2OYIC

Crystal structure of fragment d of gammad298,301a fibrinogen with the peptide ligand gly-pro-arg-pro-amide
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
299
structure length
299
Chain Sequence
b'YEASILTHDSSIRYLQEIYNSNNQKIVNLKEKVAQLEAQCQEPCKDTVQIHDITGKDCQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQSAIPYALRVELEDWNGRTSTADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDAPSAKFFTSHNGMQFSTWDNDNDKFEGNCAEQDGSGWWMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIPFNRLTI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibrinogen alpha chain
publication title Probing the gamma2 Calcium-Binding Site: Studies with gammaD298,301A Fibrinogen Reveal Changes in the gamma294-301 Loop that Alter the Integrity of the "a" Polymerization Site.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
total genus 85
structure length 299
sequence length 299
chains with identical sequence F
ec nomenclature
pdb deposition date 2007-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2oyiC01
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 2oyiC02
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 2oyiC03
1FZCA 2HLOA 2J0HA 2H43B 1Z3UA 2D39A 1FZEC 2J3FA 4EPUA 3GHGA 1FZAA 2JHIF 2Z4EA 4JYOX 2XNXC 1M1JB 4ZFGA 1M1JC 2OYHB 2J61B 1RE3B 1LTJB 2OYHC 3HUSB 1RE3C 2J1GA 1LTJC 4R9JA 3HUSA 2FFDB 2OYIB 1JY2N 2JHHC 2FFDA 3H32B 2OYIA 1LT9B 1JY3P 3H32A 3BVHC 1LT9A 2JHKF 2A45G 1T3UA 1FICA 1RF0B 2H43A 1RF0C 1FZEB 2A45I 1FZEA 2HODC 1FZFC 1RE4C 2FIBA 2A45H 1N73B 1N86C 1N73C 2XNXB 1JY2O 2XNXA 1RF1C 2J64A 1M1JA 4NYTA 3E1IB 2GY7A 2OYHA 2J61A 3E1IC 1RE3A 2J5ZA 1LTJA 1FZGB 1FZGC 2JHMF 3BVHB 1FZBC 3BVHA 2JHLF 4M7FA 2J3FD 2HPCC 1FZAC 1W2EA 1RF0A 4JZCA 2WNPF 2HODB 1FZFB 1RE4B 1JY3O 2HODA 1LWUB 1LWUC 1N86B 2J3OA 1N86A 1N73A 1RF1B 2J0GA 2J0YA 1RF1A 2Q9IB 1JY3N 2Q9IC 4M7HA 1Z3SA 1FZDA 1FZCB 3E1IA 1FZCC 4R9TA 2HLOB 1FZGA 2HLOC 1FZBB 1JY2P 2J2PA 1FZBA 1FIBA 2H43C 2J60A 2J3UA 3GHGB 2HPCB 3GHGC 1FZAB 2HPCA 2Z4EB 2Z4EC 1FZFA 3FIBA 1RE4A 1FIDA 1LWUA 3HUSC 1JC9A 2J3GA 2FFDC 2OYIC 2Q9IA 3H32C 1LT9C
chains in the Genus database with same CATH superfamily
5CCGC 4OVNF 2YKPA 2AXCA 1Z3UA 4KT0J 2NZ2A 3W67A 1U7JA 3EQ2A 2W8ZA 1KORA 1R5SA 4YPCA 1NH4A 3A0HH 1S5LX 3U59A 1LTJB 1J2JB 4UB8H 3H32A 5AW9B 5KLIB 1SQVG 4BRYB 4AUWA 3I5CA 1SQQD 3H1LD 1NOHA 1KQSO 4IL6X 1SQBK 3ITKA 1FOSF 1BGYG 2LR2A 2L5GB 2GY7A 3O6QB 1J1EC 4IFMA 4JYBA 1SQPK 2B87B 3PHLA 4D6TJ 2ZFCA 1SQXG 2PAJA 4U3FG 1LWUB 4NPFX 1QVFO 2J0GA 1NU1E 3JCUH 1RF1A 3L37A 3M0AA 2K37A 4WY4A 1T6AA 3BRVB 1LP1A 1L4AA 5AW6B 1VQ5P 1VQMP 2J2PA 1JM0A 4PV1C 3HRNA 3CCSP 4MN4C 3GHGB 4I6MC 3H1ID 1DEEG 3L71G 3V5BA 3CWBD 5GTIH 5CCHD 2LXCB 1M8OB 2OYIC 3BCCG 2JWAA 1XTGB 1L0LJ 1N7SC 2Y9YA 2C9NY 3IAOA 3CCQP 1KV4A 1NTMK 2KS1A 2KNCA 4PD4D 1FZAA 3RBXA 5AVZB 5TISE 2XNXC 1L0NJ 1N8RQ 1USDA 2AEJA 3GW6A 4R9JA 3GF7A 2L91A 2QM7A 3A7OA 5CCGA 2Q5UA 5E79H 1VQ9P 1FICA 3AE7C 4JPZB 2H43A 1FZEB 3U1AA 1S2EA 1PP9E 1X8YA 5AW7B 2Q7CA 3HE4A 1HH0A 1SQBG 4XE5B 2JHMF 1GK6A 1LNQA 1IFDA 2KLVA 3CL3D 2QJKB 1BDCA 2WSCH 3H1HJ 4CPGA 1W2EA 2WQYC 3JC22 1KB9E 1SQPG 2ZJSE 4ZMDA 2J3OA 1SS1A 1YJWP 1JCCA 1EQ7A 3RK3D 1PPJE 2JJLA 3P32A 4Z1MH 2KB7P 1CW5A 3SWFA 3TDKA 1YITP 1QL2A 1VQLP 2KXPB 5APXA 1DEBA 1KQLA 3KPEA 4EYYQ 3ZDMA 3L75J 1DIPA 1NTKD 3HD7B 4C7NB 2OYHC 3D6ZA 2B9BA 2CPSA 1NTMG 1PL5A 2OYIA 3P8CE 3PP5A 2AXTH 1N7SA 2E75B 2WSFJ 1RF0B 1YTZI 5KAIH 1N7LA 3TNUB 2XNXA 4H0LC 1M1KQ 3L35A 3E1IB 1GW4A 2J61A 3U1CA 4EOTA 3KZIH 2A06E 3L72D 1TU3F 3L74D 2JKVA 3FX0A 3MUDC 3B71A 4I7ZC 2YKOA 3AE6C 3BATA 2D2CC 3H1KD 2N1TB 4PJ0H 1ZRTD 2Z5HA 2HLOC 2P10A 1GU5A 1EDJA 4N78E 3CC2P 2R5DA 4YXWH 2R3CA 3I56P 1S5LH 3RK2B 2FYUD 4QMAA 3SWYA 3RL0g 5B5EE 3BRTB 2FYNC 1IFJA 1DD3A 5H2FE 1G2CB 2D39A 4IL6H 2YKQA 1SQVD 4BWNA 3TGUG 3NMDA 1JEKA 1GL2D 2WPVB 2WWWA 2ZYGA 1QEXA 1JCDA 1HTLC 1U57A 3RK3B 4D6TE 1BGYD 3CCRP 4R4LA 3MD0A 1NU1J 5AW8B 1R8EA 2V4HA 1FZFC 1NTZK 1RE4C 1EXIA 2WITA 3A0BH 4UB6E 3EFFK 1SQXD 1WT6A 1BE3E 2M3EA 4U3FD 2WT7B 1IFNA 1GDTA 2OYHA 1OVRA 2ZXEB 2RKLA 3B5NA 1DH3A 2BCCG 4H44C 3G9RA 1OVVA 1M56D 1GZLA 1YIJP 4ZKUA 1VQKP 1Z56A 5CMZA 1P84I 3KYQA 3MP7B 3G3ZA 2Q9IB 1P84H 3L71D 1MUUA 1FZBB 1LTSC 1FIBA 2XKMA 3BCCD 2Y0DA 3H6PA 3H1JD 3MUDA 3CMAP 1QL1A 2YNYA 3NFQA 4EIJA 2QJPB 1G1IA 2ZVOB 3GLMA 1VQ8P 1UIXA 1LT9C 2W90A 1PP9J 4K35A 1EZVG 2HLOA 3HE5B 1KZUB 2QG4A 4B86A 3RL0B 1SP4A 2JHIF 1BCCG 1FDMA 3FXEA 2KSEA 3CC7P 5K5GB 1KYOI 1KFNA 2PGDA 