2OYIC

Crystal structure of fragment d of gammad298,301a fibrinogen with the peptide ligand gly-pro-arg-pro-amide
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
299
structure length
299
Chain Sequence
YEASILTHDSSIRYLQEIYNSNNQKIVNLKEKVAQLEAQCQEPCKDTVQIHDITGKDCQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQSAIPYALRVELEDWNGRTSTADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDAPSAKFFTSHNGMQFSTWDNDNDKFEGNCAEQDGSGWWMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIPFNRLTI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Blood clotting
molecule keywords Fibrinogen alpha chain
publication title Probing the gamma2 Calcium-Binding Site: Studies with gammaD298,301A Fibrinogen Reveal Changes in the gamma294-301 Loop that Alter the Integrity of the "a" Polymerization Site.
pubmed doi rcsb
source organism Homo sapiens
total genus 85
structure length 299
sequence length 299
chains with identical sequence F
ec nomenclature
pdb deposition date 2007-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2oyiC01
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 2oyiC02
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 2oyiC03
1LT9A 1LWUA 2WNPF 4JZCA 3HUSC 2J61B 2A45I 2J61A 1LTJC 1FZFB 3HUSA 1FZDA 1JY2O 3E1IA 1RE3B 1RE3A 1M1JB 1FZAB 1Z3UA 1FZGB 1JY3P 2FFDA 1FIBA 1FZGA 2OYHB 1RE4C 1FZBC 2J60A 2XNXC 2HLOB 1JY2N 1RF0B 1T3UA 1FICA 2A45G 3H32B 1LT9C 1FZEB 2J0GA 1N86B 2HODB 2HODA 2J64A 4JYOX 3BVHB 1FZCB 1FZFC 3E1IC 4EPUA 1RE3C 1JY2P 1Z3SA 1FZFA 2FFDC 2J1GA 1RF1B 2HPCB 1FZGC 1M1JA 2HPCA 1FZAA 2JHMF 2Z4EB 2OYHA 2D39A 2HLOA 1N73B 2J0YA 2JHHC 1RF0A 4NYTA 2Q9IB 2Q9IA 2H43B 1FZEC 1N86C 2HODC 3H32A 1FZEA 3BVHC 2J3OA 1N86A 3BVHA 2J3FD 1LTJB 1FZCA 4R9JA 1M1JC 2HPCC 1FZAC 4M7FA 1RF1A 2OYHC 3FIBA 2Z4EC 2XNXB 2HLOC 2GY7A 1FIDA 2OYIB 2OYIA 1RF0C 1N73C 2J3FA 2J5ZA 2Z4EA 2Q9IC 2A45H 2FIBA 3GHGB 2H43C 1N73A 3GHGA 1W2EA 2JHKF 2J3UA 3H32C 2H43A 1LT9B 1LWUB 2JHLF 4ZFGA 1FZCC 2J2PA 3HUSB 3E1IB 2J0HA 1LTJA 2J3GA 1RF1C 2FFDB 4R9TA 1JC9A 1JY3O 2JHIF 2OYIC 1FZBB 1RE4B 1FZBA 2XNXA 1RE4A 3GHGC 4M7HA 1JY3N 1LWUC
chains in the Genus database with same CATH superfamily
1LWUA 1NTMG 1BE3E 3MHVA 2OYOA 1HJBA 4OVNF 1HF9A 2RMZA 4C7RA 4NPFX 4IFMA 2MKVA 1DEBA 5CBNA 1M8OB 3CWBD 2P67A 1MUUA 3UIAA 1IFIA 1FZCB 3H1LJ 1Z3SA 1SQXE 1FZFA 3RK2B 3A2AA 1KORA 3H1HD 3O8ZA 2R3SA 2JJLA 3MIWA 1CI6B 3PH0A 1N86A 2NPSC 3F5HA 1GK6A 1IZNB 1N7SD 2Q7CA 4JQ0D 1K73Q 1ZV8A 2GY7A 4AQRD 1FJPA 1EXJA 1N7SA 2Q9IC 1PPJD 3BRVB 4IL6X 1EXIA 3NXSA 2IZ0A 3AE9C 2CK3H 1VQOP 2K88A 1FDOA 1NYHA 5KLVK 2BEZF 3L70J 2AEJA 3WUVA 3EWKA 3G3ZA 3H1JG 1RH5B 2O1JA 1LTJA 2W6AA 2Z5IA 4GOFA 5CCHC 4U3FD 1S5LX 5KLVJ 3D70A 3CX5H 4IL6H 1Q90D 5AW4B 3B5ND 5KJ7C 1HTLC 1NJIQ 2WSCJ 3M9QA 3IN6A 3B5NA 3MP7B 1L0NE 2BASA 2XNXC 1SQBE 4H44C 3CCUP 1S5LH 3WU2H 1RF0B 3H25A 2K3RA 1LTSC 1CZQA 1NTKE 2M5AA 1E5WA 1PP9D 3OW2O 1GW4A 2WITA 1NO4A 5CCGD 1GW3A 3CI9A 3S1KA 3C1LA 2NPSB 3BRTB 1FZGC 5CCGA 1FZAA 3PTZA 2W6JH 5H2FH 1JUNA 1VF5C 1EZVE 2KYVA 1PL5A 2N1TC 4NYTA 2Q9IB 1E79H 1KQFB 1KC8Q 4I7ZC 1FE6A 3BVHC 3MD0A 3HTKB 3M91A 2JWDA 2E42A 2J3FD 1MKMA 2MJZA 1FIDA 2YXRB 2J3FA 1URQD 3D6YA 1M56D 4DZOA 3P8MC 2FIBA 2FKWB 3GHGA 3V4QA 1NAYA 3CX5E 2JHKF 4IL6E 3H32C 4ZFGA 1URQA 1SQPG 2W8ZA 1NU1K 2ZT9C 1JC9A 1GL2B 2QEXP 3H1KJ 3EFGA 2E5TA 1ZW0A 1RE4A 4H44B 2H7HA 1GK4A 1OIPA 1Q86Q 2FYUG 2KUBA 3HUSC 1SFCC 2CPSA 2E76C 3L75J 1FDMA 4YTPC 2IBZG 1P84H 1DH3A 3OJAB 1FZGB 1OVVA 1FZBC 4H0LD 2QRXA 1KQGB 1VF5B 2KK7A 1LTAC 2N1TB 3Q3DA 4I7ZB 1XTGB 2GA1A 3RK2D 3BVHB 4EPUA 2ZJSE 3RK3C 2D2CC 4PD4I 1VQ7P 2D39A 1VQNP 4GKGA 3CXHH 3HE4A 1FZEC 3D6ZA 1S9KE 2ZXXA 4HYTB 2Q6QA 4RJTA 4JBZA 3CCMP 4JYBA 1RY3A 1L0LK 3L70E 2GUVA 2ZT9B 3V5BA 3NTNA 3TYYA 2OYHC 2HLOC 3B4SA 1AQ5A 3AE4C 3TGUD 2BCCD 1KILC 2K37A 3JCUE 2AXTH 3M9HA 1KQLA 1VQ6P 1HBWA 2IZ1A 4ZNCA 1IJDB 4YPCA 3HUSB 2E76B 1D7MA 3RGUA 2JDIH 1M57D 1MV8A 4BWNA 2OYIC 1FZBB 1VDFA 1NHLA 3H1IJ 5EFWB 3L4FA 1YJNP 2K9YA 3CC7P 1JY3N 4YXDC 1PPJG 4B86A 1NTMD 3GF3A 2QVAA 5GTHH 2WNPF 1OW8A 1PGJA 3E7KA 1BE3G 1CW5A 1ZN5A 3RK3B 4OH8B 1JY3P 2D2CB 3LIEA 3CWBJ 2NPSD 2W83C 1FZEB 3GLMA 4OGQC 1LGHB 3E1IC 3VMXA 1RE3C 2AEMA 2NPSA 1W5CE 2G3AA 3PJSK 1ZR4A 2KI7B 3H1HJ 1LTGC 2WQYC 1OWAA 2LXCB 3A0BH 3L72J 3P7KA 1ZR2A 1H0TA 1Y47A 2Q9IA 4EIJA 1RQUA 2AXTE 5AVWB 1OX3A 2C9NY 2Y9YA 3HD7B 2WSFJ 1JB0J 1M1JC 1P84D 3PRJA 2R5DA 2OYIB 5KJ7D 3AE7C 2M0BA 1N73A 1NU1E 2Y0DA 1T6AA 1KB9D 4NPDA 5CJ0A 