2OYIC

Crystal structure of fragment d of gammad298,301a fibrinogen with the peptide ligand gly-pro-arg-pro-amide
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
299
structure length
299
Chain Sequence
YEASILTHDSSIRYLQEIYNSNNQKIVNLKEKVAQLEAQCQEPCKDTVQIHDITGKDCQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQSAIPYALRVELEDWNGRTSTADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDAPSAKFFTSHNGMQFSTWDNDNDKFEGNCAEQDGSGWWMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIPFNRLTI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Probing the gamma2 Calcium-Binding Site: Studies with gammaD298,301A Fibrinogen Reveal Changes in the gamma294-301 Loop that Alter the Integrity of the "a" Polymerization Site.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
molecule keywords Fibrinogen alpha chain
total genus 85
structure length 299
sequence length 299
chains with identical sequence F
ec nomenclature
pdb deposition date 2007-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2oyiC01
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 2oyiC02
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 2oyiC03
4M7FA 2A45G 1N73B 2JHLF 4R9JA 2OYHB 2FFDB 1FZAB 1RF0A 1FZDA 4R9TA 2HPCB 2WNPF 1JY2N 2XNXA 2HLOA 2H43B 1RE3A 1FIBA 1FZGB 3H32A 1FZGC 2J0HA 2Z4EC 2Q9IB 1FZBA 2OYIB 1RE4B 1LTJA 1JY3N 1M1JC 2HPCA 3GHGC 1RE3B 2J3GA 2FFDA 2J60A 1FZGA 3H32C 4M7HA 3E1IC 1FZEA 1N86B 1LT9B 1RF1A 2H43C 1RF0C 2OYHA 2Q9IC 2Z4EB 1RE4A 1W2EA 1N73C 4ZFGA 2FIBA 2J3FD 1T3UA 1FZFA 2J0GA 2JHIF 1LTJC 2J5ZA 2FFDC 3HUSC 1LT9A 2Z4EA 2HLOB 1LT9C 3BVHA 2JHMF 1RF0B 1FZEB 1N86A 4NYTA 2HODA 2JHHC 1RF1B 1FZFC 2A45I 1FZFB 1FZCA 4JYOX 1JY2O 1RE4C 1JC9A 1Z3SA 1FICA 2J2PA 1M1JB 1FZCC 2OYHC 2J3OA 3E1IB 2HODB 1FZEC 2HODC 2J3FA 3GHGB 1LWUC 1LWUA 2JHKF 3BVHC 1FZAC 3BVHB 1JY2P 2J64A 2A45H 1FIDA 1FZCB 1N73A 2J61B 1RE3C 2J1GA 2OYIA 2GY7A 3H32B 2OYIC 1JY3P 3HUSB 1JY3O 2Q9IA 2HLOC 4JZCA 2XNXC 4EPUA 2XNXB 1LWUB 1Z3UA 3FIBA 2H43A 1RF1C 3E1IA 1N86C 2J61A 1FZAA 2J3UA 1M1JA 2HPCC 3GHGA 2J0YA 3HUSA 1FZBB 1FZBC 2D39A 1LTJB
chains in the Genus database with same CATH superfamily
3S4RA 1PP9G 4L76A 2H7HA 2SPZA 2YO3A 3A0BE 1EXJA 3AE9C 1NTKD 2A06G 3CD6P 3RK3B 1ZV8A 1N7SA 1RE4B 4JYCA 2WTYA 4ASWA 3HRNA 2KSEA 3E1IC 2B87A 1IK7A 4EIJA 1KC8Q 3OA7A 3IF4A 5APTA 3HD7B 1K8AQ 1PIXA 3O6QB 3H1HJ 3H1LE 1VQ5P 3JCUH 4B86A 4WY4D 2FFDC 1LT9A 1PZQA 1KB9D 3RL0D 1NU1G 1KQGB 1USEA 2A45I 1SFCB 4BRYB 1KFMA 2QJPB 2QJYB 1NTMG 1X79B 5DJTB 2ZJSE 2WSEH 3PP5A 3RK2C 2CK3H 2ZT9D 2Q6QA 3L74D 4MN4C 1BCCG 2AEFA 3BRTB 4PD4D 3AEGC 1XTGB 2CPSA 3C1LA 1FIDA 3EFGA 1FZCB 2Q9IA 4UB6E 3L73J 2AXCA 1N86C 2WSCH 2E76B 2J61A 5BU8B 1FDOA 4K3AA 3V6IA 1H89A 1VDFA 3VP9A 1FE6A 1LTJB 1NU1J 3CXHE 2JR8A 2OTLP 3M0DC 5M1BA 1JM0A 5E79E 4HKZH 3A5TA 4U3FD 3CMAP 2JKVA 1HVVA 1QEXA 3H32A 3L73D 3KYQA 3RBXA 1QGKB 4L74A 3V4WA 4HYTB 1NU1D 4EI2A 2O01N 2Y9YA 2H43C 1NKZB 2Q3IA 4XA4A 4UB8H 1NU1E 3NMDA 1SQQJ 3CC2P 2W8ZA 2J0GA 1OVUA 4R4LA 1QX8A 2D2CC 4C46A 5AW0B 1L0LG 2JHMF 3G71P 5AVUB 1RQUA 4JYBA 3L70J 2C9LY 4RO0A 4RKUJ 1NTKG 4K35A 3V2RA 2HG5D 5APYA 1NTME 2KUBA 4JF7A 3BATA 1NYHA 3VN0A 2WSSH 1K9MQ 1KN7A 2IDBA 4IL6X 2PGDA 2W6BA 3Q1MA 4GT1A 1SQXD 1HGVA 3WUVA 2CPBA 1LP1A 1HJBA 2WSEJ 1FZAA 1URQA 1SQQK 4LLHA 2WT7A 1ZRTE 5L8RJ 1LTBC 