1JY3P 2FYUK 5KJ7D 1KYOH 5M1BA 4LC1A 5GTHE 1RQUA 1VDFA 1SQBD 4AQRD 4TLFA 1NKZB 2MKVA 1ZR2A 5KLVJ 1HUCA 3AE5C 2HG5D 4KHXA 4GT1A 4UB8E 3EFGA 4WY4B 1SQPD 1LP1B 1L4AB 1VQNP 1NTZG 1QLED 1NTKE 5TJHA 2FXOA 1T3JA 2QE7H 4WWIA 1JUNA 4RKUJ 1AJYA 3P7KA 2QRXA 2E74C 2KIKA 1YQ4C 2FXMA 3SWKA 2WVRA 4WB4A 2KS1B 2KNCB 1FZAB 2M8RA 4L73A 1NGMB 1Q90D 1JC9A 3L72E 2FFDC 1OX3A 2QM8A 1ZN5A 2J0HA 2H43B 1NTMD 1ZOYC 3S4RA 4I1LA 1EZVI 3H1KE 3JSVC 2YIUB 3VP9A 1GL2C 1ZRTE 1VF5C 1Y47A 2BEZF 3HUSB 3HE4B 2WPQA 2GUSA 3BVHC 3EWKA 3LW5J 1LT9A 3TSIA 4GIFA 2IBZG 3G71P 4OH8B 5APVA 3H1LJ 4YXDC 2Y9ZA 2FYUG 1MFTA 2ZT9D 1P84D 4JYCA 1J1EB 2YMKA 1JMBA 3V6IA 1E5WA 4ZNCA 4GKGA 3KXDA 1SLQA 2WMMA 1N86B 1BGYE 2N9BA 1GU4A 1NKNA 4KJMA 1FZDA 1DX7A 3S9OA 3S1KA 2Q3IA 2HPCB 1SQXE 1RH5B 3BASA 1X22A 2IFNA 3HD7D 3V2NA 3TGUD 2C9LY 3PH0A 3CWBJ 1KILC 1KYOD 4HKZH 1N7SB 3L73G 1IJDB 3V2RA 1BE3J 3VMYA 2E75D 3MZWB 3PRJA 3L4FA 4JBZA 3GG2A 2JO1A 1FBMA 3L71E 2J61B 1KQGB 2PRRA 3BCCE 1NYHA 1JY2N 4H13C 2FFDA 5KJ7C 3M0DC 3RGUA 2KUBA 3GF3A 3H1JG 2ZYAA 3KDPB 2QSIA 1BSNA 2K88A 2ZYDA 2O01H 1HGZA 2BCCD 2IBZI 2KYVA 1GL2A 2W6AA 1KILE 3IF4A 2N1TD 4JF7A 4ZKPA 2NPSA 1SFCD 2MJZA 2YXRB 4HH2A 1LGHB 3BVHA 1FC2C 1OW7A 3CMEP 4JZCA 2HODB 3SFEC 2KZIA 1KC8Q 2KOGA 1PGPA 3D70A 3RK2D 3AECC 3CC4P 3PTZA 2WTYA 1FS0E 1SQBE 1OXZA 1NAYA 3OJAB 5BU5A 4R9TA 2O1JA 1URQC 1VQOP 4LLHA 1EZVD 5AVUB 2H89C 4OWFA 2ZT9B 3MIWA 1FDIA 3CXHE 5KKZB 1BCCD 1Q86Q 1QX8A 3E1RA 4O9BA 5KLVE 4L75A 4L74A 2Q3EA 3QWOC 1FZEC 2J3FA 1OIPA 4A7PA 4IFFA 4OGQC 2VRSA 1NTKJ 2H88C 4L76A 4TT3H 1YI2P 2OYHB 2GM4A 1PPJG 3K5BA 4DT0A 2E42A 2FBWC 1FDOA 1KILA 3B5NB 4U7JA 3H1HD 1K73Q 1NTZD 1Y9BA 4BRYA 2K9JA 2E76B 1S9KD 3CCMP 3CLQA 1Q7YQ 3IFMA 3WU2E 4H0LB 2QVAA 1MFZA 4HJGH 3M0DA 4M7FA 1VQPP 3L72J 3D6YA 3L74J 4I7ZB 5APTA 1YBKA 5CBOA 3V4WA 3CI9A 5AVTB 3T97A 3UIAA 3USSA 3IN6A 3L70G 5KTBA 3H1KJ 1K9MQ 5TISH 1H8AA 2HLOB 3VOPA 3Q5PA 1E79H 1HVVA 3L75D 3M9HA 2G3AA 3RL0D 3HTKA 2G8YA 2IX7C 1CSBA 5B66H 5AVVB 3AEAC 1AQ5A 1PGOA 2FYNB 2M5AA 1SFCB 1SQQE 3H1LE 1L0LK 2E75C 3CPWO 3M9BA 1URQA 2YXQB 4C7RA 4K3AA 2OYOA 4Y28J 1ZP0C 5KAFE 2IBZD 1SQVJ 3Q3DA 1M1JC 1L0NK 5CCHC 1FJKA 1RE3C 4WY4D 3VMZA 1L4AD 1LTAC 2WZ7A 3MGNA 1BGYJ 4W7YA 5CHXA 4Y99C 1M90Q 1YQ3C 1YTZT 5DJUB 1FZEA 1RHZB 3KHUA 2FIBA 1K04A 1JY2O 1KYOE 5APWA 1OWAA 1SQXJ 2XZRA 1X9VA 4U3FJ 1PGJA 1M57D 1VQ4P 4WVZA 1K8AQ 2WSEH 3A2AA 4LGDE 3VMXA 4H44B 1XTCC 3H1IE 1KN7A 2O01N 1DD4A 1JY3O 3CWBE 3E7KA 3WUVA 1IK9A 3RK2C 2WPSA 4D6TG 4M7HA 2BASA 3WUTA 5CCGD 3FWNA 3L71J 4WBAA 4ASVA 4PD4E 4GODA 2BCCE 2J3UA 2XU6A 3L73D 3BCCJ 2Z4EC 2JWDA 2JR8A 3RK3C 2V7QH 3Q2YA 1LT1A 1OFCX 2R3SA 1VL2A 2M0BA 3R2PA 3AEDC 1L0LG 2E5YA 2AEMA 1W2BO 2JHHC 3LW5H 3H32B 3C9IA 1YHQP 2JHKF 1H89A 4BXLA 2O1KA 1EZVE 4GOFA 1T3UA 1L0NG 2KK7A 1AVYA 1SQBJ 1EXJA 3OAKA 1BCCE 3AE3C 1N73C 3RK3E 1M1JA 4NYTA 5CCHA 3VN0A 1RE3A 5AW4B 1SQPJ 1FZGC 3P8MC 3Q5RA 1FZBC 3WUUA 2P1JA 5B5EH 3CCEP 1CI6A 1QGKB 5AVWB 1FAVA 3A0HE 1NAFA 1ZLLA 1GTWA 1X0TA 3CCLP 1HBWA 1RF1B 1S3JA 2QJPC 1PP9D 1JTHA 2E74B 3H1HG 1GD2E 1FU1A 3I55P 2KSJA 1N7SD 4N3YB 1S72P 3G6EP 2JEEA 1ZR4A 1FZFA 1RE4A 2LXBA 2IPPA 1JNMA 4GDOA 3II6A 4UB6H 2R32A 1PPJD 2I8DA 2IZ0A 1W5CE 1YJ9P 1NTMJ 3JCUE 2J59M 1OZHA 1OVUA 1U7MA 3M9QA 2Z4EA 4N6JA 2NPSB 2IYOA 2NRGA 1FE6A 3L74E 3L75G 4HYTB 1HGVA 3RBZA 3IR9A 1NU1K 1NHLA 2RH0A 1EDLA 5GTIE 5AW3B 3V2PA 3AE2C 2C0XA 2WT7A 1N2DC 3L70D 2QJYC 3P8CD 1FZAC 5BU8B 3KQGA 5AW2B 1SQQJ 2FYUE 3N7NA 3A3YB 1N73A 3GMAA 2GUVA 2B89A 5E79E 2FXPA 1FZCC 2QIWA 1FZGA 2R5BA 1FZBA 2H43C 1SQVE 2A06D 1USEA 2YIUC 5APYA 1J1DC 5GTHH 1FIDA 3VYIA 3HUSC 1T2KD 1A02F 1NVOA 2J3GA 1KILB 3TGUJ 4JQ0D 1IFMA 1AV1A 1K05A 1RQVA 3B5ND 1YJNP 2J58A 2K9JB 2P2UA 1FJPA 4PV1B 5C39A 3HE5A 3CCJP 2E76D 4N78D 4NPEA 4U3FE 1X79B 3R4YA 4H0LD 3H1IJ 1LTJC 3AE4C 2JDIH 4H13B 2OYIB 2Q6QA 3L73E 5AW1B 5KLIC 3LIEA 1EC5A 5KLVK 2Q1KA 3AE8C 1VQ6P 3T97B 1N86C 2XNXB 2D2CD 2BCCJ 1JO5A 2FY8A 2J64A 1NU1G 1H88A 1IFPA 2RMZA 1WMKA 3CX5I 5AVXB 3H1JE 1MKMA 2DW3A 3CX5H 2OTKE 4D6TD 2WSFH 3W68A 3AE1C 2OTJP 1NWQA 3HTKB 5BVZA 2HPCC 1QVGO 1LTTC 3SFDC 1LWUC 5L8RJ 1HF9A 2KP8A 2AXTE 1JY3N 2KLUA 2M5AB 1Z3SA 1BE3D 3D71A 5KAIE 1M7LA 2W6JH 1KMIZ 1URQB 3V2QA 1H0TA 2YMYA 2IFMA 3GHGC 5AW5B 5DJTB 3CD6P 2B88A 1EDKA 2POHA 3C1LA 3KZIE 2K3RA 2E43A 2IZ1A 3LIDA 2K9YA 1L0LD 1BCCJ 2OGUA 1FZCA 2HFED 2P7JA 1IFIA 5B66E 1VQ7P 2ZVNB 4HB1A 4EPUA 2XV5A 1A02J 4OGQB 4PJ0E 3OA7A 2YO3A 1L0ND 1SQPE 1OW6A 1PP9G 2WPRA 2CPBA 2WSSH 2J1GA 2XDJA 3HUSA 2XNDH 3QH9A 