1LT9B 3KQGA 5KJ7A 1BCCJ 3L71E 1X0TA 3H1JD 2I8DA 3A5TA 1DIPA 4U3FJ 3CPWO 1UIXA 2K9JA 4QMAA 5CMZA 3VYIA 1FS0E 2XNXA 5AVYB 2O01H 2OARA 2HFED 4WY4C 1QEXA 2L91A 1EDLA 1JCDA 3R2PA 4OGQB 2WPVB 1RE3B 3N4XA 1VF5D 2N1TD 1FZGA 3SSUA 1IFMA 3L36A 1SQBG 1PP9J 3BCCE 5E79H 3A0BE 1Q7YQ 1SQQK 4K3AA 3N7NA 3L74J 4A7PA 1NVOA 2JWAA 1JCCA 2J5UA 5M1BA 2JHMF 1IO4A 4HKZH 1SQQJ 2WT7B 2WPQA 1USDA 2B87A 3G6EP 1QLED 1ZOYC 4N78D 2J58A 3VN0A 2HODC 3V2PA 1L0LE 3H32A 2ZT9D 1VQKP 1IK7A 1FDIA 1W2BO 2ZVOB 1EDIA 1S3JA 2ZYGA 4M7FA 1EC5A 2YNYA 3VMAA 1RHZB 1SFCD 1PV3A 2E76D 3HE5B 5C39A 1SQPD 3H6PA 3AEGC 1SQVE 1FZCC 4XE5B 2J2PA 2WSSH 4GOEA 1BGYE 1SFCA 1KD1Q 2C9LY 3I55P 1LP1B 1NTZK 2FFDB 3K5BA 1FZBA 3SWFA 3L73E 4BRYB 2QA4P 3TGUG 1XTCC 3AECC 3U1CA 1A02J 2FBWC 2FYUD 5APYA 3RK3D 1HUCA 3P8CE 3CCVP 4JZCA 2D2CD 1X22A 4O9BA 3EFFK 2JP3A 2J60A 1JY2N 1Y8AA 2E74D 2Q3EA 2KLUA 3L72E 1AJYA 1KTMA 2HODB 2NRGA 1Q82Q 1JY2P 5GTIE 1L4AC 1T2KC 2OYHA 1KILD 2HLOA 3V6IA 2JHHC 3RL0B 4PV1B 1KILA 2YKOA 1BCCE 4LGDE 3FIBA 2Z4EC 3Q5RA 4EI2A 2OYIA 1RF0C 2BCCJ 3CCLP 3CD6P 5TISH 3AE5C 1IFDA 2RKLA 3R4YA 1NH4A 1Q81Q 1ZRTE 1R5SA 5APTA 4AYCA 4OGQD 1NTMJ 3RL0g 1PP9E 4XFJA 2YKQA 4ZMDA 2LXBA 2NZ2A 4I2LC 1BE3D 3E1IA 2XNDH 2PAJA 1RE3A 1Z3UA 1S1CX 4W80A 3L74E 1L4AB 5APXA 2KS1A 1U7MA 2QG4A 2I1KA 1SQQE 2XKMA 4UB6H 4RESB 2C0WA 1SQXD 2HR3A 3FWLA 1M1JA 1GL2C 1HWTC 2BEQD 2QIWA 2Z4EB 4HB1A 2KSEA 2IX7C 3OA7A 2XU6A 3O6QA 2V7QJ 2R5BA 3V2QA 1CSBA 2JEEA 5APWA 2QJYC 4IOIH 5TISE 4Z1MH 4ZKPA 1FAVA 3U1AA 3VMYA 2O01N 5KAIE 3VTPC 1QGKB 4WY4D 1W2EA 2KLVA 5AW8B 1OVUA 1NU1G 3PP5A 5AVTB 4PD4H 1FJKA 1NTZE 3H1JJ 4WY4A 3L71G 2YIUB 1R5LA 1JMMA 1YTZT 2Y0CA 3WMM0 2A06E 1IK9A 4D6TE 5AVZB 1NAFA 4UB6E 1JMBA 1OZHA 4Y28J 1FZDA 1SQBD 2W6BA 4Y99C 1GU4A 2HYNA 3BCCG 2A45G 3JCUH 1H8AA 1G2CA 1AQTA 5AVRB 2WSCH 2R32A 4K35A 2HODA 3M0DA 3G4SP 1YYCA 2QJYB 1AFOA 1WRGA 3A3YB 2IDBA 1RF1B 3H1LE 1OW7A 3TSIA 4DCKA 3GG2A 2XV5A 1EZVD 3SWKA 3TK1A 2Y0EA 2RH0A 3WUTA 1L0LG 4PD4E 3P32A 3ITKA 1GDTA 1LJ2A 1FZCA 3SFEC 1SQPK 1VQ5P 3AEAC 5B5EH 2Y9ZA 5AW0B 4WBAA 1K9MQ 1ZLLA 2H43C 3TNUB 4LC1A 3CX5D 1SQPJ 1VL2A 3JC22 3AE2C 1CI6A 3IF4A 1SQVG 4WB4A 2J0HA 3AE1C 1BGYG 4R9TA 2FYNC 4AUWA 3VMZA 4WVZA 4Y99B 3KHUA 5APQA 3L73G 1VQ8P 4C46A 2FYUJ 5KLVE 1LWUC 1TU3F 2OGUA 3S4RA 2PP6A 1JTHB 1FC2C 1L4AD 3HD7C 3MUDC 1T2KD 5L8RJ 2QM8A 2WZ7A 2YXQB 1L4AA 1KYOE 4N6JA 3NFQA 1LT9C 1KYOI 2G8YA 1R8EA 1G1IA 1FZFC 3LW5J 3AEBC 3MGNA 3QWOC 1PZQA 5B5EE 2KSJA 1P84I 2IYOA 1RF0A 2P1JA 3CCSP 2H43B 4GT1A 1S9KD 5K5GB 1N86C 2FXOA 3Q2YA 3MTUE 1KB9I 3L70D 1YTZI 3Q5SA 1SQXG 1SLQA 1JEKA 2ZYAA 2FYNB 4M3LA 1G1JA 3KZIE 2A45H 2JO1A 1PFIA 1U7JA 2WSEJ 1LWUB 1MZ9A 2ZVNB 5BU5A 4N3YB 2ZXEB 3HTKA 4JPZB 3SWYA 5CCHD 2JR8A 4GDOA 5DJTB 3FGAD 1KV4A 3LIDA 1YQ4C 1YJWP 5CCHA 2AEFA 3KPEA 3H1KE 1GD2E 3RBXA 3B5NC 1BE3J 2FY8A 5AVSB 2J61B 1WT6A 3VP9A 1GL2D 2P7JA 1FZFB 1VQLP 4H44D 3L75E 2QJKC 2B9BA 1GL2A 1HGVA 1OMIA 2P2UA 1DEEG 1GMJA 3QH9A 5CJ4A 3CXHD 3CMAP 4C7NB 1N86B 1IFJA 2FXMA 2KP8A 3FXDA 1A02F 1T3JA 3EQ2A 2OTJP 3W68A 2FFDC 2WPSA 4U7JA 1L0NG 3A0HE 4W7YA 2K1AA 2QSIA 4HH2A 1S72P 1DX7A 1NTKG 3ZDMA 2N1TA 1BDCA 1SQPE 3FXEA 3BVHA 1LTJB 4R9JA 1Q2NA 2B88A 4UB8E 1T8ZA 3L37A 1NU1D 1EZVG 3KYQA 1AV1A 1KMIZ 1NTZG 1S4XA 3B5NB 3L71D 5CBOA 2IBZE 2HG5D 5GTIH 4L74A 2WSFH 2QJKB 2L5GB 5TJHA 2IBZI 1J1DB 2M5AB 3RL0C 4PV1C 1SQBK 3G71P 3H1IE 3IAOA 2A06G 1HH0A 4D6TG 1KN7A 4HJGH 1M90Q 2WTYA 3HUSA 1SQBJ 1FZAB 1VQ9P 2M3EA 3BCCD 3IR9A 1NKNA 2IFMA 4H0LC 2W90A 2KZIA 3VOPA 3CWBE 3IFMA 4I6MC 2SPZA 1UIIA 3CC4P 2IPPA 1HJ0A 3H1LG 5AVXB 1QVFO 2LR2A 4YXWH 4RKUJ 1FOSF 3H1HE 5KAFE 3T97B 1LTIC 5AW7B 1L0LD 1JO5A 1FZEA 2E5YA 1QX8A 4L73A 2QM7A 2PGDA 1S2EA 2KNCB 2KOGA 2N9YB 1QL1A 1PPJE 3HD7D 3C9IA 1QL2A 1SQVD 1DD3A 1BGYD 1GZLA 4BXLA 1FBMA 3HD7A 3MUDA 3L70G 4RO0A 2JHIF 3TGUJ 4U3FE 3L73D 2PRRA 1N8RQ 4H0LB 5KLVG 4EOTA 1LT9A 1ZMEC 3P8CD 2J61A 1KZUB 1OFCX 1RQVA 1NTMK 1VQPP 1JNMA 2I1JA 2KIKA 3L35A 5KAIH 5APSA 3HE4B 1N7LA 3L72D 4CPGA 1MFZA 3FWNA 3CCEP 3CCQP 1SVFA 2GM4A 2P58A 4C7NA 4TLFA 3V2NA 2ITAA 1HGZA 2YIUC 4I1LA 5B66H 2OTKE 1LT1A 3E1RA 4TT3H 4L75A 1K05A 1BCCD 2IYPA 2HPCC 1PGPA 3GF7A 5KTBA 4MN4C 2WPRA 1N73C 2WWWA 2WT7A 4GODA 3Q5PA 2ZAEB 1NOHA 4R4MA 2J3UA 2M3BA 2H88C 2P10A 3WUUA 3MZWB 2QJPC 4GIFA 1PGQA 4ASWA 4DOJA 1ZRTD 1RF1C 3AE6C 1JY3O 2N9BA 4H13C 1QVGO 3ABVC 3H1KG 4DT0A 3HE5A 3BASA 1KFMA 1LTTC 1Z56A 1LP1A 3L75G 2FFDA 2O3JA 2Q1KA 3L74D 2YMKA 1IC2A 1H0TB 2CPBA 1FICA 1SQQD 5B66E 1PIXA 4BRYA 2M8RA 3G9RA 1EDJA 1EZVI 