC A;  1FIC A;  2JHM F;  1YTZ T;  4WBA A;  3M9B A;  2R5D A;  3M0D A;  1H88 A;  1HJB A;  3BRV B;  3NXS A;  3E1I A;  3HUS C;  1KQL A;  1X8Y A;  1GZL A;  1LTT C;  3R2P A;  3VN0 A;  3GHG A;  1URQ A;  4NYT A;  3V2R A;  3L37 A;  4WY4 A;  1FZA A;  4LC1 A;  2NPS C;  3VYI A;  1NKZ B;  5CCH D;  1FZE C;  1FAV A;  2J59 M;  1HVV A;  1RE3 A;  3MD0 A;  3VTP C;  4GKG A;  3TK1 A;  4HH2 A;  1WT6 A;  3LW5 H;  2IFM A;  4ZFG A;  1FJK A;  4B86 A;  3U59 A;  2WPS A;  1KZU B;  5CCH A;  3M06 A;  1NKN A;  1M7L A;  1VPC A;  1N2D C;  2M8R A;  1N73 A;  1FBM A;  4AUW A;  5AVQ B;  2W27 A;  2H43 C;  4I1L A;  1J1D C;  5BVZ A;  5KTB A;  2VRS A;  4N3Y B;  3VP8 A;  1RF1 C;  1MZ9 A;  2J3G A;  2HPC A;  1FZE A;  1ZLL A;  2R3C A;  2J61 A;  2O1K A;  2WPR A;  1FOS E;  2YMY A;  3H32 A;  3VMY A;  4N6J A;  4C7N A;  2E43 A;  5CMZ A;  2KOG A;  4I2L C;  1RF1 B;  2CPS A;  1ZR2 A;  1IFD A;  2HLO C;  3VMZ A;  1CSB A;  2J58 A;  2P67 A;  1LT9 C;  5AVV B;  1GL2 D;  2E42 A;  2HOD C;  1CI6 B;  5APV A;  1L4A C;  1GK6 A;  2J5Z A;  4R9T A;  1LWU A;  1RY3 A;  1L4A D;  1JNM A;  1DEB A;  3HE4 B;  2J61 B;  1LT9 B;  3V2N A;  1HBW A;  1RE4 A;  1A02 F;  3NTN A;  1JY3 N;  3FIB A;  5CCG A;  2OYI C;  3CI9 A;  1NH4 A;  2XV5 A;  3M9Q A;  4XE5 B;  2XZR A;  2JHL F;  1GK4 A;  5KJ7 A;  1GL2 A;  5AVZ B;  2Q7C A;  1XTG B;  1JC9 A;  1KIL C;  2M3B A;  3RK2 D;  2GY7 A;  4EIJ A;  2NPS A;  2OYH B;  1CI6 A;  1N7S B;  1OWA A;  2KSJ A;  2Z4E C;  1MFZ A;  2YNY A;  3GHG C;  5AW8 B;  3V4W A;  1Z3S A;  1SQQ K;  2N1T B;  3N7N A;  2I1K A;  4ZKU A;  1SP4 A;  1FZC C;  3G3Z A;  2PP6 A;  4W80 A;  1T8Z A;  2WSF H;  2CPB A;  1M1J C;  1N86 B;  4AYC A;  1FZC B;  1WRG A;  2FXM A;  3B5N D;  2H7H A;  4DZO A;  2IX7 C;  2HYN A;  1SQP K;  1X79 B;  1T2K D;  3MUD A;  1LTJ A;  1A02 J;  3SWF A;  4JZC A;  1GW3 A;  5APU A;  1M1J B;  3CL3 D;  3HD7 D;  3P32 A;  1FZB A;  3HD7 C;  1NOH A;  1SFC D;  1X9V A;  1AQ5 A;  1E5W A;  3OJA B;  3UIA A;  1W2E A;  2HOD B;  2C9N Y;  1LWU B;  1RF0 C;  1XTC C;  1FZG B;  1HUC A;  1JCD A;  1HWT C;  1FZF C;  2Q9I A;  5CJ4 A;  2OYH C;  3EQ2 A;  2KLV A;  1FZG C;  2P1J A;  1SFC A;  5APS A;  3HD7 A;  3MGN A;  2J0Y A;  4JYO X;  1N7S A;  4W7Z A;  3TNU B;  2XKM A;  1JO5 A;  2J64 A;  1N7S C;  4GIF A;  1KIL D;  2QM7 A;  4WY4 B;  2Q5U A;  3V2Q A;  1NHL A;  2YKQ A;  1VDF A;  1NO4 A;  1HH0 A;  1IJD B;  2P7J A;  2Q9I B;  3O8Z A;  4M7H A;  1IFI A;  2Z4E B;  2R32 A;  2GUS A;  3RK2 B;  1N86 A;  1LTI C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...