2KI7B 1T8ZA 4C46A 2A45G 5AVQB 4EDFA 1S5LE 4H44D 1NTZJ 2HODC 1SQQK 1PIXA 1LTJA 5KLVG 4IL6E 1D7MA 1R5LA 2QJKC 1KD1Q 1VPCA 2GA1A 1LJ2A 3WMM0 4EI2A 2ZT9C 1N86A 2PP6A 2FYZA 2W83C 5KKZC 3TF5A 2IYPA 1NTME 3O6QA 5KJ7A 3FXDA 4RJTA 3A5TA 3A0BE 2RN0A 2B87A 1PZQA 3C8VA 2HPCA 4IOIH 4DJGA 1AFOA 2D2CB 1LWUA 2PFXA 1T2KC 3B4SA 3L70E 3VTPC 1IC2A 5EFWB 3CCVP 3B5NC 5CBNA 1LTBC 1PGQA 3F5HA 2K1AA 2FKWB 5AW0B 3O8ZA 2E76C 1Q81Q 3GHGA 1AVOA 1BSHA 2HYNA 2O01J 1P84E 1S4XA 1M1JB 4ZFGA 3HD7C 1KTMA 1RE3B 5APUA 1YYCA 2FYUJ 3CX5D 2A06G 4Y99B 1CI6B 3FGAD 3NTNA 1RF0C 2A45I 2OARA 1UIIA 2A45H 2OQQA 1KB9I 2QEXP 1JTHB 1HJBA 4AYCA 4W80A 1KB9H 3FWLA 5CJ4A 2O3JA 3E1IC 2E74D 3VMAA 1LTIC 3CXHI 1CZQA 1SQQG 4DOJA 3H1LG 3PLNA 3CXHH 2UWJE 2Y0EA 2WSCJ 2WNPF 2SPZA 1FZFB 1RE4B 2HODA 4YTPC 4W7ZA 1JOCA 1LTGC 3TGUE 1JMMA 2C0WA 1NJIQ 2N1TC 2J0YA 1SFCC 1OMIA 2HR3A 3AEGC 2Z4EB 3L73J 3H25A 2QA4P 3Q5SA 1BDDA 4NPDA 1VF5D 3FIBA 3AEFC 2J5UA 2ZXXA 2NPSD 5AVYB 3WU2H 3AEEC 1ZW0A 3F89A 1GW3A 3H1IG 3CWBG 3H1JJ 1NTKK 1BE3G 2Z5IA 3TYYA 1LT9B 1NU1D 1SVFA 2I1JA 2N9YB 3SSUA 1PV3A 2R44A 2W27A 4XA4A 1JB0J 1ZV8A 1ZXGA 1N73B 1L0LE 4DCKA 2Y0CA 2CK3H 3HD7A 4C7NA 1FZGB 3B8EB 1RY3A 2H8PD 3VP8A 1L0NE 2J3FD 1PFIA 1RF0A 3MHVA 4I2LC 4ASWA 1IK7A 3TNUA 2Q9IC 5KAFH 1KILD 1WRGA 1IZNB 3E1IA 3Q1MA 1JY2P 5AVRB 2YO2A 3N4XA 4PV1D 1Y8AA 1ZMEC 3ABVC 1IO4A 2IDBA 5H2FH 2LKMA 2W6BA 1KQFB 1L2PA 1FOSE 2N1TA 3MTUE 1GMJA 3H1HE 3NXSA 4H13D 3H32C 1NTZE 1SFCA 1S9KE 3M91A 1Q82Q 5AVSB 1AQTA 3RL0C 2P58A 1HJ0A 2KZJA 4XFJA 3AE9C 4JYOX 1SQVK 1KB9D 4GOEA 2FFDB 3PJSK 3CXHD 4DZOA 2ITAA 1GK4A 1KFMA 1Q2NA 1NTKG 2WSEJ 5KLVD 2ZAEB 1G2CA 4PD4I 5CJ0A 3OW2O 1GL2B 4PD4H 1VF5B 4RESB 1RF1C 1AA0A 4WY4C 1SQXK 5APSA 1HWTC 1G1JA 2J5ZA 1L4AC 3L75E 2OTLP 3BVHB 1H0TB 2P67A 2I1KA 2QJYB 2JHLF 3L70J 2M3BA 1URQD 3TK1A 2E5TA 3AEBC 1NO4A 1OW8A 3CX5E 1S1CX 3G4SP 2AEFA 3L72G 1MV8A 3L74G 1FZCB 3M06A 4RO0A 1EDIA 2V7QJ 4M3LA 1MZ9A 2J60A 2IBZE 2H7HA 3H1KG 4OGQD 1J1DB 4R4MA 3L36A 5APQA 2BEQD 2JP3A 2NPSC 3V4QA 3CCUP 2Q9IA 4IFDK
chains in the Genus database with same CATH topology
5CCGC 1FZCA 2HFED 1L0LK 2HLOA 2P7JA 1KZUB 3HE5B 1IFIA 2YKPA 4B86A 1Z3UA 3M9BA 1URQA 3RL0B 4EPUA 4C7RA 2XV5A 1A02J 1SP4A 3EQ2A 2JHIF 3OA7A 2YO3A 1FDMA 1M1JC 1NH4A 3U59A 2WPRA 1L0NK 5CCHC 2CPBA 1LTJB 1FJKA 1RE3C 2XDJA 4WY4D 1J2JB 3VMZA 2J1GA 3HUSA 1LTAC 1L4AD 1KFNA 2WZ7A 1JY3P 1T8ZA 2FYUK 3H32A 3MGNA 5AW9B 5KJ7D 4W7YA 4C46A 2A45G 5CHXA 4LC1A 4Y99C 4AUWA 3I5CA 5AVQB 1VDFA 4AQRD 1YTZT 1NKZB 1NOHA 1ZR2A 1FZEA 1HUCA 2HODC 2FIBA 2HG5D 1SQBK 4KHXA 1SQQK 4GT1A 1FOSF 3EFGA 1JY2O 5APWA 1OWAA 2L5GB 4WY4B 2XZRA 1X9VA 2GY7A 1L4AB 1J1EC 1LTJA 4IFMA 4JYBA 1SQPK 2WSEH 3A2AA 4LGDE 3VMXA 1XTCC 2ZFCA 1VPCA 2PAJA 1JY3O 1T3JA 1LWUB 3WMM0 1IK9A 1N86A 2PP6A 1JUNA 3RK2C 2FYZA 2J0GA 2WPSA 1RF1A 3L37A 3M0AA 4M7HA 3P7KA 2BASA 4WY4A 3BRVB 1L4AA 5AW6B 2FXMA 5CCGD 5KJ7A 2J2PA 4WBAA 3A5TA 4WB4A 3HRNA 2J3UA 2XU6A 3GHGB 1FZAB 2HPCA 2Z4EC 4I6MC 2M8RA 1AFOA 1LWUA 3V5BA 1T2KC 5CCHD 3VTPC 1IC2A 1JC9A 3RK3C 2FFDC 2OYIC 2QM8A 1XTGB 3B5NC 1N7SC 1LTBC 1ZN5A 2J0HA 2H43B 2FKWB 5AW0B 2C9NY 3O8ZA 4I1LA 1NTMK 3GHGA 1FZAA 2HYNA 3VP9A 1GL2C 5AVZB 2XNXC 1M1JB 3R2PA 4ZFGA 3HD7C 1RE3B 3HUSB 3HE4B 4R9JA 5APUA 1YYCA 2JHHC 3LW5H 3H32B 2WPQA 3C9IA 2GUSA 3BVHC 2QM7A 3A7OA 1LT9A 1H89A 2JHKF 4Y99B 2O1KA 5CCGA 1CI6B 1T3UA 2Q5UA 3NTNA 3TSIA 4GIFA 1FICA 2H43A 1RF0C 1FZEB 2A45I 4OH8B 3U1AA 5APVA 2OARA 2A45H 3OAKA 1N73C 4JYCA 1M1JA 4NYTA 1JTHB 1HJBA 4AYCA 1J1EB 4W80A 3VN0A 5CCHA 3E1IC 5CJ4A 1RE3A 1X8YA 5AW4B 5AW7B 2Q7CA 3HE4A 1HH0A 3P8MC 1LTIC 1FZGC 1CZQA 4XE5B 1E5WA 2JHMF 4DOJA 1GK6A 1FZBC 1IFDA 2KLVA 3CL3D 2P1JA 2WSCH 1CI6A 5AVWB 1W2EA 1FAVA 2WNPF 4GKGA 1NAFA 1FZFB 1ZLLA 1RE4B 2HODA 4W7ZA 1JOCA 1LTGC 1SLQA 1GTWA 1JMMA 1N86B 2J3OA 1HBWA 2C0WA 1RF1B 2N1TC 1JCCA 1EQ7A 2N9BA 2J0YA 1GU4A 3RK3D 1JTHA 1NKNA 1GD2E 1FZDA 1FU1A 1SFCC 2KSJA 2JJLA 1N7SD 3P32A 4N3YB 1DX7A 2KB7P 2JEEA 2Q3IA 1CW5A 2HPCB 3SWFA 3BASA 1ZR4A 2Z4EB 1QL2A 1FZFA 3FIBA 1RE4A 2IFNA 2IPPA 3HD7D 5APXA 3V2NA 2C9LY 1JNMA 1DEBA 2NPSD 1KILC 1KQLA 3II6A 5AVYB 2R32A 1N7SB 3KPEA 1IJDB 3V2RA 3VMYA 1GW3A 3L4FA 2J59M 2Z4EA 3M9QA 3HD7B 1NTKK 4C7NB 1FBMA 2J61B 2Z5IA 4N6JA 3TYYA 2OYHC 2NPSB 2CPSA 1JY2N 2FFDA 2OYIA 5KJ7C 1LT9B 3P8CE 3M0DC 3PP5A 1SVFA 4HYTB 1HGVA 2I1JA 1N7SA 3IR9A 3KDPB 1RF0B 1NU1K 1NHLA 2W27A 1YTZI 4XA4A 1N7LA 1ZV8A 1HGZA 2O01H 5AW3B 3V2PA 2KYVA 1N73B 1GL2A 3TNUB 2C0XA 2W6AA 2XNXA 3L35A 3HD7A 2N1TD 4C7NA 4JF7A 4ZKPA 