2ZFCA 3TF5A 5KLVD 3GG2A 2PFXA 5AW3B 1SQPG 4W80A 4U3FJ 1X0TA 1ZOYC 3CX5I 2QJKC 1FZGC 1PP9E 2PRRA 3R2PA 3HE4B 5KLIC 4YPCA 1RE3B 3M91A 2Z5IA 4OGQB 2HFED 1JTHB 4UB8E 1RF0C 2QE7H 1FAVA 3EQ2A 4LC1A 1LTIC 3CXHD 1L4AA 1L0LJ 1X8YA 2WZ7A 4H44B 3F89A 2J5ZA 1NOHA 1IZNB 3KHUA 5AVYB 2GUSA 4DOJA 3D71A 1K05A 1CSBA 1LTSC 1GW3A 3CCSP 2IBZD 1MV8A 3L74E 1LWUC 3CWBE 2ZAEB 2P67A 2KS1B 3MIWA 3BVHB 1T3JA 1T8ZA 3FWLA 1WT6A 1DEEG 5AVTB 2HLOC 4GIFA 2KIKA 4Z1MH 3B5NA 1NKNA 2Y0EA 3SWFA 1S1CX 2AXTH 4WY4C 1W2BO 1G2CA 1FZBC 1JB0J 5KJ7C 4GOEA 2R3SA 3P8MC 3CPWO 1D7MA 3B4SA 5KLVK 3VOPA 1YJNP 3L72E 2HPCA 3H1IE 1NTMJ 2Q3EA 1WMKA 3I55P 3W67A 1NTZK 3PJSK 2Q9IC 2N1TC 3RBZA 1KD1Q 3CXHI 2XDJA 1SP4A 2R5DA 3KZIE 3PLNA 3HUSC 1LTTC 3USSA 1GK4A 4JYOX 2K88A 1SFCC 2QIWA 1JY2O 3B5ND 4W7YA 2FYUE 1NVOA 1ZR2A 3RK2B 2HODB 5KAIE 1VQ9P 3GHGB 5TISE 1QVFO 2JHKF 2Y9ZA 2UWJE 1S5LX 4WWIA 3VMXA 1PGPA 3FWNA 1P84H 1GL2A 2KNCB 2L91A 4YXDC 3D70A 2XNXC 2N9BA 3L75E 4BXLA 3AECC 2LR2A 2E76C 1NTKK 2KLVA 4KHXA 1Q82Q 4PV1D 3GLMA 2A06E 5CJ0A 1URQC 2YMKA 1AA0A 3AE2C 1VQKP 1E79H 1GW4A 4KT0J 2FY8A 2WPRA 1GMJA 5AW6B 2OYIB 4TT3H 3NFQA 1SQPE 4IL6E 4OGQD 3B71A 1RH5B 3AE8C 1KILB 3RK3E 1HF9A 1U7MA 2W6AA 2JWDA 3V4QA 3L70D 3CX5E 3I5CA 3L73E 2HLOB 4TLFA 2IFNA 3BVHA 2B87B 1X9VA 1EQ7A 1BGYG 1RE4C 3O6QA 5APWA 5AW4B 1Q81Q 1GL2C 2H8PD 3TNUB 1A02J 4CPGA 1PGOA 2WITA 1JOCA 2H89C 2R5BA 1JCCA 4AUWA 1PP9D 2E74B 4BWNA 2QG4A 1WRGA 5CCHA 1YITP 3HD7D 5KKZC 2K9JB 1M8OB 2GUVA 3HUSA 1M90Q 2J0YA 3VYIA 3H1HE 3HE5B 1EZVI 1NU1K 1KMIZ 1GU5A 3TSIA 1L4AD 2R44A 1OW6A 3M0DA 3N4XA 1FZGB 1OWAA 3L37A 4OH8B 1LTJA 1R5LA 3BASA 2LXBA 3FGAD 1N86B 3MZWB 5AW7B 3GF3A 2WPSA 1KV4A 1JMMA 1NTMD 1N8RQ 1KQSO 4ZFGA 3CX5H 3H1IG 2I1JA 2J3FD 2BEZF 1LNQA 1M7LA 3H6PA 1EDKA 1NTKE 2J5UA 4U7JA 1IFDA 1QLED 2KP8A 3CCJP 1IFMA 1LJ2A 1VQOP 1NTZD 4L73A 1N7SB 1L0LK 3U1AA 1MKMA 3M06A 2KK7A 1JMBA 2IX7C 1YQ3C 5KKZB 1VQ6P 2KZIA 3CCVP 3KDPB 1BDCA 2GY7A 1H0TA 2OARA 4RESB 3L71E 4PV1B 3L74J 1KB9E 2YXRB 1QL2A 1TU3F 2OYOA 1DIPA 1MFTA 1OVVA 2JHLF 1OW7A 1L4AC 2FFDB 1VF5C 2WMMA 1RF0A 2V4HA 4H0LC 1OIPA 3R4YA 1SQQG 3ITKA 3KPEA 5H2FH 4A7PA 4M3LA 2G8YA 3BCCE 3RK2D 1EDJA 3V2NA 2QVAA 4XFJA 3D6YA 5CMZA 3H1LG 3WUTA 5TISH 3L70E 5BVZA 1CW5A 4PV1C 2H88C 2Z4EA 5CJ4A 1IJDB 5KTBA 1FZFC 4HJGH 2BCCG 2J2PA 3L73G 1M1JB 1EZVD 2QSIA 5CCGD 2FXPA 2J3FA 1FDIA 3CI9A 3H1ID 1SQBK 1BCCJ 2C0WA 2Y0DA 2J64A 2B9BA 1ZMEC 4EYYQ 1RE3C 1JY3O 4W7ZA 4IFDK 2M5AA 2XNXB 3JC22 3MP7B 1RF1C 4N78E 5KAFH 4H0LB 3GHGA 1HGZA 2FBWC 1NGMB 3RGUA 1BSHA 1BE3J 2A45G 1BCCD 2D2CD 3CL3D 2N1TA 4Y28J 5B66H 4H0LD 5H2FE 1LTGC 3H1HG 2Z5HA 2QA4P 1FIBA 2G3AA 3EFFK 1KORA 1SQQE 2Y0CA 5KLVJ 1PGJA 1J1DB 3H32C 1S5LE 3CWBD 2BCCJ 3IAOA 1SQBJ 4NPDA 4I2LC 4Y99B 2L5GB 3H1KE 4UB6H 2ZXEB 1FS0E 2IBZE 2NPSB 2FKWB 1T6AA 1T3UA 3QWOC 1NJIQ 3SWYA 1PGQA 1LT9C 2FYUG 4HH2A 2JHHC 3CCMP 1FZFB 2P2UA 4GDOA 1AQ5A 2O1JA 3HE4A 1KILA 2WSCJ 2C0XA 2ZXXA 3L36A 1GDTA 5AVWB 5CBNA 1S72P 4IFMA 3L75J 3M0AA 4O9BA 3Q5PA 2YIUB 1AFOA 3OW2O 3MHVA 3JSVC 1MUUA 3N7NA 1BSNA 1KILD 1G1IA 3JCUE 2J61B 1FOSE 3H32B 2WWWA 1M1KQ 3AEEC 3H1JJ 1LWUB 3CCUP 3CLQA 1SQXG 4NPEA 4WBAA 2IZ1A 2O01H 1VL2A 2E74C 3ABVC 5AW1B 4GODA 3CC4P 5CCHC 1GZLA 3KZIH 1W5CE 3LIDA 1L0NK 3W68A 1HUCA 1OVRA 1SS1A 3TGUJ 5APUA 2Z4EC 1KQLA 3M9BA 4DCKA 1KYOI 3GHGC 2J3GA 1SQVE 5B5EE 1LT9B 1RF1A 1OZHA 