4LLHA 4JYOX 2YO2A 1X9VA 3KDPB 2HPCB 1L0ND 4KT0J 1Y9BA 3TDKA 1J2JB 1N73B 1NTKD 3AEEC 1KQSO 3T97A 1YQ3C 2XDJA 3M06A 2QE7H 2J3OA 1LNQA 3CX5I 2RN0A 2QJPB 1HVVA 2K9JB 3RL0D 2KNCA 2W27A 4PV1D 2XNXB 4L76A 1KYOH 1M7LA 1NU1J 3C8VA 1S5LE 3WU2E 3TGUE 4H13B 2BCCE 2LKMA 3L71J 5AW3B 1NTZD 3CL3D 2V7QH 5AVVB 1DD4A 2PFXA 3AE3C 1JM0A 1L2PA 2B89A 3II6A 1OW6A 3Q1MA 5AVQB 3V4WA 2H89C 5H2FE 2XZRA 2Q5UA 1ZXGA 1KB9H 4JF7A 3H1IG 3M0AA 2A06D 2DW3A 4D6TD 1NTME 4IFDK 1YI2P 3KXDA 2E75C 2FYUK 3USSA 1AVYA 3BCCJ 3KZIH 1OVRA 1GU5A 1FOSE 2B87B 2Q3IA 2E74C 3H32B 3CWBG 4XA4A 4KHXA 2J64A 3CMEP 1JOCA 2ZYDA 3GW6A 3H1LD 5BU8B 1LTBC 3PLNA 1NWQA 3H1HG 1L0LJ 1YIJP 3V2RA 3L72G 4PD4D 5APUA 1YBKA 3OAKA 2J59M 1SFCB 1VQMP 1MFTA 3A7OA 3W67A 1P84E 1SQVK 1USEA 5DJUB 2H8PD 2O01J 2Z4EA 2WMMA 1BDDA 3CC2P 1SQVJ 1YJ9P 1KB9E 2JHLF 1BGYJ 2WVRA 1KFNA 1WMKA 3CCRP 4WWIA 3H1JE 1ZP0C 1OXZA 2E75B 1BCCG 5AW5B 3L73J 3A0HH 3CLQA 2FXPA 2KB7P 1N7SC 2R3CA 4U3FG 1K8AQ 5KLVD 3CXHE 2E74B 1J1EC 2IFNA 5AW9B 5AW1B 2KXPB 1LTJC 3CXHI 1JY2O 1PGOA 2OYHB 2HLOB 1YHQP 1KYOD 4UB8H 1EQ7A 3NMDA 1GTWA 1KILB 1AA0A 1PP9G 5APVA 2OTLP 2GUSA 3AE8C 3AEDC 4KJMA 4PJ0H 1SS1A 3RBZA 2HPCA 4OWFA 4NPEA 1J1DC 3L74G 1SQXK 2J0YA 3JSVC 1SQQG 5KKZC 4N78E 2VRSA 1X8YA 5GTHE 5CHXA 1SQXJ 2C0XA 2ZFCA 2YKPA 5CCGC 3D71A 3B71A 1VPCA 1FZAC 2KZJA 4H13D 4IFFA 5KLIC 3LW5H 1RF1A 3U59A 5AW2B 2J5ZA 1N7SB 2FYZA 3I56P 1H89A 2YMYA 2POHA 1J1EB 3E1IB 2J3GA 3S9OA 1X79B 2V4HA 2OQQA 3F89A 2KS1B 2AXCA 3GHGC 1N2DC 3H1KD 1BSHA 5KAFH 3B8EB 3TNUA 4W7ZA 1URQC 2R44A 2WSEH 2FYUE 3RK3E 1IFNA 2A45I 1M1JB 3L75D 4R4LA 4PJ0E 1FIBA 1IFPA 1RE4C 3TF5A 1T3UA 2Z5HA 1L0NK 3O6QB 4EYYQ 2YO3A 4ASVA 2O1KA 5KKZB 3M0DC 5AW6B 2J0GA 1NTKK 1EDKA 4EDFA 1K04A 1L0NJ 1JTHA 3PHLA 1FU1A 2J1GA 3GMAA 5KLIB 1NTKJ 3M9BA 1KILE 3VP8A 3I5CA 3CCJP 4WY4B 1U57A 4ZKUA 1AVOA 1VQ4P 3RK2C 1NKZB 1NGMB 1YITP 4JYCA 3HRNA 2E43A 3GHGB 1NTZJ 1SP4A 5E79E 2H43A 2BCCG 1URQB 2E75D 2IBZD 3FX0A 1M1KQ 3BATA 5AVUB 1H88A 2JKVA 2UWJE 5BVZA 1RE4B 1BSNA 4DJGA 3SFDC 4M7HA 1G2CB 4D6TJ 3H1ID 3AEFC
chains in the Genus database with same CATH topology
3HE5A 2HFED 4WY4C 1LWUA 1JCDA 3R2PA 2PP6A 1JTHB 1L4AD 3BASA 3HD7C 1T2KD 1RE3B 1KFMA 1LTTC 1Z56A 1HJBA 3N4XA 2FFDA 2N1TD 1FZGA 1IFMA 3L36A 2QM8A 2WZ7A 4C7RA 1IC2A 1L4AA 2CPBA 4N6JA 1FICA 3NFQA 4IFMA 1DEBA 1LT9C 2P67A 2M8RA 1MUUA 3UIAA 1SQQK 4LLHA 4JYOX 1G1IA 1IFIA 2YO2A 1FZCB 1FZFC 1X9VA 3KDPB 1Z3SA 3N7NA 1FZFA 2HPCB 3RK2B 3MGNA 3A2AA 1JCCA 2JHMF 1J2JB 2KSJA 1IO4A 2WT7B 2WPQA 1N73B 3O8ZA 1RF0A 2P1JA 2H43B 2JJLA 4GT1A 3T97A 4N78D 1S9KD 2J58A 2XDJA 3VN0A 1N86C 3MIWA 3H32A 1CI6B 3M06A 3V2PA 2HODC 2J3OA 1N86A 2NPSC 3MTUE 1GK6A 1N7SD 1YTZI 1HVVA 1SLQA 4M7FA 3RL0D 2Q7CA 2W27A 4M3LA 2XNXB 1G1JA 1ZV8A 2GY7A 4AQRD 1M7LA 1FJPA 1N7SA 2YNYA 2A45H 2Q9IC 3BRVB 3NXSA 1PFIA 1SFCD 2LKMA 3HE5B 1LWUB 5AW3B 1MZ9A 3CL3D 5BU5A 4N3YB 2ZXEB 5AVVB 3H6PA 5KLVK 1FZCC 4XE5B 2J2PA 3HTKA 3G3ZA 1SFCA 3SWYA 5CCHD 2C9LY 2O1JA 1LTJA 1NTZK 2W6AA 2Z5IA 2FFDB 3II6A 5CCHC 3LIDA 1FZBA 5AVQB 3SWFA 3V4WA 5CCHA 3KPEA 2XZRA 5AW4B 2Q5UA 3B5ND 5KJ7C 1XTCC 1HTLC 4JF7A 3U1CA 1A02J 1GD2E 3M0AA 5APYA 3RK3D 3M9QA 3B5NC 1HUCA 3P8CE 5AVSB 2J61B 4JZCA 1WT6A 3VP9A 4IFDK 1GL2D 2P7JA 3B5NA 1FZFB 4O9BA 2FYUK 2BASA 2J60A 2XNXC 1JY2N 1GU5A 1GL2A 1HGVA 2P2UA 1FOSE 1RF0B 1LTSC 1CZQA 5CJ4A 1E5WA 2Q3IA 1GW4A 3H32B 2WITA 1NO4A 5CCGD 1GW3A 4XA4A 2HODB 3CI9A 4C7NB 1IFJA 1N86B 4KHXA 2J64A 2FXMA 2NPSB 2KP8A 1A02F 1JY2P 3BRTB 1T3JA 1JOCA 3EQ2A 2FFDC 2WPSA 1FZGC 5CCGA 1FZAA 5BU8B 1L4AC 1LTBC 1T2KC 2OYHA 1KILD 2HLOA 4W7YA 1JUNA 2JHHC 2KYVA 2N1TC 3RL0B 1NWQA 4NYTA 2Q9IB 4HH2A 1DX7A 2N1TA 3V2RA 1KILA 2YKOA 3BVHC 3MD0A 3HTKB 3M91A 5APUA 3OAKA 2J59M 1SFCB 3BVHA 2E42A 2J3FD 1LTJB 4R9JA 3A7OA 1SQVK 4LGDE 2MJZA 3FIBA 2Z4EC 2H8PD 1FIDA 2OYIA 1RF0C 1URQD 2J3FA 2Z4EA 4DZOA 3P8MC 2FIBA 1T8ZA 2FKWB 3GHGA 3L37A 3V4QA 3KYQA 2JHKF 3H32C 2JHLF 4ZFGA 1URQA 1KFNA 3B5NB 1IFDA 1NU1K 2HG5D 1NH4A 1OXZA 2WSFH 1JC9A 5AW5B 1GL2B 2L5GB 3CLQA 3EFGA 2KB7P 1N7SC 2R3CA 1RE4A 1J1DB 2H7HA 5APTA 1GK4A 3RL0C 4AYCA 1SQBK 2YKQA 1J1EC 1HH0A 2IFNA 3HUSC 5AW1B 1SFCC 2CPSA 5AW9B 1FDMA 4I2LC 2WTYA 1LTJC 3HUSA 1JY2O 3E1IA 2PAJA 1RE3A 1FZAB 1DH3A 1Z3UA 3OJAB 4W80A 1FZGB 1FZBC 2OYHB 2HLOB 1L4AB 5APXA 1EQ7A 3IR9A 3NMDA 1NKNA 2IFMA 2I1KA 2N1TB 1LTAC 1GTWA 2XKMA 1KILB 3VOPA 1XTGB 4RESB 3IFMA 5APVA 4I6MC 2GUSA 3RK2D 3BVHB 2C0WA 4EPUA 3RK3C 2IPPA 1M1JA 2HPCA 5AVXB 1GL2C 1HWTC 2Z4EB 1J1DC 2D39A 1SQXK 2J0YA 4GKGA 2IX7C 