1GW4A 2WT7A 3E1IB 2J61A 1FZGB 3U1CA 2NPSA 4EOTA 3B8EB 1SFCD 1N2DC 2MJZA 4HH2A 1LGHB 1RY3A 3BVHA 2H8PD 3VP8A 3P8CD 2J3FD 1PFIA 1FZAC 5BU8B 1RF0A 4JZCA 2HODB 3KQGA 4I2LC 5AW2B 2YKOA 3N7NA 3A3YB 3BATA 2KOGA 1N73A 2N1TB 3TNUA 3RK2D 2GUVA 2Q9IC 1KILD 2WTYA 1WRGA 3E1IA 2Z5HA 1OXZA 1FZCC 3OJAB 5BU5A 1FZGA 4R9TA 2HLOC 1GU5A 1JY2P 2R5BA 5AVRB 2YO2A 1FZBA 2O1JA 2H43C 1URQC 3N4XA 4N78E 2R5DA 4LLHA 5AVUB 5APYA 1J1DC 1IO4A 2LKMA 2R3CA 2W6BA 1FIDA 3VYIA 3MIWA 3RK2B 1FOSE 3HUSC 3SWYA 1T2KD 1A02F 2N1TA 3MTUE 1KILB 2J3GA 3NXSA 3BRTB 3H32C 1IFMA 4O9BA 1IFJA 1SFCA 1S9KE 3B5ND 3M91A 2J58A 2P2UA 1FJPA 5AVSB 3HE5A 1G2CB 2D39A 1FZEC 2J3FA 3RL0C 2YKQA 4IFFA 4N78D 2VRSA 1X79B 3NMDA 4JYOX 1GL2D 2WWWA 1SQVK 1JCDA 1HTLC 2OYHB 2GM4A 1LTJC 2E42A 3RK3B 2FFDB 2OYIB 1KILA 4DZOA 3B5NB 5AW1B 3MD0A 1GK4A 1KFMA 5AW8B 3LIEA 1S9KD 1G2CA 1FZFC 1NTZK 3CLQA 1RE4C 5CJ0A 5KLVK 2WITA 1GL2B 3IFMA 1N86C 2XNXB 1JO5A 1WT6A 4RESB 1RF1C 2J64A 2WT7B 1H88A 4WY4C 1IFNA 1MFZA 1SQXK 5APSA 2OYHA 1GDTA 1G1JA 1HWTC 1L4AC 2J5ZA 3BVHB 5AVXB 2ZXEB 2P67A 2I1KA 3M0DA 2JHLF 3B5NA 4M7FA 2WSFH 1DH3A 2M3BA 1URQD 1NWQA 3HTKB 5BVZA 2HPCC 3TK1A 1GZLA 5APTA 1LTTC 4ZKUA 1LWUC 3V4WA 1Z56A 5CMZA 1NO4A 3CI9A 2KP8A 5AVTB 3T97A 3KYQA 3G3ZA 3UIAA 2Q9IB 1JY3N 5KTBA 1MV8A 1H8AA 1Z3SA 1FZCB 1MUUA 2HLOB 3VOPA 3M06A 4M3LA 1FZBB 1M7LA 1MZ9A 1LTSC 1FIBA 2XKMA 1HVVA 1URQB 3M9HA 3V2QA 2J60A 2YMYA 3H6PA 3MUDA 2IFMA 3GHGC 1QL1A 3RL0D 2H7HA 5AW5B 3HTKA 1J1DB 2IX7C 2YNYA 3NFQA 4EIJA 1CSBA 2POHA 3L36A 5AVVB 2E43A 3LIDA 1G1IA 5APQA 2NPSC 3V4QA 1AQ5A 2Q9IA 4IFDK 1LT9C 1SFCB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FZC A;  2HLO A;  2J0H A;  2H43 B;  1Z3U A;  2D39 A;  1FZE C;  2J3F A;  4EPU A;  3GHG A;  1FZA A;  2JHI F;  2Z4E A;  4JYO X;  2XNX C;  1M1J B;  4ZFG A;  1M1J C;  2OYH B;  2J61 B;  1RE3 B;  1LTJ B;  2OYH C;  3HUS B;  1RE3 C;  2J1G A;  1LTJ C;  4R9J A;  3HUS A;  2FFD B;  2OYI B;  1JY2 N;  2JHH C;  2FFD A;  3H32 B;  2OYI A;  1LT9 B;  1JY3 P;  3H32 A;  3BVH C;  1LT9 A;  2JHK F;  2A45 G;  1T3U A;  1FIC A;  1RF0 B;  2H43 A;  1RF0 C;  1FZE B;  2A45 I;  1FZE A;  2HOD C;  1FZF C;  1RE4 C;  2FIB A;  2A45 H;  1N73 B;  1N86 C;  1N73 C;  2XNX B;  1JY2 O;  2XNX A;  1RF1 C;  2J64 A;  1M1J A;  4NYT A;  3E1I B;  2GY7 A;  2OYH A;  2J61 A;  3E1I C;  1RE3 A;  2J5Z A;  1LTJ A;  1FZG B;  1FZG C;  2JHM F;  3BVH B;  1FZB C;  3BVH A;  2JHL F;  4M7F A;  2J3F D;  2HPC C;  1FZA C;  1W2E A;  1RF0 A;  4JZC A;  2WNP F;  2HOD B;  1FZF B;  1RE4 B;  1JY3 O;  2HOD A;  1LWU B;  1LWU C;  1N86 B;  2J3O A;  1N86 A;  1N73 A;  1RF1 B;  2J0G A;  2J0Y A;  1RF1 A;  2Q9I B;  1JY3 N;  2Q9I C;  4M7H A;  1Z3S A;  1FZD A;  1FZC B;  3E1I A;  1FZC C;  4R9T A;  2HLO B;  1FZG A;  2HLO C;  1FZB B;  1JY2 P;  2J2P A;  1FZB A;  1FIB A;  2H43 C;  2J60 A;  2J3U A;  3GHG B;  2HPC B;  3GHG C;  1FZA B;  2HPC A;  2Z4E B;  2Z4E C;  1FZF A;  3FIB A;  1RE4 A;  1FID A;  1LWU A;  3HUS C;  1JC9 A;  2J3G A;  2FFD C;  2OYI C;  2Q9I A;  3H32 C;  1LT9 C; 
#chains in the Genus database with same CATH topology
 5CCG C;  4OVN F;  2YKP A;  2AXC A;  1Z3U A;  4KT0 J;  2NZ2 A;  3W67 A;  1U7J A;  3EQ2 A;  2W8Z A;  1KOR A;  1R5S A;  4YPC A;  1NH4 A;  3A0H H;  1S5L X;  3U59 A;  1LTJ B;  1J2J B;  4UB8 H;  3H32 A;  5AW9 B;  5KLI B;  1SQV G;  4BRY B;  4AUW A;  3I5C A;  1SQQ D;  3H1L D;  1NOH A;  1KQS O;  4IL6 X;  1SQB K;  3ITK A;  1FOS F;  1BGY G;  2LR2 A;  2L5G B;  2GY7 A;  3O6Q B;  1J1E C;  4IFM A;  4JYB A;  1SQP K;  2B87 B;  3PHL A;  4D6T J;  2ZFC A;  1SQX G;  2PAJ A;  4U3F G;  1LWU B;  4NPF X;  1QVF O;  2J0G A;  1NU1 E;  3JCU H;  1RF1 A;  3L37 A;  3M0A A;  2K37 A;  4WY4 A;  1T6A A;  3BRV B;  1LP1 A;  1L4A A;  5AW6 B;  1VQ5 P;  1VQM P;  2J2P A;  1JM0 A;  4PV1 C;  3HRN A;  3CCS P;  4MN4 C;  3GHG B;  4I6M C;  3H1I D;  1DEE G;  3L71 G;  3V5B A;  3CWB D;  5GTI H;  5CCH D;  2LXC B;  1M8O B;  2OYI C;  3BCC G;  2JWA A;  1XTG B;  1L0L J;  1N7S C;  2Y9Y A;  2C9N Y;  3IAO A;  3CCQ P;  1KV4 A;  1NTM K;  2KS1 A;  2KNC A;  4PD4 D;  1FZA A;  3RBX A;  5AVZ B;  5TIS E;  2XNX C;  1L0N J;  1N8R Q;  1USD A;  2AEJ A;  3GW6 A;  4R9J A;  3GF7 A;  2L91 A;  2QM7 A;  3A7O A;  5CCG A;  2Q5U A;  5E79 H;  1VQ9 P;  1FIC A;  3AE7 C;  4JPZ B;  2H43 A;  1FZE B;  3U1A A;  1S2E A;  1PP9 E;  1X8Y A;  5AW7 B;  2Q7C A;  3HE4 A;  1HH0 A;  1SQB G;  4XE5 B;  2JHM F;  1GK6 A;  1LNQ A;  1IFD A;  2KLV A;  3CL3 D;  2QJK B;  1BDC A;  2WSC H;  3H1H