3L72J 1BGYD 1Y9BA 1M56D 1PV3A 4Y99C 1RE4A 2KI7B 1EZVE 4OWFA 2XV5A 1Q90D 3H1KG 3TGUD 2JHIF 2NZ2A 1GTWA 1SVFA 2FYNB 4WVZA 3CCRP 1Y47A 3A0HH 2RH0A 2AXTE 4C7NB 2W27A 1ZRTD 5GTHH 1J1DC 2RKLA 1L0NJ 1NWQA 1CI6B 1RHZB 3T97B 1L0NG 1YTZI 1YJ9P 1NTZE 1JY3P 2WT7B 2WPVB 1YBKA 2HR3A 3FX0A 2YNYA 3E1IA 1SLQA 2OQQA 3WMM0 5E79H 3E1RA 1L0ND 3U59A 1SQXK 4N6JA 3SFDC 1L4AB 2MKVA 1EDLA 1DH3A 3H1KJ 3VMZA 2D2CB 3TDKA 1NO4A 1Y8AA 1RE3A 1IC2A 2NPSA 1GL2B 2KNCA 2KSJA 4D6TJ 3HE5A 5EFWB 1KTMA 2P1JA 4H13C 5APSA 1BGYJ 2NPSD 2YIUC 1L0LD 3V2QA 1N73C 2AEMA 3H1HD 1PFIA 5APVA 4EOTA 3IN6A 3HD7A 2ZYGA 3AEDC 1T2KC 1IFJA 1N86A 4NYTA 1HWTC 3PRJA 1LGHB 3B5NB 4C7RA 2IBZG 2OGUA 2WSFJ 2P10A 1JEKA 2XZRA 1SQXJ 3L4FA 2K37A 1YQ4C 1ZP0C 1JO5A 1L0NE 1BGYE 4I7ZB 2V7QH 3L71G 2R3CA 1P84I 2YKQA 3L75D 3QH9A 2MJZA 3M9HA 2Q5UA 1SFCA 4PD4E 1YJWP 3L71D 3SSUA 4OGQC 2W6JH 4GOFA 1GD2E 2WQYC 4DT0A 1DEBA 2N9YB 3C8VA 3BCCG 3S9OA 1J1EB 1FZAB 2YMYA 1SQVJ 5APQA 2HPCB 1FBMA 2WNPF 2XNXA 2ITAA 1YHQP 2ZT9B 3S1KA 3Q2YA 4H13B 3L71J 1SQBG 4ASVA 2Q9IB 3K5BA 3BRVB 5CBOA 5AW2B 2IZ0A 3GMAA 5CCGA 1FZEA 3MTUE 1OX3A 1XTCC 2M3BA 3RL0B 3L72D 2BCCE 2JP3A 1OMIA 2FYZA 2E74D 2W90A 2P7JA 2QEXP 1BE3G 4ZNCA 5CCHD 3P32A 4NPFX 4WY4B 3U1CA 2YXQB 1VQLP 3CCEP 2KYVA 1SFCD 2W83C 2YKOA 2M0BA 3E1IB 1YI2P 3MUDA 1RY3A 2HODC 4AYCA 1NAYA 3VMYA 1KZUB 2IPPA 2QM7A 2IFMA 2E75B 3II6A 2DW3A 3LW5J 4IL6H 1S5LH 1P84D 1N73A 3NTNA 1HBWA 1P84E 1FJPA 3G4SP 2HPCC 3RL0g 1NTZG 1ZR4A 1SQBE 2KOGA 2PAJA 3KQGA 1URQB 3D6ZA 1R5SA 2OYHB 1MFZA 2ZVOB 1FZDA 1SQVD 1NTMK 3Q5RA 2HLOA 1PPJG 3H1LJ 2J0HA 3E7KA 1JY3N 1Q2NA 2KXPB 5AVRB 5B5EH 1FU1A 2Q1KA 4PD4H 1Q7YQ 2B88A 2HYNA 3TYYA 3AE7C 1BE3E 3WUUA 3P8CD 5APXA 1W2EA 2FYUD 2BEQD 3A3YB 3I56P 1VQ8P 1ZW0A 1RF0B 2HODA 1SQPD 3FXEA 1LTAC 2K9YA 2J58A 2R32A 2IBZI 2POHA 1KILE 1FICA 3L74G 1FZCC 2JO1A 1VF5D 2J3OA 4YXWH 5KJ7A 3MGNA 1UIXA 2FYNC 1J1EC 3IFMA 1VF5B 3M9QA 2K3RA 4N78D 4U3FG 5AVVB 1JY2P 4H13D 1SQPJ 1SQXE 2A45H 2NPSC 4JBZA 3RK3C 2KS1A 3HUSB 4IOIH 2KB7P 1PL5A 1VQMP 1T2KD 1KYOH 3PHLA 5AVXB 3HD7C 2QRXA 3O8ZA 4LGDE 4D6TD 3T97A 5GTIE 1KFNA 1UIIA 4DZOA 2O3JA 4YTPC 1AQTA 4R9TA 2H43B 3AE3C 5AVQB 4DJGA 1HTLC 1NHLA 5C39A 1SQQD 1PPJE 2RN0A 1OFCX 4JPZB 1SQVK 4M7HA 1G2CB 1IFNA 4WY4A 3L70G 2E43A 2N1TD 2YKPA 1EXIA 2K1AA 2E75C 1VQPP 3HTKA 3G9RA 2FYUJ 4ZMDA 2KLUA 3BCCD 2FIBA 1H88A 1DD4A 1LTJC 1EC5A 1MZ9A 1Z56A 4QMAA 2P58A 2B89A 3VMAA 2QM8A 5BU5A 1LP1B 1RF1B 1HJ0A 3B5NC 1NTZJ 1FOSF 2XNDH 3B8EB 4OVNF 3G6EP 1NH4A 1KYOD 5KLVG 3PTZA 1HH0A 1S4XA 1YYCA 5CHXA 5AW8B 1VQ4P 1AVYA 2E5TA 2KZJA 3SFEC 1N7LA 3AEFC 3FIBA 1JTHA 1L2PA 4JQ0D 3FXDA 1IK9A 4R4MA 2E42A 1R8EA 5AW5B 2JJLA 4M7FA 5TJHA 1QVGO 1IO4A 3A0BH 4WB4A 2JDIH 3NXSA 3AE5C 3V2PA 3TGUE 1N7SC 1LT1A 3H1LD 2J60A 4I1LA 3MUDC 3CCQP 1KILC 3ZDMA 1BDDA 2Z4EB 4HB1A 1SQVG 1DX7A 3BCCJ 2JWAA 2Q7CA 2OTKE 3GW6A 5KJ7D 1EZVG 3KXDA 1FZCA 1Z3SA 3IR9A 2PP6A 1NAFA 3P7KA 1X22A 1L0LE 2IYPA 1U7JA 1KB9H 3VP8A 1FZEC 1FC2C 2FXMA 2I8DA 5CCGC 1OW8A 2LXCB 5KLVE 4PJ0E 3Q5SA 1SQPK 3EWKA 2QJKB 3AEAC 2J1GA 3F5HA 1PP9J 1JCDA 2JEEA 4U3FE 2H43A 2GM4A 2N1TB 5AVZB 2J3UA 1VQNP 3TNUA 3V5BA 1H0TB 1IFIA 3C9IA 4ZKPA 2K9JA 4AQRD 4R9JA 5GTHE 3LW5H 3AE1C 5B66E 1KYOE 1JY2N 2O01J 1JUNA 5KAIH 1AVOA 2IYOA 1FZBA 1M1JC 3PH0A 3G3ZA 2XKMA 4I7ZC 1A02F 2FFDA 2GA1A 1FZGA 4ZKUA 3TK1A 3RK3D 5KAFE 1EDIA 4D6TG 3GF7A 