1FOSF 3OA7A 2XU6A 3HE4A 1FZEC 1LTIC 5AW7B 4N78E 1S9KE 2VRSA 1X8YA 2R5BA 1JO5A 1FZEA 3V2QA 1CSBA 4HYTB 2JEEA 5APWA 5CHXA 2C0XA 4JYBA 2ZFCA 2YKPA 1RY3A 2QM7A 5CCGC 4ZKPA 1L0LK 1VPCA 1FZAC 2GUVA 3V5BA 4IFFA 3NTNA 2KOGA 1FAVA 3LW5H 3TYYA 3U1AA 1RF1A 3U59A 2OYHC 2HLOC 3VMYA 1AQ5A 5AW2B 2J5ZA 1N7SB 1QL1A 3VTPC 4WY4D 1W2EA 2KLVA 5AW8B 2FYZA 1KILC 3PP5A 3M9HA 5AVTB 1KQLA 1FJKA 3HD7D 1H89A 2YMYA 3C9IA 1QL2A 1HBWA 2POHA 1J1EB 4WY4A 1IJDB 3HUSB 3E1IB 1GZLA 1FBMA 2J3GA 3HD7A 3MUDA 1X79B 1MV8A 2JHIF 2OYIC 1FZBB 1JMMA 1VDFA 1NHLA 3GHGC 1N2DC 3L4FA 1JY3N 1YTZT 3B8EB 3TNUA 4W7ZA 1URQC 3WMM0 4EOTA 4B86A 2WSEH 1IK9A 1LT9A 3P8CD 1IFNA 2WNPF 2A45I 5AVZB 1NAFA 2J61A 1KZUB 1FZDA 1CW5A 1M1JB 1ZN5A 1NTMK 3RK3B 1JNMA 4OH8B 1JY3P 1FIBA 1RE4C 2I1JA 3L35A 2W6BA 4Y99C 5APSA 1T3UA 1GU4A 3LIEA 2Z5HA 2HYNA 1L0NK 3HE4B 1N7LA 2A45G 1H8AA 2YO3A 2NPSD 1G2CA 1MFZA 5AVRB 1FZEB 2O1KA 3M0DC 5AW6B 2J0GA 1SVFA 2GM4A 2WSCH 2R32A 4C7NA 2HODA 1NTKK 1LGHB 3M0DA 1YYCA 3E1IC 3VMXA 1RE3C 1AFOA 2NPSA 1WRGA 3A3YB 1JTHA 1FU1A 2J1GA 1RF1B 3V2NA 1ZR4A 1HGZA 3TSIA 1LTGC 4I1LA 3M9BA 2XV5A 3VP8A 1OWAA 3P7KA 1ZR2A 2Q9IA 3TK1A 3I5CA 4EIJA 4WY4B 5AVWB 3P32A 1GDTA 2C9NY 4ZKUA 1FZCA 3HD7B 1SQPK 1M1JC 2HPCC 5KTBA 3RK2C 1NKZB 5AW0B 4WBAA 2WPRA 2R5DA 4JYCA 2OYIB 5KJ7D 1N73C 3HRNA 2E43A 2WWWA 1ZLLA 2WT7A 3GHGB 2H43C 1N73A 3TNUB 4LC1A 1SP4A 2J3UA 1NOHA 5CJ0A 2H43A 1LT9B 2M3BA 3KQGA 1URQB 5KJ7A 1CI6A 4WB4A 3BATA 2J0HA 4GIFA 4DOJA 3A5TA 1RF1C 4R9TA 4AUWA 5AVUB 1JY3O 1H88A 3VMZA 5CMZA 2N9BA 3VYIA 5BVZA 1RE4B 2XNXA 5AVYB 4Y99B 5APQA 2O01H 4C46A 1G2CB 4M7HA 2OARA 1LWUC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LT9 A;  1LWU A;  2WNP F;  4JZC A;  3HUS C;  2J61 B;  2A45 I;  2J61 A;  1LTJ C;  1FZF B;  3HUS A;  1FZD A;  1JY2 O;  3E1I A;  1RE3 B;  1RE3 A;  1M1J B;  1FZA B;  1Z3U A;  1FZG B;  1JY3 P;  2FFD A;  1FIB A;  1FZG A;  2OYH B;  1RE4 C;  1FZB C;  2J60 A;  2XNX C;  2HLO B;  1JY2 N;  1RF0 B;  1T3U A;  1FIC A;  2A45 G;  3H32 B;  1LT9 C;  1FZE B;  2J0G A;  1N86 B;  2HOD B;  2HOD A;  2J64 A;  4JYO X;  3BVH B;  1FZC B;  1FZF C;  3E1I C;  4EPU A;  1RE3 C;  1JY2 P;  1Z3S A;  1FZF A;  2FFD C;  2J1G A;  1RF1 B;  2HPC B;  1FZG C;  1M1J A;  2HPC A;  1FZA A;  2JHM F;  2Z4E B;  2OYH A;  2D39 A;  2HLO A;  1N73 B;  2J0Y A;  2JHH C;  1RF0 A;  4NYT A;  2Q9I B;  2Q9I A;  2H43 B;  1FZE C;  1N86 C;  2HOD C;  3H32 A;  1FZE A;  3BVH C;  2J3O A;  1N86 A;  3BVH A;  2J3F D;  1LTJ B;  1FZC A;  4R9J A;  1M1J C;  2HPC C;  1FZA C;  4M7F A;  1RF1 A;  2OYH C;  3FIB A;  2Z4E C;  2XNX B;  2HLO C;  2GY7 A;  1FID A;  2OYI B;  2OYI A;  1RF0 C;  1N73 C;  2J3F A;  2J5Z A;  2Z4E A;  2Q9I C;  2A45 H;  2FIB A;  3GHG B;  2H43 C;  1N73 A;  3GHG A;  1W2E A;  2JHK F;  2J3U A;  3H32 C;  2H43 A;  1LT9 B;  1LWU B;  2JHL F;  4ZFG A;  1FZC C;  2J2P A;  3HUS B;  3E1I B;  2J0H A;  1LTJ A;  2J3G A;  1RF1 C;  2FFD B;  4R9T A;  1JC9 A;  1JY3 O;  2JHI F;  2OYI C;  1FZB B;  1RE4 B;  1FZB A;  2XNX A;  1RE4 A;  3GHG C;  4M7H A;  1JY3 N;  1LWU C; 
#chains in the Genus database with same CATH topology
 1LWU A;  1NTM G;  1BE3 E;  3MHV A;  2OYO A;  1HJB A;  4OVN F;  1HF9 A;  2RMZ A;  4C7R A;  4NPF X;  4IFM A;  2MKV A;  1DEB A;  5CBN A;  1M8O B;  3CWB D;  2P67 A;  1MUU A;  3UIA A;  1IFI A;  1FZC B;  3H1L J;  1Z3S A;  1SQX E;  1FZF A;  3RK2 B;  3A2A A;  1KOR A;  3H1H D;  3O8Z A;  2R3S A;  2JJL A;  3MIW A;  1CI6 B;  3PH0 A;  1N86 A;  2NPS C;  3F5H A;  1GK6 A;  1IZN B;  1N7S D;  2Q7C A;  4JQ0 D;  1K73 Q;  1ZV8 A;  2GY7 A;  4AQR D;  1FJP A;  1EXJ A;  1N7S A;  2Q9I C;  1PPJ D;  3BRV B;  4IL6 X;  1EXI A;  3NXS A;  2IZ0 A;  3AE9 C;  2CK3 H;  1VQO P;  2K88 A;  1FDO A;  1NYH A;  5KLV K;  2BEZ F;  3L70 J;  2AEJ A;  3WUV A;  3EWK A;  3G3Z A;  3H1J G;  1RH5 B;  2O1J A;  1LTJ A;  2W6A A;  2Z5I A;  4GOF A;  5CCH C;  4U3F D;  1S5L X;  5KLV J;  3D70 A;  3CX5 H;  4IL6 H;  1Q90 D;  5AW4 B;  3B5N D;  5KJ7 C;  1HTL C;  1NJI Q;  2WSC J;  3M9Q A;  3IN6 A;  3B5N A;  3MP7 B;  1L0N E;  2BAS A;  2XNX C;  1SQB E;  4H44 C;  3CCU P;  1S5L H;  3WU2 H;  1RF0 B;  3H25 A;  2K3R A;  1LTS C;  1CZQ A;  1NTK E;  2M5A A;  1E5W A;  1PP9 D;  3OW2 O;  1GW4 A;  2WIT A;  1NO4 A;  5CCG D;  1GW3 A;  3CI9 A;  3S1K A;  3C1L A;  2NPS B;  3BRT B;  1FZG C;  5CCG A;  1FZA A;  3PTZ A;  2W6J H;  5H2F H;  1JUN A;  1VF5 C;  1EZV E;  2KYV A;  1PL5 A;  2N1T C;  4NYT A;  2Q9I B;  1E79 H;  1KQF B;  1KC8 Q;  4I7Z C;  1FE6 A;  3BVH C;  