J;  4CPG A;  1W2E A;  2WQY C;  3JC2 2;  1KB9 E;  1SQP G;  2ZJS E;  4ZMD A;  2J3O A;  1SS1 A;  1YJW P;  1JCC A;  1EQ7 A;  3RK3 D;  1PPJ E;  2JJL A;  3P32 A;  4Z1M H;  2KB7 P;  1CW5 A;  3SWF A;  3TDK A;  1YIT P;  1QL2 A;  1VQL P;  2KXP B;  5APX A;  1DEB A;  1KQL A;  3KPE A;  4EYY Q;  3ZDM A;  3L75 J;  1DIP A;  1NTK D;  3HD7 B;  4C7N B;  2OYH C;  3D6Z A;  2B9B A;  2CPS A;  1NTM G;  1PL5 A;  2OYI A;  3P8C E;  3PP5 A;  2AXT H;  1N7S A;  2E75 B;  2WSF J;  1RF0 B;  1YTZ I;  5KAI H;  1N7L A;  3TNU B;  2XNX A;  4H0L C;  1M1K Q;  3L35 A;  3E1I B;  1GW4 A;  2J61 A;  3U1C A;  4EOT A;  3KZI H;  2A06 E;  3L72 D;  1TU3 F;  3L74 D;  2JKV A;  3FX0 A;  3MUD C;  3B71 A;  4I7Z C;  2YKO A;  3AE6 C;  3BAT A;  2D2C C;  3H1K D;  2N1T B;  4PJ0 H;  1ZRT D;  2Z5H A;  2HLO C;  2P10 A;  1GU5 A;  1EDJ A;  4N78 E;  3CC2 P;  2R5D A;  4YXW H;  2R3C A;  3I56 P;  1S5L H;  3RK2 B;  2FYU D;  4QMA A;  3SWY A;  3RL0 g;  5B5E E;  3BRT B;  2FYN C;  1IFJ A;  1DD3 A;  5H2F E;  1G2C B;  2D39 A;  4IL6 H;  2YKQ A;  1SQV D;  4BWN A;  3TGU G;  3NMD A;  1JEK A;  1GL2 D;  2WPV B;  2WWW A;  2ZYG A;  1QEX A;  1JCD A;  1HTL C;  1U57 A;  3RK3 B;  4D6T E;  1BGY D;  3CCR P;  4R4L A;  3MD0 A;  1NU1 J;  5AW8 B;  1R8E A;  2V4H A;  1FZF C;  1NTZ K;  1RE4 C;  1EXI A;  2WIT A;  3A0B H;  4UB6 E;  3EFF K;  1SQX D;  1WT6 A;  1BE3 E;  2M3E A;  4U3F D;  2WT7 B;  1IFN A;  1GDT A;  2OYH A;  1OVR A;  2ZXE B;  2RKL A;  3B5N A;  1DH3 A;  2BCC G;  4H44 C;  3G9R A;  1OVV A;  1M56 D;  1GZL A;  1YIJ P;  4ZKU A;  1VQK P;  1Z56 A;  5CMZ A;  1P84 I;  3KYQ A;  3MP7 B;  3G3Z A;  2Q9I B;  1P84 H;  3L71 D;  1MUU A;  1FZB B;  1LTS C;  1FIB A;  2XKM A;  3BCC D;  2Y0D A;  3H6P A;  3H1J D;  3MUD A;  3CMA P;  1QL1 A;  2YNY A;  3NFQ A;  4EIJ A;  2QJP B;  1G1I A;  2ZVO B;  3GLM A;  1VQ8 P;  1UIX A;  1LT9 C;  2W90 A;  1PP9 J;  4K35 A;  1EZV G;  2HLO A;  3HE5 B;  1KZU B;  2QG4 A;  4B86 A;  3RL0 B;  1SP4 A;  2JHI F;  1BCC G;  1FDM A;  3FXE A;  2KSE A;  3CC7 P;  5K5G B;  1KYO I;  1KFN A;  2PGD A;  1JY3 P;  2FYU K;  5KJ7 D;  1KYO H;  5M1B A;  4LC1 A;  5GTH E;  1RQU A;  1VDF A;  1SQB D;  4AQR D;  4TLF A;  1NKZ B;  2MKV A;  1ZR2 A;  5KLV J;  1HUC A;  3AE5 C;  2HG5 D;  4KHX A;  4GT1 A;  4UB8 E;  3EFG A;  4WY4 B;  1SQP D;  1LP1 B;  1L4A B;  1VQN P;  1NTZ G;  1QLE D;  1NTK E;  5TJH A;  2FXO A;  1T3J A;  2QE7 H;  4WWI A;  1JUN A;  4RKU J;  1AJY A;  3P7K A;  2QRX A;  2E74 C;  2KIK A;  1YQ4 C;  2FXM A;  3SWK A;  2WVR A;  4WB4 A;  2KS1 B;  2KNC B;  1FZA B;  2M8R A;  4L73 A;  1NGM B;  1Q90 D;  1JC9 A;  3L72 E;  2FFD C;  1OX3 A;  2QM8 A;  1ZN5 A;  2J0H A;  2H43 B;  1NTM D;  1ZOY C;  3S4R A;  4I1L A;  1EZV I;  3H1K E;  3JSV C;  2YIU B;  3VP9 A;  1GL2 C;  1ZRT E;  1VF5 C;  1Y47 A;  2BEZ F;  3HUS B;  3HE4 B;  2WPQ A;  2GUS A;  3BVH C;  3EWK A;  3LW5 J;  1LT9 A;  3TSI A;  4GIF A;  2IBZ G;  3G71 P;  4OH8 B;  5APV A;  3H1L J;  4YXD C;  2Y9Z A;  2FYU G;  1MFT A;  2ZT9 D;  1P84 D;  4JYC A;  1J1E B;  2YMK A;  1JMB A;  3V6I A;  1E5W A;  4ZNC A;  4GKG A;  3KXD A;  1SLQ A;  2WMM A;  1N86 B;  1BGY E;  2N9B A;  1GU4 A;  1NKN A;  4KJM A;  1FZD A;  1DX7 A;  3S9O A;  3S1K A;  2Q3I A;  2HPC B;  1SQX E;  1RH5 B;  3BAS A;  1X22 A;  2IFN A;  3HD7 D;  3V2N A;  3TGU D;  2C9L Y;  3PH0 A;  3CWB J;  1KIL C;  1KYO D;  4HKZ H;  1N7S B;  3L73 G;  1IJD B;  3V2R A;  1BE3 J;  3VMY A;  2E75 D;  3MZW B;  3PRJ A;  3L4F A;  4JBZ A;  3GG2 A;  2JO1 A;  1FBM A;  3L71 E;  2J61 B;  1KQG B;  2PRR A;  3BCC E;  1NYH A;  1JY2 N;  4H13 C;  2FFD A;  5KJ7 C;  3M0D C;  3RGU A;  2KUB A;  3GF3 A;  3H1J G;  2ZYA A;  3KDP B;  2QSI A;  1BSN A;  2K88 A;  2ZYD A;  2O01 H;  1HGZ A;  2BCC D;  2IBZ I;  2KYV A;  1GL2 A;  2W6A A;  1KIL E;  3IF4 A;  2N1T D;  4JF7 A;  4ZKP A;  2NPS A;  1SFC D;  2MJZ A;  2YXR B;  4HH2 A;  1LGH B;  3BVH A;  1FC2 C;  1OW7 A;  3CME P;  4JZC A;  2HOD B;  3SFE C;  2KZI A;  1KC8 Q;  2KOG A;  1PGP A;  3D70 A;  3RK2 D;  3AEC C;  3CC4 P;  3PTZ A;  2WTY A;  1FS0 E;  1SQB E;  1OXZ A;  1NAY A;  3OJA B;  5BU5 A;  4R9T A;  2O1J A;  1URQ C;  1VQO P;  4LLH A;  1EZV D;  5AVU B;  2H89 C;  4OWF A;  2ZT9 B;  3MIW A;  1FDI A;  3CXH E;  5KKZ B;  1BCC D;  1Q86 Q;  1QX8 A;  3E1R A;  4O9B A;  5KLV E;  4L75 A;  4L74 A;  2Q3E A;  3QWO C;  1FZE C;  2J3F A;  1OIP A;  4A7P A;  4IFF A;  4OGQ C;  2VRS A;  1NTK J;  2H88 C;  4L76 A;  4TT3 H;  1YI2 P;  2OYH B;  2GM4 A;  1PPJ G;  3K5B A;  4DT0 A;  2E42 A;  2FBW C;  