4H44D 1H8AA 2OYHA 2E76D 4XE5B 3WU2E 1S3JA 1FZFA 1PPJD 2LKMA 3H25A 4N3YB 1N2DC 1JNMA 1VQ7P 3H1IJ 3WU2H 1URQD 2NRGA 1FZEB 3MD0A 4EDFA 4IFFA 1KB9I 1K73Q 5DJUB 1OXZA 3OJAB 2E5YA 1ZXGA 1GU4A 1BCCE 1IFPA 2FXOA 1FDMA 2I1KA 1K04A 3CCLP 2A06D 3A7OA 2VRSA 4I6MC 3H1JE 1G1JA 4BRYA 1FJKA 2E75D 1Q86Q 2OYIA 3SWKA 1YIJP 4JZCA 3CWBG 3AEBC 3H1JD 4L75A 1YTZT 4RJTA 1Z3UA 3OAKA 3CMEP 4KJMA 1DD3A 3CX5D 5AVSB 5AW9B 2D39A 3H1KD 1N73B 3CWBJ 3VTPC 3CC7P 1GL2D 1M57D 2C9NY 2WPQA 2WVRA 1J2JB 2QJPC 2QJYC 4PD4I 2J59M 1S2EA 3L72G 1AV1A 3UIAA 1RQVA 5KLIB 1AJYA 1E5WA 4H44C 1BE3D 1ZN5A 2RMZA 5GTIH 3AE4C 1U57A 2XU6A 4D6TE 3TGUG 3P8CE 2BASA 2YO2A 4PJ0H 1S9KE 2M3EA 3Q3DA 5K5GB 4C7NA 3CXHH 2ZYAA 3RL0C 1S9KD 1CZQA 3A0HE 3LIEA 1JC9A 2BCCD 1SQBD 1VPCA 2FYUK 3H1JG 2OYHC 3HTKB 1CI6A 1KQFB 1N7SD 1QL1A 1LWUA 1ZLLA 3BVHC 1FZAC 2AEJA 2OTJP 2M8RA 2ZT9C 2O1KA 3A2AA 3L75G 2ZYDA 2OYIC 3L35A 1GK6A 4EPUA 2V7QJ 2ZVNB 1NTKJ 4GKGA 1USDA 1M1JA 1FZBB 2WSFH 2M5AB 3AE6C
chains in the Genus database with same CATH topology
3O8ZA 4LGDE 3T97A 5CJ0A 1URQC 1KFNA 4DZOA 5AW1B 2H7HA 5CCHC 1GZLA 2YO3A 3LIDA 1L0NK 4R9TA 1GW4A 1HUCA 2H43B 5AVQB 2WPRA 1HTLC 5APUA 1NHLA 2Z4EC 1KQLA 5AW6B 3M9BA 3RK3B 1ZV8A 1N7SA 2OYIB 4JYCA 1RE4B 2WTYA 3NFQA 3HRNA 3GHGC 2J3GA 1SQVK 4M7HA 1G2CB 3E1IC 1IFNA 4WY4A 2E43A 1LT9B 2N1TD 4EIJA 1RF1A 3OA7A 2YKPA 5APTA 3HD7B 1KILB 4Y99C 1RE4A 2W6AA 3HTKA 3V4QA 2XV5A 2FIBA 1H88A 2JHIF 1LTJC 4B86A 1MZ9A 1Z56A 3I5CA 4WY4D 2FFDC 2HLOB 1LT9A 1GTWA 2IFNA 3RL0D 3BVHA 2QM8A 5BU5A 1X9VA 1SVFA 1RF1B 2A45I 1EQ7A 1SFCB 3B5NC 1FOSF 1KFMA 3B8EB 1RE4C 5APWA 5AW4B 1X79B 1GL2C 1NH4A 2H8PD 2WSEH 3PP5A 3TNUB 4C7NB 2W27A 1A02J 3RK2C 1HH0A 1YYCA 1J1DC 5CHXA 5AW8B 2WITA 1NWQA 1JOCA 3BRTB 1XTGB 1CI6B 2CPSA 2R5BA 1JCCA 4AUWA 1FIDA 1YTZI 3EFGA 1FZCB 1N7LA 1JY3P 2WT7B 2Q9IA 1WRGA 5CCHA 3FIBA 1JTHA 2YNYA 3E1IA 1SLQA 1N86C 3HD7D 2WSCH 3WMM0 2J61A 1IK9A 2E42A 2GUVA 3HUSA 5BU8B 2J0YA 3VYIA 3U59A 1H89A 1VDFA 5AW5B 3VP9A 2JJLA 1SQXK 3HE5B 1LTJB 4N6JA 4M7FA 1NU1K 1L4AB 3M0DC 1DH3A 1IO4A 1GU5A 3TSIA 3VMZA 3A5TA 1L4AD 4WB4A 3M0DA 1NO4A 1RE3A 3N4XA 3NXSA 1FZGB 1IC2A 1HVVA 1OWAA 3H32A 2NPSA 3KYQA 3V2PA 1GL2B 2KSJA 3L37A 4OH8B 1LTJA 3HE5A 1N7SC 3BASA 3V4WA 4HYTB 2J60A 4I1LA 1N86B 5AW7B 2H43C 2P1JA 1NKZB 2Q3IA 4XA4A 1KILC 2NPSD 5APSA 2WPSA 3NMDA 2Z4EB 1JMMA 3V2QA 1N73C 4ZFGA 1DX7A 2I1JA 2J3FD 1PFIA 2J0GA 1M7LA 5APVA 4EOTA 3H6PA 2Q7CA 3HD7A 4C46A 5AW0B 1T2KC 2JHMF 1IFJA 1N86A 4NYTA 5KJ7D 1IFDA 1HWTC 2KP8A 1IFMA 1LGHB 3B5NB 4C7RA 5AVUB 1FZCA 4JYBA 2XZRA 2C9LY 3IR9A 1N7SB 3L4FA 2PP6A 1NAFA 1Z3SA 3P7KA 3V2RA 2HG5D 1L0LK 5APYA 3U1AA 3M06A 1JO5A 3VP8A 1FZEC 2FXMA 5CCGC 2IX7C 4JF7A 3BATA 2R3CA 1SQPK 2YKQA 3VN0A 2MJZA 3M9HA 2Q5UA 2J1GA 3KDPB 2W6BA 2GY7A 4GT1A 2OARA 4RESB 1JCDA 1HGVA 1SFCA 2JEEA 2CPBA 2H43A 2GM4A 1QL2A 1HJBA 2N1TB 1FZAA 1URQA 5AVZB 2J3UA 1SQQK 4LLHA 2WT7A 3TNUA 1LTBC 1GD2E 3V5BA 1IFIA 3C9IA 2JHLF 2ZFCA 4ZKPA 4R9JA 4AQRD 1L4AC 1DEBA 5AW3B 3LW5H 1J1EB 2FFDB 1FZAB 2YMYA 1RF0A 5APQA 2HPCB 1FBMA 4W80A 1JY2N 2XNXA 2WNPF 1JUNA 3KPEA 1FZGC 2Q9IB 4M3LA 1FZBA 3BRVB 3RK2D 3R2PA 3HE4B 1M1JC 3V2NA 3G3ZA 2XKMA 1A02F 5AW2B 1RE3B 3M91A 2Z5IA 2FFDA 1FZGA 5CCGA 2HFED 3TK1A 1JTHB 3RK3D 4ZKUA 1FZEA 3MTUE 1H8AA 1RF0C 5CMZA 1XTCC 2OYHA 1FAVA 3EQ2A 2M3BA 4XE5B 4LC1A 1LTIC 3RL0B 1L4AA 1X8YA 2WZ7A 5BVZA 1FZFA 1CW5A 2LKMA 4N3YB 2FYZA 1N2DC 2J5ZA 1JNMA 1NOHA 2P7JA 2Z4EA 5CJ4A 1IJDB 5KTBA 1URQD 5AVYB 2GUSA 1FZEB 3MD0A 4IFFA 5CCHD 3P32A 1FZFC 4DOJA 4WY4B 1OXZA 3OJAB 3U1CA 1CSBA 1LTSC 1GU4A 1GW3A 2J2PA 1M1JB 1SFCD 2KYVA 2YKOA 5CCGD 3E1IB 1MV8A 1FDMA 3MUDA 1RY3A 2HODC 2I1KA 4AYCA 2J3FA 1LWUC 3VMYA 3CI9A 1KZUB 2IPPA 2P67A 3MIWA 2QM7A 3A7OA 2IFMA 3BVHB 2VRSA 3II6A 1SQBK 2C0WA 4I6MC 2J64A 1T3JA 1T8ZA 1G1JA 1WT6A 1FJKA 1N73A 1RE3C 2OYIA 3NTNA 5AVTB 2HLOC 1JY3O 4JZCA 4W7ZA 1HBWA 4GIFA 4IFDK 3B5NA 1NKNA 2XNXB 1YTZT 3SWFA 1Z3UA 3OAKA 1RF1C 4N78E 1FJPA 4WY4C 1G2CA 2HPCC 5AVSB 3GHGA 1HGZA 5AW9B 1FZBC 1ZR4A 2D39A 2A45G 2KOGA 1N73B 2PAJA 3CL3D 3VTPC 2N1TA 3KQGA 1URQB 5KJ7C 1LTGC 1GL2D 2OYHB 1MFZA 2C9NY 2WPQA 1FZDA 2Z5HA 1NTMK 3P8MC 2HLOA 1J2JB 1FIBA 2J59M 2J0HA 3UIAA 5KLVK 3VOPA 1JY3N 1E5WA 2HPCA 5AVRB 1FU1A 1J1DB 3H32C 1ZN5A 2HYNA 3TYYA 1NTZK 4I2LC 2XU6A 4Y99B 2Q9IC 2L5GB 2N1TC 3P8CD 2ZXEB 5APXA 1W2EA 3P8CE 2BASA 2NPSB 2FKWB 2YO2A 1T3UA 3A3YB 2XDJA 1SP4A 1S9KE 2R5DA 3HUSC 3SWYA 1LTTC 1LT9C 4HH2A 1RF0B 2HODA 2JHHC 1GK4A 1LTAC 4C7NA 1FZFB 3RL0C 2J58A 4JYOX 2R32A 1SFCC 1S9KD 1CZQA 1JY2O 2POHA 2P2UA 1AQ5A 3LIEA 1JC9A 2O1JA 3B5ND 1FICA 3HE4A 1VPCA 1KILA 4W7YA 2FYUK 1FZCC 2C0XA 2OYHC 3HTKB 1ZR2A 1CI6A 3RK2B 2J3OA 1N7SD 2HODB 5KJ7A 3L36A 1QL1A 5AVWB 1GDTA 3MGNA 4IFMA 3M0AA 3GHGB 4O9BA 1LWUA 2JHKF 1ZLLA 3BVHC 1J1EC 3IFMA 1FZAC 3M9QA 1AFOA 4N78D 5AVVB 1JY2P 2M8RA 1MUUA 3N7NA 2A45H 2O1KA 3VMXA 1KILD 1G1IA 2NPSC 3A2AA 1GL2A 2J61B 1FOSE 3H32B 3RK3C 2OYIC 2WWWA 3L35A 3HUSB 2XNXC 2N9BA 1GK6A 4EPUA 2KB7P 1LWUB 3CLQA 1T2KD 1NTKK 4WBAA 2KLVA 4KHXA 4GKGA 1M1JA 2O01H 1FZBB 5AVXB 2WSFH 3HD7C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M7F A;  2A45 G;  1N73 B;  2JHL F;  4R9J A;  2OYH B;  2FFD B;  1FZA B;  1RF0 A;  1FZD A;  4R9T A;  2HPC B;  2WNP F;  1JY2 N;  2XNX A;  2HLO A;  2H43 B;  1RE3 A;  1FIB A;  1FZG B;  3H32 A;  1FZG C;  2J0H A;  2Z4E C;  2Q9I B;  1FZB A;  2OYI B;  1RE4 B;  1LTJ A;  1JY3 N;  1M1J C;  2HPC A;  3GHG C;  1RE3 B;  2J3G A;  2FFD A;  2J60 A;  1FZG A;  3H32 C;  4M7H A;  3E1I C;  1FZE A;  1N86 B;  1LT9 B;  1RF1 A;  2H43 C;  1RF0 C;  2OYH A;  2Q9I C;  2Z4E B;  1RE4 A;  1W2E A;  1N73 C;  4ZFG A;  2FIB A;  2J3F D;  1T3U A;  1FZF A;  2J0G A;  2JHI F;  1LTJ C;  2J5Z A;  2FFD C;  3HUS C;  1LT9 A;  2Z4E A;  2HLO B;  1LT9 C;  3BVH A;  2JHM F;  1RF0 B;  1FZE B;  1N86 A;  4NYT A;  2HOD A;  2JHH C;  1RF1 B;  1FZF C;  2A45 I;  1FZF B;  1FZC A;  4JYO X;  1JY2 O;  1RE4 C;  1JC9 A;  1Z3S A;  1FIC A;  2J2P A;  1M1J B;  1FZC C;  2OYH C;  2J3O A;  3E1I B;  2HOD B;  1FZE C;  2HOD C;  2J3F A;  3GHG B;  1LWU C;  1LWU A;  2JHK F;  3BVH C;  1FZA C;  3BVH B;  1JY2 P;  2J64 A;  2A45 H;  1FID A;  1FZC B;  1N73 A;  2J61 B;  1RE3 C;  2J1G A;  2OYI A;  2GY7 A;  3H32 B;  2OYI C;  1JY3 P;  3HUS B;  1JY3 O;  2Q9I A;  2HLO C;  4JZC A;  2XNX C;  4EPU A;  2XNX B;  1LWU B;  1Z3U A;  3FIB A;  2H43 A;  1RF1 C;  3E1I A;  1N86 C;  2J61 A;  1FZA A;  2J3U A;  1M1J A;  2HPC C;  3GHG A;  2J0Y A;  3HUS A;  1FZB B;  1FZB C;  2D39 A;  1LTJ B; 
#chains in the Genus database with same CATH topology