3MD0 A;  3HTK B;  3M91 A;  2JWD A;  2E42 A;  2J3F D;  1MKM A;  2MJZ A;  1FID A;  2YXR B;  2J3F A;  1URQ D;  3D6Y A;  1M56 D;  4DZO A;  3P8M C;  2FIB A;  2FKW B;  3GHG A;  3V4Q A;  1NAY A;  3CX5 E;  2JHK F;  4IL6 E;  3H32 C;  4ZFG A;  1URQ A;  1SQP G;  2W8Z A;  1NU1 K;  2ZT9 C;  1JC9 A;  1GL2 B;  2QEX P;  3H1K J;  3EFG A;  2E5T A;  1ZW0 A;  1RE4 A;  4H44 B;  2H7H A;  1GK4 A;  1OIP A;  1Q86 Q;  2FYU G;  2KUB A;  3HUS C;  1SFC C;  2CPS A;  2E76 C;  3L75 J;  1FDM A;  4YTP C;  2IBZ G;  1P84 H;  1DH3 A;  3OJA B;  1FZG B;  1OVV A;  1FZB C;  4H0L D;  2QRX A;  1KQG B;  1VF5 B;  2KK7 A;  1LTA C;  2N1T B;  3Q3D A;  4I7Z B;  1XTG B;  2GA1 A;  3RK2 D;  3BVH B;  4EPU A;  2ZJS E;  3RK3 C;  2D2C C;  4PD4 I;  1VQ7 P;  2D39 A;  1VQN P;  4GKG A;  3CXH H;  3HE4 A;  1FZE C;  3D6Z A;  1S9K E;  2ZXX A;  4HYT B;  2Q6Q A;  4RJT A;  4JBZ A;  3CCM P;  4JYB A;  1RY3 A;  1L0L K;  3L70 E;  2GUV A;  2ZT9 B;  3V5B A;  3NTN A;  3TYY A;  2OYH C;  2HLO C;  3B4S A;  1AQ5 A;  3AE4 C;  3TGU D;  2BCC D;  1KIL C;  2K37 A;  3JCU E;  2AXT H;  3M9H A;  1KQL A;  1VQ6 P;  1HBW A;  2IZ1 A;  4ZNC A;  1IJD B;  4YPC A;  3HUS B;  2E76 B;  1D7M A;  3RGU A;  2JDI H;  1M57 D;  1MV8 A;  4BWN A;  2OYI C;  1FZB B;  1VDF A;  1NHL A;  3H1I J;  5EFW B;  3L4F A;  1YJN P;  2K9Y A;  3CC7 P;  1JY3 N;  4YXD C;  1PPJ G;  4B86 A;  1NTM D;  3GF3 A;  2QVA A;  5GTH H;  2WNP F;  1OW8 A;  1PGJ A;  3E7K A;  1BE3 G;  1CW5 A;  1ZN5 A;  3RK3 B;  4OH8 B;  1JY3 P;  2D2C B;  3LIE A;  3CWB J;  2NPS D;  2W83 C;  1FZE B;  3GLM A;  4OGQ C;  1LGH B;  3E1I C;  3VMX A;  1RE3 C;  2AEM A;  2NPS A;  1W5C E;  2G3A A;  3PJS K;  1ZR4 A;  2KI7 B;  3H1H J;  1LTG C;  2WQY C;  1OWA A;  2LXC B;  3A0B H;  3L72 J;  3P7K A;  1ZR2 A;  1H0T A;  1Y47 A;  2Q9I A;  4EIJ A;  1RQU A;  2AXT E;  5AVW B;  1OX3 A;  2C9N Y;  2Y9Y A;  3HD7 B;  2WSF J;  1JB0 J;  1M1J C;  1P84 D;  3PRJ A;  2R5D A;  2OYI B;  5KJ7 D;  3AE7 C;  2M0B A;  1N73 A;  1NU1 E;  2Y0D A;  1T6A A;  1KB9 D;  4NPD A;  5CJ0 A;  1LT9 B;  3KQG A;  5KJ7 A;  1BCC J;  3L71 E;  1X0T A;  3H1J D;  2I8D A;  3A5T A;  1DIP A;  4U3F J;  3CPW O;  1UIX A;  2K9J A;  4QMA A;  5CMZ A;  3VYI A;  1FS0 E;  2XNX A;  5AVY B;  2O01 H;  2OAR A;  2HFE D;  4WY4 C;  1QEX A;  2L91 A;  1EDL A;  1JCD A;  3R2P A;  4OGQ B;  2WPV B;  1RE3 B;  3N4X A;  1VF5 D;  2N1T D;  1FZG A;  3SSU A;  1IFM A;  3L36 A;  1SQB G;  1PP9 J;  3BCC E;  5E79 H;  3A0B E;  1Q7Y Q;  1SQQ K;  4K3A A;  3N7N A;  3L74 J;  4A7P A;  1NVO A;  2JWA A;  1JCC A;  2J5U A;  5M1B A;  2JHM F;  1IO4 A;  4HKZ H;  1SQQ J;  2WT7 B;  2WPQ A;  1USD A;  2B87 A;  3G6E P;  1QLE D;  1ZOY C;  4N78 D;  2J58 A;  3VN0 A;  2HOD C;  3V2P A;  1L0L E;  3H32 A;  2ZT9 D;  1VQK P;  1IK7 A;  1FDI A;  1W2B O;  2ZVO B;  1EDI A;  1S3J A;  2ZYG A;  4M7F A;  1EC5 A;  2YNY A;  3VMA A;  1RHZ B;  1SFC D;  1PV3 A;  2E76 D;  3HE5 B;  5C39 A;  1SQP D;  3H6P A;  3AEG C;  1SQV E;  1FZC C;  4XE5 B;  2J2P A;  2WSS H;  4GOE A;  1BGY E;  1SFC A;  1KD1 Q;  2C9L Y;  3I55 P;  1LP1 B;  1NTZ K;  2FFD B;  3K5B A;  1FZB A;  3SWF A;  3L73 E;  4BRY B;  2QA4 P;  3TGU G;  1XTC C;  3AEC C;  3U1C A;  1A02 J;  2FBW C;  2FYU D;  5APY A;  3RK3 D;  1HUC A;  3P8C E;  3CCV P;  4JZC A;  2D2C D;  1X22 A;  4O9B A;  3EFF K;  2JP3 A;  2J60 A;  1JY2 N;  1Y8A A;  2E74 D;  2Q3E A;  2KLU A;  3L72 E;  1AJY A;  1KTM A;  2HOD B;  2NRG A;  1Q82 Q;  1JY2 P;  5GTI E;  1L4A C;  1T2K C;  2OYH A;  1KIL D;  2HLO A;  3V6I A;  2JHH C;  3RL0 B;  4PV1 B;  1KIL A;  2YKO A;  1BCC E;  4LGD E;  3FIB A;  2Z4E C;  3Q5R A;  4EI2 A;  2OYI A;  1RF0 C;  2BCC J;  3CCL P;  3CD6 P;  5TIS H;  3AE5 C;  1IFD A;  2RKL A;  3R4Y A;  1NH4 A;  1Q81 Q;  1ZRT E;  1R5S A;  5APT A;  4AYC A;  4OGQ D;  1NTM J;  3RL0 g;  1PP9 E;  4XFJ A;  2YKQ A;  4ZMD A;  2LXB A;  2NZ2 A;  4I2L C;  1BE3 D;  3E1I A;  2XND H;  2PAJ A;  1RE3 A;  1Z3U A;  1S1C X;  4W80 A;  3L74 E;  1L4A B;  5APX A;  2KS1 A;  1U7M A;  2QG4 A;  2I1K A;  1SQQ E;  2XKM A;  4UB6 H;  4RES B;  2C0W A;  1SQX D;  2HR3 A;  3FWL A;  1M1J A;  1GL2 C;  1HWT C;  2BEQ D;  2QIW A;  2Z4E B;  4HB1 A;  2KSE A;  2IX7 C;  3OA7 A;  2XU6 A;  3O6Q A;  2V7Q J;  2R5B A;  3V2Q A;  1CSB A;  2JEE A;  5APW A;  2QJY C;  4IOI H;  5TIS E;  4Z1M H;  4ZKP A;  1FAV A;  3U1A A;  3VMY A;  2O01 N;  5KAI E;  3VTP C;  1QGK B;  4WY4 D;  1W2E A;  2KLV A;  5AW8 B;  1OVU A;  1NU1 G;  3PP5 A;  5AVT B;  4PD4 H;  1FJK A;  1NTZ E;  3H1J J;  4WY4 A;  3L71 G;  2YIU