1FDO A;  1KIL A;  3B5N B;  4U7J A;  3H1H D;  1K73 Q;  1NTZ D;  1Y9B A;  4BRY A;  2K9J A;  2E76 B;  1S9K D;  3CCM P;  3CLQ A;  1Q7Y Q;  3IFM A;  3WU2 E;  4H0L B;  2QVA A;  1MFZ A;  4HJG H;  3M0D A;  4M7F A;  1VQP P;  3L72 J;  3D6Y A;  3L74 J;  4I7Z B;  5APT A;  1YBK A;  5CBO A;  3V4W A;  3CI9 A;  5AVT B;  3T97 A;  3UIA A;  3USS A;  3IN6 A;  3L70 G;  5KTB A;  3H1K J;  1K9M Q;  5TIS H;  1H8A A;  2HLO B;  3VOP A;  3Q5P A;  1E79 H;  1HVV A;  3L75 D;  3M9H A;  2G3A A;  3RL0 D;  3HTK A;  2G8Y A;  2IX7 C;  1CSB A;  5B66 H;  5AVV B;  3AEA C;  1AQ5 A;  1PGO A;  2FYN B;  2M5A A;  1SFC B;  1SQQ E;  3H1L E;  1L0L K;  2E75 C;  3CPW O;  3M9B A;  1URQ A;  2YXQ B;  4C7R A;  4K3A A;  2OYO A;  4Y28 J;  1ZP0 C;  5KAF E;  2IBZ D;  1SQV J;  3Q3D A;  1M1J C;  1L0N K;  5CCH C;  1FJK A;  1RE3 C;  4WY4 D;  3VMZ A;  1L4A D;  1LTA C;  2WZ7 A;  3MGN A;  1BGY J;  4W7Y A;  5CHX A;  4Y99 C;  1M90 Q;  1YQ3 C;  1YTZ T;  5DJU B;  1FZE A;  1RHZ B;  3KHU A;  2FIB A;  1K04 A;  1JY2 O;  1KYO E;  5APW A;  1OWA A;  1SQX J;  2XZR A;  1X9V A;  4U3F J;  1PGJ A;  1M57 D;  1VQ4 P;  4WVZ A;  1K8A Q;  2WSE H;  3A2A A;  4LGD E;  3VMX A;  4H44 B;  1XTC C;  3H1I E;  1KN7 A;  2O01 N;  1DD4 A;  1JY3 O;  3CWB E;  3E7K A;  3WUV A;  1IK9 A;  3RK2 C;  2WPS A;  4D6T G;  4M7H A;  2BAS A;  3WUT A;  5CCG D;  3FWN A;  3L71 J;  4WBA A;  4ASV A;  4PD4 E;  4GOD A;  2BCC E;  2J3U A;  2XU6 A;  3L73 D;  3BCC J;  2Z4E C;  2JWD A;  2JR8 A;  3RK3 C;  2V7Q H;  3Q2Y A;  1LT1 A;  1OFC X;  2R3S A;  1VL2 A;  2M0B A;  3R2P A;  3AED C;  1L0L G;  2E5Y A;  2AEM A;  1W2B O;  2JHH C;  3LW5 H;  3H32 B;  3C9I A;  1YHQ P;  2JHK F;  1H89 A;  4BXL A;  2O1K A;  1EZV E;  4GOF A;  1T3U A;  1L0N G;  2KK7 A;  1AVY A;  1SQB J;  1EXJ A;  3OAK A;  1BCC E;  3AE3 C;  1N73 C;  3RK3 E;  1M1J A;  4NYT A;  5CCH A;  3VN0 A;  1RE3 A;  5AW4 B;  1SQP J;  1FZG C;  3P8M C;  3Q5R A;  1FZB C;  3WUU A;  2P1J A;  5B5E H;  3CCE P;  1CI6 A;  1QGK B;  5AVW B;  1FAV A;  3A0H E;  1NAF A;  1ZLL A;  1GTW A;  1X0T A;  3CCL P;  1HBW A;  1RF1 B;  1S3J A;  2QJP C;  1PP9 D;  1JTH A;  2E74 B;  3H1H G;  1GD2 E;  1FU1 A;  3I55 P;  2KSJ A;  1N7S D;  4N3Y B;  1S72 P;  3G6E P;  2JEE A;  1ZR4 A;  1FZF A;  1RE4 A;  2LXB A;  2IPP A;  1JNM A;  4GDO A;  3II6 A;  4UB6 H;  2R32 A;  1PPJ D;  2I8D A;  2IZ0 A;  1W5C E;  1YJ9 P;  1NTM J;  3JCU E;  2J59 M;  1OZH A;  1OVU A;  1U7M A;  3M9Q A;  2Z4E A;  4N6J A;  2NPS B;  2IYO A;  2NRG A;  1FE6 A;  3L74 E;  3L75 G;  4HYT B;  1HGV A;  3RBZ A;  3IR9 A;  1NU1 K;  1NHL A;  2RH0 A;  1EDL A;  5GTI E;  5AW3 B;  3V2P A;  3AE2 C;  2C0X A;  2WT7 A;  1N2D C;  3L70 D;  2QJY C;  3P8C D;  1FZA C;  5BU8 B;  3KQG A;  5AW2 B;  1SQQ J;  2FYU E;  3N7N A;  3A3Y B;  1N73 A;  3GMA A;  2GUV A;  2B89 A;  5E79 E;  2FXP A;  1FZC C;  2QIW A;  1FZG A;  2R5B A;  1FZB A;  2H43 C;  1SQV E;  2A06 D;  1USE A;  2YIU C;  5APY A;  1J1D C;  5GTH H;  1FID A;  3VYI A;  3HUS C;  1T2K D;  1A02 F;  1NVO A;  2J3G A;  1KIL B;  3TGU J;  4JQ0 D;  1IFM A;  1AV1 A;  1K05 A;  1RQV A;  3B5N D;  1YJN P;  2J58 A;  2K9J B;  2P2U A;  1FJP A;  4PV1 B;  5C39 A;  3HE5 A;  3CCJ P;  2E76 D;  4N78 D;  4NPE A;  4U3F E;  1X79 B;  3R4Y A;  4H0L D;  3H1I J;  1LTJ C;  3AE4 C;  2JDI H;  4H13 B;  2OYI B;  2Q6Q A;  3L73 E;  5AW1 B;  5KLI C;  3LIE A;  1EC5 A;  5KLV K;  2Q1K A;  3AE8 C;  1VQ6 P;  3T97 B;  1N86 C;  2XNX B;  2D2C D;  2BCC J;  1JO5 A;  2FY8 A;  2J64 A;  1NU1 G;  1H88 A;  1IFP A;  2RMZ A;  1WMK A;  3CX5 I;  5AVX B;  3H1J E;  1MKM A;  2DW3 A;  3CX5 H;  2OTK E;  4D6T D;  2WSF H;  3W68 A;  3AE1 C;  2OTJ P;  1NWQ A;  3HTK B;  5BVZ A;  2HPC C;  1QVG O;  1LTT C;  3SFD C;  1LWU C;  5L8R J;  1HF9 A;  2KP8 A;  2AXT E;  1JY3 N;  2KLU A;  2M5A B;  1Z3S A;  1BE3 D;  3D71 A;  5KAI E;  1M7L A;  2W6J H;  1KMI Z;  1URQ B;  3V2Q A;  1H0T A;  2YMY A;  2IFM A;  3GHG C;  5AW5 B;  5DJT B;  3CD6 P;  2B88 A;  1EDK A;  2POH A;  3C1L A;  3KZI E;  2K3R A;  2E43 A;  2IZ1 A;  3LID A;  2K9Y A;  1L0L D;  1BCC J;  2OGU A;  1FZC A;  2HFE D;  2P7J A;  1IFI A;  5B66 E;  1VQ7 P;  2ZVN B;  4HB1 A;  4EPU A;  2XV5 A;  1A02 J;  4OGQ B;  4PJ0 E;  3OA7 A;  2YO3 A;  1L0N D;  1SQP E;  1OW6 A;  1PP9 G;  2WPR A;  2CPB A;  2WSS H;  2J1G A;  2XDJ A;  3HUS A;  2XND H;  3QH9 A;  2KI7 B;  1T8Z A;  4C46 A;  2A45 G;  5AVQ B;  4EDF A;  1S5L E;  4H44 D;  1NTZ J;  2HOD C;  1SQQ K;  1PIX A;  1LTJ A;  5KLV G;  4IL6 E;  1D7M A;  1R5L A;  2QJK C;  1KD1 Q;  