 3S4R A;  1PP9 G;  4L76 A;  2H7H A;  2SPZ A;  2YO3 A;  3A0B E;  1EXJ A;  3AE9 C;  1NTK D;  2A06 G;  3CD6 P;  3RK3 B;  1ZV8 A;  1N7S A;  1RE4 B;  4JYC A;  2WTY A;  4ASW A;  3HRN A;  2KSE A;  3E1I C;  2B87 A;  1IK7 A;  4EIJ A;  1KC8 Q;  3OA7 A;  3IF4 A;  5APT A;  3HD7 B;  1K8A Q;  1PIX A;  3O6Q B;  3H1H J;  3H1L E;  1VQ5 P;  3JCU H;  4B86 A;  4WY4 D;  2FFD C;  1LT9 A;  1PZQ A;  1KB9 D;  3RL0 D;  1NU1 G;  1KQG B;  1USE A;  2A45 I;  1SFC B;  4BRY B;  1KFM A;  2QJP B;  2QJY B;  1NTM G;  1X79 B;  5DJT B;  2ZJS E;  2WSE H;  3PP5 A;  3RK2 C;  2CK3 H;  2ZT9 D;  2Q6Q A;  3L74 D;  4MN4 C;  1BCC G;  2AEF A;  3BRT B;  4PD4 D;  3AEG C;  1XTG B;  2CPS A;  3C1L A;  1FID A;  3EFG A;  1FZC B;  2Q9I A;  4UB6 E;  3L73 J;  2AXC A;  1N86 C;  2WSC H;  2E76 B;  2J61 A;  5BU8 B;  1FDO A;  4K3A A;  3V6I A;  1H89 A;  1VDF A;  3VP9 A;  1FE6 A;  1LTJ B;  1NU1 J;  3CXH E;  2JR8 A;  2OTL P;  3M0D C;  5M1B A;  1JM0 A;  5E79 E;  4HKZ H;  3A5T A;  4U3F D;  3CMA P;  2JKV A;  1HVV A;  1QEX A;  3H32 A;  3L73 D;  3KYQ A;  3RBX A;  1QGK B;  4L74 A;  3V4W A;  4HYT B;  1NU1 D;  4EI2 A;  2O01 N;  2Y9Y A;  2H43 C;  1NKZ B;  2Q3I A;  4XA4 A;  4UB8 H;  1NU1 E;  3NMD A;  1SQQ J;  3CC2 P;  2W8Z A;  2J0G A;  1OVU A;  4R4L A;  1QX8 A;  2D2C C;  4C46 A;  5AW0 B;  1L0L G;  2JHM F;  3G71 P;  5AVU B;  1RQU A;  4JYB A;  3L70 J;  2C9L Y;  4RO0 A;  4RKU J;  1NTK G;  4K35 A;  3V2R A;  2HG5 D;  5APY A;  1NTM E;  2KUB A;  4JF7 A;  3BAT A;  1NYH A;  3VN0 A;  2WSS H;  1K9M Q;  1KN7 A;  2IDB A;  4IL6 X;  2PGD A;  2W6B A;  3Q1M A;  4GT1 A;  1SQX D;  1HGV A;  3WUV A;  2CPB A;  1LP1 A;  1HJB A;  2WSE J;  1FZA A;  1URQ A;  1SQQ K;  4LLH A;  2WT7 A;  1ZRT E;  5L8R J;  1LTB C;  2ZFC A;  3TF5 A;  5KLV D;  3GG2 A;  2PFX A;  5AW3 B;  1SQP G;  4W80 A;  4U3F J;  1X0T A;  1ZOY C;  3CX5 I;  2QJK C;  1FZG C;  1PP9 E;  2PRR A;  3R2P A;  3HE4 B;  5KLI C;  4YPC A;  1RE3 B;  3M91 A;  2Z5I A;  4OGQ B;  2HFE D;  1JTH B;  4UB8 E;  1RF0 C;  2QE7 H;  1FAV A;  3EQ2 A;  4LC1 A;  1LTI C;  3CXH D;  1L4A A;  1L0L J;  1X8Y A;  2WZ7 A;  4H44 B;  3F89 A;  2J5Z A;  1NOH A;  1IZN B;  3KHU A;  5AVY B;  2GUS A;  4DOJ A;  3D71 A;  1K05 A;  1CSB A;  1LTS C;  1GW3 A;  3CCS P;  2IBZ D;  1MV8 A;  3L74 E;  1LWU C;  3CWB E;  2ZAE B;  2P67 A;  2KS1 B;  3MIW A;  3BVH B;  1T3J A;  1T8Z A;  3FWL A;  1WT6 A;  1DEE G;  5AVT B;  2HLO C;  4GIF A;  2KIK A;  4Z1M H;  3B5N A;  1NKN A;  2Y0E A;  3SWF A;  1S1C X;  2AXT H;  4WY4 C;  1W2B O;  1G2C A;  1FZB C;  1JB0 J;  5KJ7 C;  4GOE A;  2R3S A;  3P8M C;  3CPW O;  1D7M A;  3B4S A;  5KLV K;  3VOP A;  1YJN P;  3L72 E;  2HPC A;  3H1I E;  1NTM J;  2Q3E A;  1WMK A;  3I55 P;  3W67 A;  1NTZ K;  3PJS K;  2Q9I C;  2N1T C;  3RBZ A;  1KD1 Q;  3CXH I;  2XDJ A;  1SP4 A;  2R5D A;  3KZI E;  3PLN A;  3HUS C;  1LTT C;  3USS A;  1GK4 A;  4JYO X;  2K88 A;  1SFC C;  2QIW A;  1JY2 O;  3B5N D;  4W7Y A;  2FYU E;  1NVO A;  1ZR2 A;  3RK2 B;  2HOD B;  5KAI E;  1VQ9 P;  3GHG B;  5TIS E;  1QVF O;  2JHK F;  2Y9Z A;  2UWJ E;  1S5L X;  4WWI A;  3VMX A;  1PGP A;  3FWN A;  1P84 H;  1GL2 A;  2KNC B;  2L91 A;  4YXD C;  3D70 A;  2XNX C;  2N9B A;  3L75 E;  4BXL A;  3AEC C;  2LR2 A;  2E76 C;  1NTK K;  2KLV A;  4KHX A;  1Q82 Q;  4PV1 D;  3GLM A;  2A06 E;  5CJ0 A;  1URQ C;  2YMK A;  1AA0 A;  3AE2 C;  1VQK P;  1E79 H;  1GW4 A;  4KT0 J;  2FY8 A;  2WPR A;  1GMJ A;  5AW6 B;  2OYI B;  4TT3 H;  3NFQ A;  1SQP E;  4IL6 E;  4OGQ D;  3B71 A;  1RH5 B;  3AE8 C;  