B;  1R5L A;  1JMM A;  1YTZ T;  2Y0C A;  3WMM 0;  2A06 E;  1IK9 A;  4D6T E;  5AVZ B;  1NAF A;  4UB6 E;  1JMB A;  1OZH A;  4Y28 J;  1FZD A;  1SQB D;  2W6B A;  4Y99 C;  1GU4 A;  2HYN A;  3BCC G;  2A45 G;  3JCU H;  1H8A A;  1G2C A;  1AQT A;  5AVR B;  2WSC H;  2R32 A;  4K35 A;  2HOD A;  3M0D A;  3G4S P;  1YYC A;  2QJY B;  1AFO A;  1WRG A;  3A3Y B;  2IDB A;  1RF1 B;  3H1L E;  1OW7 A;  3TSI A;  4DCK A;  3GG2 A;  2XV5 A;  1EZV D;  3SWK A;  3TK1 A;  2Y0E A;  2RH0 A;  3WUT A;  1L0L G;  4PD4 E;  3P32 A;  3ITK A;  1GDT A;  1LJ2 A;  1FZC A;  3SFE C;  1SQP K;  1VQ5 P;  3AEA C;  5B5E H;  2Y9Z A;  5AW0 B;  4WBA A;  1K9M Q;  1ZLL A;  2H43 C;  3TNU B;  4LC1 A;  3CX5 D;  1SQP J;  1VL2 A;  3JC2 2;  3AE2 C;  1CI6 A;  3IF4 A;  1SQV G;  4WB4 A;  2J0H A;  3AE1 C;  1BGY G;  4R9T A;  2FYN C;  4AUW A;  3VMZ A;  4WVZ A;  4Y99 B;  3KHU A;  5APQ A;  3L73 G;  1VQ8 P;  4C46 A;  2FYU J;  5KLV E;  1LWU C;  1TU3 F;  2OGU A;  3S4R A;  2PP6 A;  1JTH B;  1FC2 C;  1L4A D;  3HD7 C;  3MUD C;  1T2K D;  5L8R J;  2QM8 A;  2WZ7 A;  2YXQ B;  1L4A A;  1KYO E;  4N6J A;  3NFQ A;  1LT9 C;  1KYO I;  2G8Y A;  1R8E A;  1G1I A;  1FZF C;  3LW5 J;  3AEB C;  3MGN A;  3QWO C;  1PZQ A;  5B5E E;  2KSJ A;  1P84 I;  2IYO A;  1RF0 A;  2P1J A;  3CCS P;  2H43 B;  4GT1 A;  1S9K D;  5K5G B;  1N86 C;  2FXO A;  3Q2Y A;  3MTU E;  1KB9 I;  3L70 D;  1YTZ I;  3Q5S A;  1SQX G;  1SLQ A;  1JEK A;  2ZYA A;  2FYN B;  4M3L A;  1G1J A;  3KZI E;  2A45 H;  2JO1 A;  1PFI A;  1U7J A;  2WSE J;  1LWU B;  1MZ9 A;  2ZVN B;  5BU5 A;  4N3Y B;  2ZXE B;  3HTK A;  4JPZ B;  3SWY A;  5CCH D;  2JR8 A;  4GDO A;  5DJT B;  3FGA D;  1KV4 A;  3LID A;  1YQ4 C;  1YJW P;  5CCH A;  2AEF A;  3KPE A;  3H1K E;  1GD2 E;  3RBX A;  3B5N C;  1BE3 J;  2FY8 A;  5AVS B;  2J61 B;  1WT6 A;  3VP9 A;  1GL2 D;  2P7J A;  1FZF B;  1VQL P;  4H44 D;  3L75 E;  2QJK C;  2B9B A;  1GL2 A;  1HGV A;  1OMI A;  2P2U A;  1DEE G;  1GMJ A;  3QH9 A;  5CJ4 A;  3CXH D;  3CMA P;  4C7N B;  1N86 B;  1IFJ A;  2FXM A;  2KP8 A;  3FXD A;  1A02 F;  1T3J A;  3EQ2 A;  2OTJ P;  3W68 A;  2FFD C;  2WPS A;  4U7J A;  1L0N G;  3A0H E;  4W7Y A;  2K1A A;  2QSI A;  4HH2 A;  1S72 P;  1DX7 A;  1NTK G;  3ZDM A;  2N1T A;  1BDC A;  1SQP E;  3FXE A;  3BVH A;  1LTJ B;  4R9J A;  1Q2N A;  2B88 A;  4UB8 E;  1T8Z A;  3L37 A;  1NU1 D;  1EZV G;  3KYQ A;  1AV1 A;  1KMI Z;  1NTZ G;  1S4X A;  3B5N B;  3L71 D;  5CBO A;  2IBZ E;  2HG5 D;  5GTI H;  4L74 A;  2WSF H;  2QJK B;  2L5G B;  5TJH A;  2IBZ I;  1J1D B;  2M5A B;  3RL0 C;  4PV1 C;  1SQB K;  3G71 P;  3H1I E;  3IAO A;  2A06 G;  1HH0 A;  4D6T G;  1KN7 A;  4HJG H;  1M90 Q;  2WTY A;  3HUS A;  1SQB J;  1FZA B;  1VQ9 P;  2M3E A;  3BCC D;  3IR9 A;  1NKN A;  2IFM A;  4H0L C;  2W90 A;  2KZI A;  3VOP A;  3CWB E;  3IFM A;  4I6M C;  2SPZ A;  1UII A;  3CC4 P;  2IPP A;  1HJ0 A;  3H1L G;  5AVX B;  1QVF O;  2LR2 A;  4YXW H;  4RKU J;  1FOS F;  3H1H E;  5KAF E;  3T97 B;  1LTI C;  5AW7 B;  1L0L D;  1JO5 A;  1FZE A;  2E5Y A;  1QX8 A;  4L73 A;  2QM7 A;  2PGD A;  1S2E A;  2KNC B;  2KOG A;  2N9Y B;  1QL1 A;  1PPJ E;  3HD7 D;  3C9I A;  1QL2 A;  1SQV D;  1DD3 A;  1BGY D;  1GZL A;  4BXL A;  1FBM A;  3HD7 A;  3MUD A;  3L70 G;  4RO0 A;  2JHI F;  3TGU J;  4U3F E;  3L73 D;  2PRR A;  1N8R Q;  4H0L B;  5KLV G;  4EOT A;  1LT9 A;  1ZME C;  3P8C D;  2J61 A;  1KZU B;  1OFC X;  1RQV A;  1NTM K;  1VQP P;  1JNM A;  2I1J A;  2KIK A;  3L35 A;  5KAI H;  5APS A;  3HE4 B;  1N7L A;  3L72 D;  4CPG A;  1MFZ A;  3FWN A;  3CCE P;  3CCQ P;  1SVF A;  2GM4 A;  2P58 A;  4C7N A;  4TLF A;  3V2N A;  2ITA A;  1HGZ A;  2YIU C;  4I1L A;  5B66 H;  2OTK E;  1LT1 A;  3E1R A;  4TT3 H;  4L75 A;  1K05 A;  1BCC D;  2IYP A;  2HPC C;  1PGP A;  3GF7 A;  5KTB A;  4MN4 C;  2WPR A;  1N73 C;  2WWW A;  2WT7 A;  4GOD A;  3Q5P A;  2ZAE B;  1NOH A;  4R4M A;  2J3U A;  2M3B A;  2H88 C;  2P10 A;  3WUU A;  3MZW B;  2QJP C;  4GIF A;  1PGQ A;  4ASW A;  4DOJ A;  1ZRT D;  1RF1 C;  3AE6 C;  1JY3 O;  2N9B A;  4H13 C;  1QVG O;  3ABV C;  3H1K G;  4DT0 A;  3HE5 A;  3BAS A;  1KFM A;  1LTT C;  1Z56 A;  1LP1 A;  3L75 G;  2FFD A;  2O3J A;  2Q1K A;  3L74 D;  2YMK A;  1IC2 A;  1H0T B;  2CPB A;  1FIC A;  1SQQ D;  5B66 E;  1PIX A;  4BRY A;  2M8R A;  3G9R A;  1EDJ A;  1EZV I;  4LLH A;  4JYO X;  2YO2 A;  1X9V A;  3KDP B;  2HPC B;  1L0N D;  4KT0 J;  1Y9B A;  3TDK A;  1J2J B;  1N73 B;  1NTK D;  3AEE C;  1KQS O;  3T97 A;  1YQ3 C;  2XDJ A;  3M06 A;  2QE7 H;  2J3O A;  1LNQ A;  3CX5 I;  2RN0 A;  2QJP B;  1HVV A;  2K9J B;  3RL0 D;  2KNC A;  2W27 A;  4PV1 D;  2XNX B;  4L76 A;  1KYO H;  1M7L A;  1NU1 J;  3C8V A;  1S5L E;  3WU2 E;  3TGU E;  4H13 B;  2BCC E;  2LKM A;  3L71 J;  5AW3 B;  1NTZ D;  3CL3 D;  2V7Q H;  5AVV B;  1DD4 A;  2PFX A;  3AE3 C;  1JM0 A;  1L2P A;  2B89 A;  3II6 A;  1OW6 A;  3Q1M A;  5AVQ B;  3V4W A;  2H89 C;  5H2F E;  2XZR A;  2Q5U A;  1ZXG A;  1KB9 H;  4JF7 A;  3H1I G;  3M0A A;  2A06 D;  2DW3 A;  4D6T D;  1NTM E;  4IFD K;  1YI2 P;  3KXD A;  2E75 C;  2FYU K;  3USS A;  1AVY A;  3BCC J;  3KZI H;  1OVR A;  1GU5 A;  1FOS E;  2B87 B;  2Q3I A;  2E74 C;  3H32 B;  3CWB G;  4XA4 A;  4KHX A;  2J64 A;  3CME P;  1JOC A;  2ZYD A;  3GW6 A;  3H1L D;  5BU8 B;  1LTB C;  3PLN A;  1NWQ A;  3H1H G;  1L0L J;  1YIJ P;  3V2R A;  3L72 G;  4PD4 D;  5APU A;  1YBK A;  3OAK A;  2J59 M;  1SFC B;  1VQM P;  1MFT A;  3A7O A;  3W67 A;  1P84 E;  1SQV K;  1USE A;  5DJU B;  2H8P D;  2O01 J;  2Z4E A;  2WMM A;  1BDD A;  3CC2 P;  1SQV J;  1YJ9 P;  1KB9 E;  2JHL F;  1BGY J;  2WVR A;  1KFN A;  1WMK A;  3CCR P;  4WWI A;  3H1J E;  1ZP0 C;  1OXZ A;  2E75 B;  1BCC G;  5AW5 B;  3L73 J;  3A0H H;  3CLQ A;  2FXP A;  2KB7 P;  1N7S C;  2R3C A;  4U3F G;  1K8A Q;  5KLV D;  3CXH E;  2E74 B;  1J1E C;  2IFN A;  5AW9 B;  5AW1 B;  2KXP B;  1LTJ C;  3CXH I;  1JY2 O;  1PGO A;  2OYH B;  2HLO B;  1YHQ P;  1KYO D;  4UB8 H;  1EQ7 A;  3NMD A;  1GTW A;  1KIL B;  1AA0 A;  1PP9 G;  5APV A;  2OTL P;  2GUS A;  3AE8 C;  3AED C;  4KJM A;  4PJ0 H;  1SS1 A;  3RBZ A;  2HPC A;  4OWF A;  4NPE A;  1J1D C;  3L74 G;  1SQX K;  2J0Y A;  3JSV C;  1SQQ G;  5KKZ C;  4N78 E;  2VRS A;  1X8Y A;  5GTH E;  5CHX A;  1SQX J;  2C0X A;  2ZFC A;  2YKP A;  5CCG C;  3D71 A;  3B71 A;  1VPC A;  1FZA C;  2KZJ A;  4H13 D;  4IFF A;  5KLI C;  3LW5 H;  1RF1 A;  3U59 A;  5AW2 B;  2J5Z A;  1N7S B;  2FYZ A;  3I56 P;  1H89 A;  2YMY A;  2POH A;  1J1E B;  3E1I B;  2J3G A;  3S9O A;  1X79 B;  2V4H A;  2OQQ A;  3F89 A;  2KS1 B;  2AXC A;  3GHG C;  1N2D C;  3H1K D;  1BSH A;  5KAF H;  3B8E B;  3TNU A;  4W7Z A;  1URQ C;  2R44 A;  2WSE H;  2FYU E;  3RK3 E;  1IFN A;  2A45 I;  1M1J B;  3L75 D;  4R4L A;  4PJ0 E;  1FIB A;  1IFP A;  1RE4 C;  3TF5 A;  1T3U A;  2Z5H A;  1L0N K;  3O6Q B;  4EYY Q;  2YO3 A;  4ASV A;  2O1K A;  5KKZ B;  3M0D C;  5AW6 B;  2J0G A;  1NTK K;  1EDK A;  4EDF A;  1K04 A;  1L0N J;  1JTH A;  3PHL A;  1FU1 A;  2J1G A;  3GMA A;  5KLI B;  1NTK J;  3M9B A;  1KIL E;  3VP8 A;  3I5C A;  3CCJ P;  4WY4 B;  1U57 A;  4ZKU A;  1AVO A;  1VQ4 P;  3RK2 C;  1NKZ B;  1NGM B;  1YIT P;  4JYC A;  3HRN A;  2E43 A;  3GHG B;  1NTZ J;  1SP4 A;  5E79 E;  2H43 A;  2BCC G;  1URQ B;  2E75 D;  2IBZ D;  3FX0 A;  1M1K Q;  3BAT A;  5AVU B;  1H88 A;  2JKV A;  2UWJ E;  5BVZ A;  1RE4 B;  1BSN A;  4DJG A;  3SFD C;  4M7H A;  1G2C B;  4D6T J;  3H1I D;  3AEF C; 
#chains in the Genus database with same CATH homology
 3HE5 A;  2HFE D;  4WY4 C;  1LWU A;  1JCD A;  3R2P A;  2PP6 A;  1JTH B;  1L4A D;  3BAS A;  3HD7 C;  1T2K D;  1RE3 B;  1KFM A;  1LTT C;  1Z56 A;  1HJB A;  3N4X A;  2FFD A;  2N1T D;  1FZG A;  1IFM A;  3L36 A;  2QM8 A;  2WZ7 A;  4C7R A;  1IC2 A;  1L4A A;  2CPB A;  4N6J A;  1FIC A;  3NFQ A;  4IFM A;  1DEB A;  1LT9 C;  2P67 A;  2M8R A;  1MUU A;  3UIA A;  1SQQ K;  4LLH A;  4JYO X;  1G1I A;  1IFI A;  2YO2 A;  1FZC B;  1FZF C;  1X9V A;  3KDP B;  1Z3S A;  3N7N A;  1FZF A;  2HPC B;  3RK2 B;  3MGN A;  3A2A A;  1JCC A;  2JHM F;  1J2J B;  2KSJ A;  1IO4 A;  2WT7 B;  2WPQ A;  1N73 B;  3O8Z A;  1RF0 A;  2P1J A;  2H43 B;  2JJL A;  4GT1 A;  3T97 A;  4N78 D;  1S9K D;  2J58 A;  2XDJ A;  3VN0 A;  1N86 C;  3MIW A;  3H32 A;  1CI6 B;  3M06 A;  3V2P A;  2HOD C;  2J3O A;  1N86 A;  2NPS C;  3MTU E;  1GK6 A;  1N7S D;  1YTZ I;  1HVV A;  1SLQ A;  4M7F A;  3RL0 D;  2Q7C A;  2W27 A;  4M3L A;  2XNX B;  1G1J A;  1ZV8 A;  2GY7 A;  4AQR D;  1M7L A;  1FJP A;  1N7S A;  2YNY A;  2A45 H;  2Q9I C;  3BRV B;  3NXS A;  1PFI A;  1SFC D;  2LKM A;  3HE5 B;  1LWU B;  5AW3 B;  1MZ9 A;  3CL3 D;  5BU5 A;  4N3Y B;  2ZXE B;  5AVV B;  3H6P A;  5KLV K;  1FZC C;  4XE5 B;  2J2P A;  3HTK A;  3G3Z A;  1SFC A;  3SWY A;  5CCH D;  2C9L Y;  2O1J A;  1LTJ A;  1NTZ K;  2W6A A;  2Z5I A;  2FFD B;  3II6 A;  5CCH C;  3LID A;  1FZB A;  5AVQ B;  3SWF A;  3V4W A;  5CCH A;  3KPE A;  2XZR A;  5AW4 B;  2Q5U A;  3B5N D;  5KJ7 C;  1XTC C;  1HTL C;  4JF7 A;  3U1C A;  1A02 J;  1GD2 E;  3M0A A;  5APY A;  3RK3 D;  3M9Q