1VPC A;  2GA1 A;  1LJ2 A;  3WMM 0;  4EI2 A;  2ZT9 C;  1N86 A;  2PP6 A;  2FYZ A;  2W83 C;  5KKZ C;  3TF5 A;  2IYP A;  1NTM E;  3O6Q A;  5KJ7 A;  3FXD A;  4RJT A;  3A5T A;  3A0B E;  2RN0 A;  2B87 A;  1PZQ A;  3C8V A;  2HPC A;  4IOI H;  4DJG A;  1AFO A;  2D2C B;  1LWU A;  2PFX A;  1T2K C;  3B4S A;  3L70 E;  3VTP C;  1IC2 A;  5EFW B;  3CCV P;  3B5N C;  5CBN A;  1LTB C;  1PGQ A;  3F5H A;  2K1A A;  2FKW B;  5AW0 B;  3O8Z A;  2E76 C;  1Q81 Q;  3GHG A;  1AVO A;  1BSH A;  2HYN A;  2O01 J;  1P84 E;  1S4X A;  1M1J B;  4ZFG A;  3HD7 C;  1KTM A;  1RE3 B;  5APU A;  1YYC A;  2FYU J;  3CX5 D;  2A06 G;  4Y99 B;  1CI6 B;  3FGA D;  3NTN A;  1RF0 C;  2A45 I;  2OAR A;  1UII A;  2A45 H;  2OQQ A;  1KB9 I;  2QEX P;  1JTH B;  1HJB A;  4AYC A;  4W80 A;  1KB9 H;  3FWL A;  5CJ4 A;  2O3J A;  3E1I C;  2E74 D;  3VMA A;  1LTI C;  3CXH I;  1CZQ A;  1SQQ G;  4DOJ A;  3H1L G;  3PLN A;  3CXH H;  2UWJ E;  2Y0E A;  2WSC J;  2WNP F;  2SPZ A;  1FZF B;  1RE4 B;  2HOD A;  4YTP C;  4W7Z A;  1JOC A;  1LTG C;  3TGU E;  1JMM A;  2C0W A;  1NJI Q;  2N1T C;  2J0Y A;  1SFC C;  1OMI A;  2HR3 A;  3AEG C;  2Z4E B;  3L73 J;  3H25 A;  2QA4 P;  3Q5S A;  1BDD A;  4NPD A;  1VF5 D;  3FIB A;  3AEF C;  2J5U A;  2ZXX A;  2NPS D;  5AVY B;  3WU2 H;  3AEE C;  1ZW0 A;  3F89 A;  1GW3 A;  3H1I G;  3CWB G;  3H1J J;  1NTK K;  1BE3 G;  2Z5I A;  3TYY A;  1LT9 B;  1NU1 D;  1SVF A;  2I1J A;  2N9Y B;  3SSU A;  1PV3 A;  2R44 A;  2W27 A;  4XA4 A;  1JB0 J;  1ZV8 A;  1ZXG A;  1N73 B;  1L0L E;  4DCK A;  2Y0C A;  2CK3 H;  3HD7 A;  4C7N A;  1FZG B;  3B8E B;  1RY3 A;  2H8P D;  3VP8 A;  1L0N E;  2J3F D;  1PFI A;  1RF0 A;  3MHV A;  4I2L C;  4ASW A;  1IK7 A;  3TNU A;  2Q9I C;  5KAF H;  1KIL D;  1WRG A;  1IZN B;  3E1I A;  3Q1M A;  1JY2 P;  5AVR B;  2YO2 A;  3N4X A;  4PV1 D;  1Y8A A;  1ZME C;  3ABV C;  1IO4 A;  2IDB A;  5H2F H;  2LKM A;  2W6B A;  1KQF B;  1L2P A;  1FOS E;  2N1T A;  3MTU E;  1GMJ A;  3H1H E;  3NXS A;  4H13 D;  3H32 C;  1NTZ E;  1SFC A;  1S9K E;  3M91 A;  1Q82 Q;  5AVS B;  1AQT A;  3RL0 C;  2P58 A;  1HJ0 A;  2KZJ A;  4XFJ A;  3AE9 C;  4JYO X;  1SQV K;  1KB9 D;  4GOE A;  2FFD B;  3PJS K;  3CXH D;  4DZO A;  2ITA A;  1GK4 A;  1KFM A;  1Q2N A;  1NTK G;  2WSE J;  5KLV D;  2ZAE B;  1G2C A;  4PD4 I;  5CJ0 A;  3OW2 O;  1GL2 B;  4PD4 H;  1VF5 B;  4RES B;  1RF1 C;  1AA0 A;  4WY4 C;  1SQX K;  5APS A;  1HWT C;  1G1J A;  2J5Z A;  1L4A C;  3L75 E;  2OTL P;  3BVH B;  1H0T B;  2P67 A;  2I1K A;  2QJY B;  2JHL F;  3L70 J;  2M3B A;  1URQ D;  3TK1 A;  2E5T A;  3AEB C;  1NO4 A;  1OW8 A;  3CX5 E;  1S1C X;  3G4S P;  2AEF A;  3L72 G;  1MV8 A;  3L74 G;  1FZC B;  3M06 A;  4RO0 A;  1EDI A;  2V7Q J;  4M3L A;  1MZ9 A;  2J60 A;  2IBZ E;  2H7H A;  3H1K G;  4OGQ D;  1J1D B;  4R4M A;  3L36 A;  5APQ A;  2BEQ D;  2JP3 A;  2NPS C;  3V4Q A;  3CCU P;  2Q9I A;  4IFD K; 
#chains in the Genus database with same CATH homology
 5CCG C;  1FZC A;  2HFE D;  1L0L K;  2HLO A;  2P7J A;  1KZU B;  3HE5 B;  1IFI A;  2YKP A;  4B86 A;  1Z3U A;  3M9B A;  1URQ A;  3RL0 B;  4EPU A;  4C7R A;  2XV5 A;  1A02 J;  1SP4 A;  3EQ2 A;  2JHI F;  3OA7 A;  2YO3 A;  1FDM A;  1M1J C;  1NH4 A;  3U59 A;  2WPR A;  1L0N K;  5CCH C;  2CPB A;  1LTJ B;  1FJK A;  1RE3 C;  2XDJ A;  4WY4 D;  1J2J B;  3VMZ A;  2J1G A;  3HUS A;  1LTA C;  1L4A D;  1KFN A;  2WZ7 A;  1JY3 P;  1T8Z A;  2FYU K;  3H32 A;  3MGN A;  5AW9 B;  5KJ7 D;  4W7Y A;  4C46 A;  2A45 G;  5CHX A;  4LC1 A;  4Y99 C;  4AUW A;  3I5C A;  5AVQ B;  1VDF A;  4AQR D;  1YTZ T;  1NKZ B;  1NOH A;  1ZR2 A;  1FZE A;  1HUC A;  2HOD C;  2FIB A;  2HG5 D;  1SQB K;  4KHX A;  1SQQ K;  4GT1 A;  1FOS F;  3EFG A;  1JY2 O;  5APW A;  1OWA A;  2L5G B;  4WY4 B;  2XZR A;  1X9V A;  2GY7 A;  1L4A B;  1J1E C;  1LTJ A;  4IFM A;  4JYB A;  1SQP K;  2WSE H;  3A2A A;  4LGD E;  3VMX A;  1XTC C;  2ZFC A;  1VPC A;  2PAJ A;  1JY3 O;  1T3J A;  1LWU B;  3WMM 0;  1IK9 A;  1N86 A;  2PP6 A;  1JUN A;  3RK2 C;  2FYZ A;  2J0G A;  2WPS A;  1RF1 A;  3L37 A;  3M0A A;  4M7H A;  3P7K A;  2BAS A;  4WY4 A;  3BRV B;  1L4A A;  5AW6 B;  2FXM A;  5CCG D;  5KJ7 A;  2J2P A;  4WBA A;  3A5T A;  4WB4 A;  3HRN A;  2J3U A;  2XU6 A;  3GHG B;  1FZA B;  2HPC A;  2Z4E C;  4I6M C;  2M8R A;  1AFO A;  1LWU A;  3V5B A;  1T2K C;  5CCH D;  3VTP C;  1IC2 A;  1JC9 A;  3RK3 C;  2FFD C;  2OYI C;  2QM8 A;  1XTG B;  3B5N C;  1N7S C;  1LTB C;  1ZN5 A;  2J0H A;  2H43 B;  2FKW B;  5AW0 B;  2C9N Y;  3O8Z A;  4I1L A;  1NTM K;  