1KIL B;  3RK3 E;  1HF9 A;  1U7M A;  2W6A A;  2JWD A;  3V4Q A;  3L70 D;  3CX5 E;  3I5C A;  3L73 E;  2HLO B;  4TLF A;  2IFN A;  3BVH A;  2B87 B;  1X9V A;  1EQ7 A;  1BGY G;  1RE4 C;  3O6Q A;  5APW A;  5AW4 B;  1Q81 Q;  1GL2 C;  2H8P D;  3TNU B;  1A02 J;  4CPG A;  1PGO A;  2WIT A;  1JOC A;  2H89 C;  2R5B A;  1JCC A;  4AUW A;  1PP9 D;  2E74 B;  4BWN A;  2QG4 A;  1WRG A;  5CCH A;  1YIT P;  3HD7 D;  5KKZ C;  2K9J B;  1M8O B;  2GUV A;  3HUS A;  1M90 Q;  2J0Y A;  3VYI A;  3H1H E;  3HE5 B;  1EZV I;  1NU1 K;  1KMI Z;  1GU5 A;  3TSI A;  1L4A D;  2R44 A;  1OW6 A;  3M0D A;  3N4X A;  1FZG B;  1OWA A;  3L37 A;  4OH8 B;  1LTJ A;  1R5L A;  3BAS A;  2LXB A;  3FGA D;  1N86 B;  3MZW B;  5AW7 B;  3GF3 A;  2WPS A;  1KV4 A;  1JMM A;  1NTM D;  1N8R Q;  1KQS O;  4ZFG A;  3CX5 H;  3H1I G;  2I1J A;  2J3F D;  2BEZ F;  1LNQ A;  1M7L A;  3H6P A;  1EDK A;  1NTK E;  2J5U A;  4U7J A;  1IFD A;  1QLE D;  2KP8 A;  3CCJ P;  1IFM A;  1LJ2 A;  1VQO P;  1NTZ D;  4L73 A;  1N7S B;  1L0L K;  3U1A A;  1MKM A;  3M06 A;  2KK7 A;  1JMB A;  2IX7 C;  1YQ3 C;  5KKZ B;  1VQ6 P;  2KZI A;  3CCV P;  3KDP B;  1BDC A;  2GY7 A;  1H0T A;  2OAR A;  4RES B;  3L71 E;  4PV1 B;  3L74 J;  1KB9 E;  2YXR B;  1QL2 A;  1TU3 F;  2OYO A;  1DIP A;  1MFT A;  1OVV A;  2JHL F;  1OW7 A;  1L4A C;  2FFD B;  1VF5 C;  2WMM A;  1RF0 A;  2V4H A;  4H0L C;  1OIP A;  3R4Y A;  1SQQ G;  3ITK A;  3KPE A;  5H2F H;  4A7P A;  4M3L A;  2G8Y A;  3BCC E;  3RK2 D;  1EDJ A;  3V2N A;  2QVA A;  4XFJ A;  3D6Y A;  5CMZ A;  3H1L G;  3WUT A;  5TIS H;  3L70 E;  5BVZ A;  1CW5 A;  4PV1 C;  2H88 C;  2Z4E A;  5CJ4 A;  1IJD B;  5KTB A;  1FZF C;  4HJG H;  2BCC G;  2J2P A;  3L73 G;  1M1J B;  1EZV D;  2QSI A;  5CCG D;  2FXP A;  2J3F A;  1FDI A;  3CI9 A;  3H1I D;  1SQB K;  1BCC J;  2C0W A;  2Y0D A;  2J64 A;  2B9B A;  1ZME C;  4EYY Q;  1RE3 C;  1JY3 O;  4W7Z A;  4IFD K;  2M5A A;  2XNX B;  3JC2 2;  3MP7 B;  1RF1 C;  4N78 E;  5KAF H;  4H0L B;  3GHG A;  1HGZ A;  2FBW C;  1NGM B;  3RGU A;  1BSH A;  1BE3 J;  2A45 G;  1BCC D;  2D2C D;  3CL3 D;  2N1T A;  4Y28 J;  5B66 H;  4H0L D;  5H2F E;  1LTG C;  3H1H G;  2Z5H A;  2QA4 P;  1FIB A;  2G3A A;  3EFF K;  1KOR A;  1SQQ E;  2Y0C A;  5KLV J;  1PGJ A;  1J1D B;  3H32 C;  1S5L E;  3CWB D;  2BCC J;  3IAO A;  1SQB J;  4NPD A;  4I2L C;  4Y99 B;  2L5G B;  3H1K E;  4UB6 H;  2ZXE B;  1FS0 E;  2IBZ E;  2NPS B;  2FKW B;  1T6A A;  1T3U A;  3QWO C;  1NJI Q;  3SWY A;  1PGQ A;  1LT9 C;  2FYU G;  4HH2 A;  2JHH C;  3CCM P;  1FZF B;  2P2U A;  4GDO A;  1AQ5 A;  2O1J A;  3HE4 A;  1KIL A;  2WSC J;  2C0X A;  2ZXX A;  3L36 A;  1GDT A;  5AVW B;  5CBN A;  1S72 P;  4IFM A;  3L75 J;  3M0A A;  4O9B A;  3Q5P A;  2YIU B;  1AFO A;  3OW2 O;  3MHV A;  3JSV C;  1MUU A;  3N7N A;  1BSN A;  1KIL D;  1G1I A;  3JCU E;  2J61 B;  1FOS E;  3H32 B;  2WWW A;  1M1K Q;  3AEE C;  3H1J J;  1LWU B;  3CCU P;  3CLQ A;  1SQX G;  4NPE A;  4WBA A;  2IZ1 A;  2O01 H;  1VL2 A;  2E74 C;  3ABV C;  5AW1 B;  4GOD A;  3CC4 P;  5CCH C;  1GZL A;  3KZI H;  1W5C E;  3LID A;  1L0N K;  3W68 A;  1HUC A;  1OVR A;  1SS1 A;  3TGU J;  5APU A;  2Z4E C;  1KQL A;  3M9B A;  4DCK A;  1KYO I;  3GHG C;  2J3G A;  1SQV E;  5B5E E;  1LT9 B;  1RF1 A;  1OZH A;  3L72 J;  1BGY D;  1Y9B A;  1M56 D;  1PV3 A;  4Y99 C;  1RE4 A;  2KI7 B;  1EZV E;  4OWF A;  