A;  3B5N C;  1HUC A;  3P8C E;  5AVS B;  2J61 B;  4JZC A;  1WT6 A;  3VP9 A;  4IFD K;  1GL2 D;  2P7J A;  3B5N A;  1FZF B;  4O9B A;  2FYU K;  2BAS A;  2J60 A;  2XNX C;  1JY2 N;  1GU5 A;  1GL2 A;  1HGV A;  2P2U A;  1FOS E;  1RF0 B;  1LTS C;  1CZQ A;  5CJ4 A;  1E5W A;  2Q3I A;  1GW4 A;  3H32 B;  2WIT A;  1NO4 A;  5CCG D;  1GW3 A;  4XA4 A;  2HOD B;  3CI9 A;  4C7N B;  1IFJ A;  1N86 B;  4KHX A;  2J64 A;  2FXM A;  2NPS B;  2KP8 A;  1A02 F;  1JY2 P;  3BRT B;  1T3J A;  1JOC A;  3EQ2 A;  2FFD C;  2WPS A;  1FZG C;  5CCG A;  1FZA A;  5BU8 B;  1L4A C;  1LTB C;  1T2K C;  2OYH A;  1KIL D;  2HLO A;  4W7Y A;  1JUN A;  2JHH C;  2KYV A;  2N1T C;  3RL0 B;  1NWQ A;  4NYT A;  2Q9I B;  4HH2 A;  1DX7 A;  2N1T A;  3V2R A;  1KIL A;  2YKO A;  3BVH C;  3MD0 A;  3HTK B;  3M91 A;  5APU A;  3OAK A;  2J59 M;  1SFC B;  3BVH A;  2E42 A;  2J3F D;  1LTJ B;  4R9J A;  3A7O A;  1SQV K;  4LGD E;  2MJZ A;  3FIB A;  2Z4E C;  2H8P D;  1FID A;  2OYI A;  1RF0 C;  1URQ D;  2J3F A;  2Z4E A;  4DZO A;  3P8M C;  2FIB A;  1T8Z A;  2FKW B;  3GHG A;  3L37 A;  3V4Q A;  3KYQ A;  2JHK F;  3H32 C;  2JHL F;  4ZFG A;  1URQ A;  1KFN A;  3B5N B;  1IFD A;  1NU1 K;  2HG5 D;  1NH4 A;  1OXZ A;  2WSF H;  1JC9 A;  5AW5 B;  1GL2 B;  2L5G B;  3CLQ A;  3EFG A;  2KB7 P;  1N7S C;  2R3C A;  1RE4 A;  1J1D B;  2H7H A;  5APT A;  1GK4 A;  3RL0 C;  4AYC A;  1SQB K;  2YKQ A;  1J1E C;  1HH0 A;  2IFN A;  3HUS C;  5AW1 B;  1SFC C;  2CPS A;  5AW9 B;  1FDM A;  4I2L C;  2WTY A;  1LTJ C;  3HUS A;  1JY2 O;  3E1I A;  2PAJ A;  1RE3 A;  1FZA B;  1DH3 A;  1Z3U A;  3OJA B;  4W80 A;  1FZG B;  1FZB C;  2OYH B;  2HLO B;  1L4A B;  5APX A;  1EQ7 A;  3IR9 A;  3NMD A;  1NKN A;  2IFM A;  2I1K A;  2N1T B;  1LTA C;  1GTW A;  2XKM A;  1KIL B;  3VOP A;  1XTG B;  4RES B;  3IFM A;  5APV A;  4I6M C;  2GUS A;  3RK2 D;  3BVH B;  2C0W A;  4EPU A;  3RK3 C;  2IPP A;  1M1J A;  2HPC A;  5AVX B;  1GL2 C;  1HWT C;  2Z4E B;  1J1D C;  2D39 A;  1SQX K;  2J0Y A;  4GKG A;  2IX7 C;  1FOS F;  3OA7 A;  2XU6 A;  3HE4 A;  1FZE C;  1LTI C;  5AW7 B;  4N78 E;  1S9K E;  2VRS A;  1X8Y A;  2R5B A;  1JO5 A;  1FZE A;  3V2Q A;  1CSB A;  4HYT B;  2JEE A;  5APW A;  5CHX A;  2C0X A;  4JYB A;  2ZFC A;  2YKP A;  1RY3 A;  2QM7 A;  5CCG C;  4ZKP A;  1L0L K;  1VPC A;  1FZA C;  2GUV A;  3V5B A;  4IFF A;  3NTN A;  2KOG A;  1FAV A;  3LW5 H;  3TYY A;  3U1A A;  1RF1 A;  3U59 A;  2OYH C;  2HLO C;  3VMY A;  1AQ5 A;  5AW2 B;  2J5Z A;  1N7S B;  1QL1 A;  3VTP C;  4WY4 D;  1W2E A;  2KLV A;  5AW8 B;  2FYZ A;  1KIL C;  3PP5 A;  3M9H A;  5AVT B;  1KQL A;  1FJK A;  3HD7 D;  1H89 A;  2YMY A;  3C9I A;  1QL2 A;  1HBW A;  2POH A;  1J1E B;  4WY4 A;  1IJD B;  3HUS B;  3E1I B;  1GZL A;  1FBM A;  2J3G A;  3HD7 A;  3MUD A;  1X79 B;  1MV8 A;  2JHI F;  2OYI C;  1FZB B;  1JMM A;  1VDF A;  1NHL A;  3GHG C;  1N2D C;  3L4F A;  1JY3 N;  1YTZ T;  3B8E B;  3TNU A;  4W7Z A;  1URQ C;  3WMM 0;  4EOT A;  4B86 A;  2WSE H;  1IK9 A;  1LT9 A;  3P8C D;  1IFN A;  2WNP F;  2A45 I;  5AVZ B;  1NAF A;  2J61 A;  1KZU B;  1FZD A;  1CW5 A;  1M1J B;  1ZN5 A;  1NTM K;  3RK3 B;  1JNM A;  4OH8 B;  1JY3 P;  1FIB A;  1RE4 C;  2I1J A;  3L35 A;  2W6B A;  4Y99 C;  5APS A;  1T3U A;  1GU4 A;  3LIE A;  2Z5H A;  2HYN A;  1L0N K;  3HE4 B;  1N7L A;  2A45 G;  1H8A A;  2YO3 A;  2NPS D;  1G2C A;  1MFZ A;  5AVR B;  1FZE B;  2O1K A;  3M0D C;  5AW6 B;  2J0G A;  1SVF A;  2GM4 A;  2WSC H;  2R32 A;  4C7N A;  2HOD A;  1NTK K;  1LGH B;  3M0D A;  1YYC A;  3E1I C;  3VMX A;  1RE3 C;  1AFO A;  2NPS A;  1WRG A;  3A3Y B;  1JTH A;  1FU1 A;  2J1G A;  1RF1 B;  3V2N A;  1ZR4 A;  1HGZ A;  3TSI A;  1LTG C;  4I1L A;  3M9B A;  2XV5 A;  3VP8 A;  1OWA A;  3P7K A;  1ZR2 A;  2Q9I A;  3TK1 A;  3I5C A;  4EIJ A;  4WY4 B;  5AVW B;  3P32 A;  1GDT A;  2C9N Y;  4ZKU A;  1FZC A;  3HD7 B;  1SQP K;  1M1J C;  2HPC C;  5KTB A;  3RK2 C;  1NKZ B;  5AW0 B;  4WBA A;  2WPR A;  2R5D A;  4JYC A;  2OYI B;  5KJ7 D;  1N73 C;  3HRN A;  2E43 A;  2WWW A;  1ZLL A;  2WT7 A;  3GHG B;  2H43 C;  1N73 A;  3TNU B;  4LC1 A;  1SP4 A;  2J3U A;  1NOH A;  5CJ0 A;  2H43 A;  1LT9 B;  2M3B A;  3KQG A;  1URQ B;  5KJ7 A;  1CI6 A;  4WB4 A;  3BAT A;  2J0H A;  4GIF A;  4DOJ A;  3A5T A;  1RF1 C;  4R9T A;  4AUW A;  5AVU B;  1JY3 O;  1H88 A;  3VMZ A;  5CMZ A;  2N9B A;  3VYI A;  5BVZ A;  1RE4 B;  2XNX A;  5AVY B;  4Y99 B;  5APQ A;  2O01 H;  4C46 A;  1G2C B;  4M7H A;  2OAR A;  1LWU C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...