3GHG A;  1FZA A;  2HYN A;  3VP9 A;  1GL2 C;  5AVZ B;  2XNX C;  1M1J B;  3R2P A;  4ZFG A;  3HD7 C;  1RE3 B;  3HUS B;  3HE4 B;  4R9J A;  5APU A;  1YYC A;  2JHH C;  3LW5 H;  3H32 B;  2WPQ A;  3C9I A;  2GUS A;  3BVH C;  2QM7 A;  3A7O A;  1LT9 A;  1H89 A;  2JHK F;  4Y99 B;  2O1K A;  5CCG A;  1CI6 B;  1T3U A;  2Q5U A;  3NTN A;  3TSI A;  4GIF A;  1FIC A;  2H43 A;  1RF0 C;  1FZE B;  2A45 I;  4OH8 B;  3U1A A;  5APV A;  2OAR A;  2A45 H;  3OAK A;  1N73 C;  4JYC A;  1M1J A;  4NYT A;  1JTH B;  1HJB A;  4AYC A;  1J1E B;  4W80 A;  3VN0 A;  5CCH A;  3E1I C;  5CJ4 A;  1RE3 A;  1X8Y A;  5AW4 B;  5AW7 B;  2Q7C A;  3HE4 A;  1HH0 A;  3P8M C;  1LTI C;  1FZG C;  1CZQ A;  4XE5 B;  1E5W A;  2JHM F;  4DOJ A;  1GK6 A;  1FZB C;  1IFD A;  2KLV A;  3CL3 D;  2P1J A;  2WSC H;  1CI6 A;  5AVW B;  1W2E A;  1FAV A;  2WNP F;  4GKG A;  1NAF A;  1FZF B;  1ZLL A;  1RE4 B;  2HOD A;  4W7Z A;  1JOC A;  1LTG C;  1SLQ A;  1GTW A;  1JMM A;  1N86 B;  2J3O A;  1HBW A;  2C0W A;  1RF1 B;  2N1T C;  1JCC A;  1EQ7 A;  2N9B A;  2J0Y A;  1GU4 A;  3RK3 D;  1JTH A;  1NKN A;  1GD2 E;  1FZD A;  1FU1 A;  1SFC C;  2KSJ A;  2JJL A;  1N7S D;  3P32 A;  4N3Y B;  1DX7 A;  2KB7 P;  2JEE A;  2Q3I A;  1CW5 A;  2HPC B;  3SWF A;  3BAS A;  1ZR4 A;  2Z4E B;  1QL2 A;  1FZF A;  3FIB A;  1RE4 A;  2IFN A;  2IPP A;  3HD7 D;  5APX A;  3V2N A;  2C9L Y;  1JNM A;  1DEB A;  2NPS D;  1KIL C;  1KQL A;  3II6 A;  5AVY B;  2R32 A;  1N7S B;  3KPE A;  1IJD B;  3V2R A;  3VMY A;  1GW3 A;  3L4F A;  2J59 M;  2Z4E A;  3M9Q A;  3HD7 B;  1NTK K;  4C7N B;  1FBM A;  2J61 B;  2Z5I A;  4N6J A;  3TYY A;  2OYH C;  2NPS B;  2CPS A;  1JY2 N;  2FFD A;  2OYI A;  5KJ7 C;  1LT9 B;  3P8C E;  3M0D C;  3PP5 A;  1SVF A;  4HYT B;  1HGV A;  2I1J A;  1N7S A;  3IR9 A;  3KDP B;  1RF0 B;  1NU1 K;  1NHL A;  2W27 A;  1YTZ I;  4XA4 A;  1N7L A;  1ZV8 A;  1HGZ A;  2O01 H;  5AW3 B;  3V2P A;  2KYV A;  1N73 B;  1GL2 A;  3TNU B;  2C0X A;  2W6A A;  2XNX A;  3L35 A;  3HD7 A;  2N1T D;  4C7N A;  4JF7 A;  4ZKP A;  1GW4 A;  2WT7 A;  3E1I B;  2J61 A;  1FZG B;  3U1C A;  2NPS A;  4EOT A;  3B8E B;  1SFC D;  1N2D C;  2MJZ A;  4HH2 A;  1LGH B;  1RY3 A;  3BVH A;  2H8P D;  3VP8 A;  3P8C D;  2J3F D;  1PFI A;  1FZA C;  5BU8 B;  1RF0 A;  4JZC A;  2HOD B;  3KQG A;  4I2L C;  5AW2 B;  2YKO A;  3N7N A;  3A3Y B;  3BAT A;  2KOG A;  1N73 A;  2N1T B;  3TNU A;  3RK2 D;  2GUV A;  2Q9I C;  1KIL D;  2WTY A;  1WRG A;  3E1I A;  2Z5H A;  1OXZ A;  1FZC C;  3OJA B;  5BU5 A;  1FZG A;  4R9T A;  2HLO C;  1GU5 A;  1JY2 P;  2R5B A;  5AVR B;  2YO2 A;  1FZB A;  2O1J A;  2H43 C;  1URQ C;  3N4X A;  4N78 E;  2R5D A;  4LLH A;  5AVU B;  5APY A;  1J1D C;  1IO4 A;  2LKM A;  2R3C A;  2W6B A;  1FID A;  3VYI A;  3MIW A;  3RK2 B;  1FOS E;  3HUS C;  3SWY A;  1T2K D;  1A02 F;  2N1T A;  3MTU E;  1KIL B;  2J3G A;  3NXS A;  3BRT B;  3H32 C;  1IFM A;  4O9B A;  1IFJ A;  1SFC A;  1S9K E;  3B5N D;  3M91 A;  2J58 A;  2P2U A;  1FJP A;  5AVS B;  3HE5 A;  1G2C B;  2D39 A;  1FZE C;  2J3F A;  3RL0 C;  2YKQ A;  4IFF A;  4N78 D;  2VRS A;  1X79 B;  3NMD A;  4JYO X;  1GL2 D;  2WWW A;  1SQV K;  1JCD A;  1HTL C;  2OYH B;  2GM4 A;  1LTJ C;  2E42 A;  3RK3 B;  2FFD B;  2OYI B;  1KIL A;  4DZO A;  3B5N B;  5AW1 B;  3MD0 A;  1GK4 A;  1KFM A;  5AW8 B;  3LIE A;  1S9K D;  1G2C A;  1FZF C;  1NTZ K;  3CLQ A;  1RE4 C;  5CJ0 A;  5KLV K;  2WIT A;  1GL2 B;  3IFM A;  1N86 C;  2XNX B;  1JO5 A;  1WT6 A;  4RES B;  1RF1 C;  2J64 A;  2WT7 B;  1H88 A;  4WY4 C;  1IFN A;  1MFZ A;  1SQX K;  5APS A;  2OYH A;  1GDT A;  1G1J A;  1HWT C;  1L4A C;  2J5Z A;  3BVH B;  5AVX B;  2ZXE B;  2P67 A;  2I1K A;  3M0D A;  2JHL F;  3B5N A;  4M7F A;  2WSF H;  1DH3 A;  2M3B A;  1URQ D;  1NWQ A;  3HTK B;  5BVZ A;  2HPC C;  3TK1 A;  1GZL A;  5APT A;  1LTT C;  4ZKU A;  1LWU C;  3V4W A;  1Z56 A;  5CMZ A;  1NO4 A;  3CI9 A;  2KP8 A;  5AVT B;  3T97 A;  3KYQ A;  3G3Z A;  3UIA A;  2Q9I B;  1JY3 N;  5KTB A;  1MV8 A;  1H8A A;  1Z3S A;  1FZC B;  1MUU A;  2HLO B;  3VOP A;  3M06 A;  4M3L A;  1FZB B;  1M7L A;  1MZ9 A;  1LTS C;  1FIB A;  2XKM A;  1HVV A;  1URQ B;  3M9H A;  3V2Q A;  2J60 A;  2YMY A;  3H6P A;  3MUD A;  2IFM A;  3GHG C;  1QL1 A;  3RL0 D;  2H7H A;  5AW5 B;  3HTK A;  1J1D B;  2IX7 C;  2YNY A;  3NFQ A;  4EIJ A;  1CSB A;  2POH A;  3L36 A;  5AVV B;  2E43 A;  3LID A;  1G1I A;  5APQ A;  2NPS C;  3V4Q A;  1AQ5 A;  2Q9I A;  4IFD K;  1LT9 C;  1SFC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...