2XV5 A;  1Q90 D;  3H1K G;  3TGU D;  2JHI F;  2NZ2 A;  1GTW A;  1SVF A;  2FYN B;  4WVZ A;  3CCR P;  1Y47 A;  3A0H H;  2RH0 A;  2AXT E;  4C7N B;  2W27 A;  1ZRT D;  5GTH H;  1J1D C;  2RKL A;  1L0N J;  1NWQ A;  1CI6 B;  1RHZ B;  3T97 B;  1L0N G;  1YTZ I;  1YJ9 P;  1NTZ E;  1JY3 P;  2WT7 B;  2WPV B;  1YBK A;  2HR3 A;  3FX0 A;  2YNY A;  3E1I A;  1SLQ A;  2OQQ A;  3WMM 0;  5E79 H;  3E1R A;  1L0N D;  3U59 A;  1SQX K;  4N6J A;  3SFD C;  1L4A B;  2MKV A;  1EDL A;  1DH3 A;  3H1K J;  3VMZ A;  2D2C B;  3TDK A;  1NO4 A;  1Y8A A;  1RE3 A;  1IC2 A;  2NPS A;  1GL2 B;  2KNC A;  2KSJ A;  4D6T J;  3HE5 A;  5EFW B;  1KTM A;  2P1J A;  4H13 C;  5APS A;  1BGY J;  2NPS D;  2YIU C;  1L0L D;  3V2Q A;  1N73 C;  2AEM A;  3H1H D;  1PFI A;  5APV A;  4EOT A;  3IN6 A;  3HD7 A;  2ZYG A;  3AED C;  1T2K C;  1IFJ A;  1N86 A;  4NYT A;  1HWT C;  3PRJ A;  1LGH B;  3B5N B;  4C7R A;  2IBZ G;  2OGU A;  2WSF J;  2P10 A;  1JEK A;  2XZR A;  1SQX J;  3L4F A;  2K37 A;  1YQ4 C;  1ZP0 C;  1JO5 A;  1L0N E;  1BGY E;  4I7Z B;  2V7Q H;  3L71 G;  2R3C A;  1P84 I;  2YKQ A;  3L75 D;  3QH9 A;  2MJZ A;  3M9H A;  2Q5U A;  1SFC A;  4PD4 E;  1YJW P;  3L71 D;  3SSU A;  4OGQ C;  2W6J H;  4GOF A;  1GD2 E;  2WQY C;  4DT0 A;  1DEB A;  2N9Y B;  3C8V A;  3BCC G;  3S9O A;  1J1E B;  1FZA B;  2YMY A;  1SQV J;  5APQ A;  2HPC B;  1FBM A;  2WNP F;  2XNX A;  2ITA A;  1YHQ P;  2ZT9 B;  3S1K A;  3Q2Y A;  4H13 B;  3L71 J;  1SQB G;  4ASV A;  2Q9I B;  3K5B A;  3BRV B;  5CBO A;  5AW2 B;  2IZ0 A;  3GMA A;  5CCG A;  1FZE A;  3MTU E;  1OX3 A;  1XTC C;  2M3B A;  3RL0 B;  3L72 D;  2BCC E;  2JP3 A;  1OMI A;  2FYZ A;  2E74 D;  2W90 A;  2P7J A;  2QEX P;  1BE3 G;  4ZNC A;  5CCH D;  3P32 A;  4NPF X;  4WY4 B;  3U1C A;  2YXQ B;  1VQL P;  3CCE P;  2KYV A;  1SFC D;  2W83 C;  2YKO A;  2M0B A;  3E1I B;  1YI2 P;  3MUD A;  1RY3 A;  2HOD C;  4AYC A;  1NAY A;  3VMY A;  1KZU B;  2IPP A;  2QM7 A;  2IFM A;  2E75 B;  3II6 A;  2DW3 A;  3LW5 J;  4IL6 H;  1S5L H;  1P84 D;  1N73 A;  3NTN A;  1HBW A;  1P84 E;  1FJP A;  3G4S P;  2HPC C;  3RL0 g;  1NTZ G;  1ZR4 A;  1SQB E;  2KOG A;  2PAJ A;  3KQG A;  1URQ B;  3D6Z A;  1R5S A;  2OYH B;  1MFZ A;  2ZVO B;  1FZD A;  1SQV D;  1NTM K;  3Q5R A;  2HLO A;  1PPJ G;  3H1L J;  2J0H A;  3E7K A;  1JY3 N;  1Q2N A;  2KXP B;  5AVR B;  5B5E H;  1FU1 A;  2Q1K A;  4PD4 H;  1Q7Y Q;  2B88 A;  2HYN A;  3TYY A;  3AE7 C;  1BE3 E;  3WUU A;  3P8C D;  5APX A;  1W2E A;  2FYU D;  2BEQ D;  3A3Y B;  3I56 P;  1VQ8 P;  1ZW0 A;  1RF0 B;  2HOD A;  1SQP D;  3FXE A;  1LTA C;  2K9Y A;  2J58 A;  2R32 A;  2IBZ I;  2POH A;  1KIL E;  1FIC A;  3L74 G;  1FZC C;  2JO1 A;  1VF5 D;  2J3O A;  4YXW H;  5KJ7 A;  3MGN A;  1UIX A;  2FYN C;  1J1E C;  3IFM A;  1VF5 B;  3M9Q A;  2K3R A;  4N78 D;  4U3F G;  5AVV B;  1JY2 P;  4H13 D;  1SQP J;  1SQX E;  2A45 H;  2NPS C;  4JBZ A;  3RK3 C;  2KS1 A;  3HUS B;  4IOI H;  2KB7 P;  1PL5 A;  1VQM P;  1T2K D;  1KYO H;  3PHL A;  5AVX B;  3HD7 C;  2QRX A;  3O8Z A;  4LGD E;  4D6T D;  3T97 A;  5GTI E;  1KFN A;  1UII A;  4DZO A;  2O3J A;  4YTP C;  1AQT A;  4R9T A;  2H43 B;  3AE3 C;  5AVQ B;  4DJG A;  1HTL C;  1NHL A;  5C39 A;  1SQQ D;  1PPJ E;  2RN0 A;  1OFC X;  4JPZ B;  1SQV K;  4M7H A;  1G2C B;  1IFN A;  4WY4 A;  3L70 G;  2E43 A;  2N1T D;  2YKP A;  1EXI A;  2K1A A;  2E75 C;  1VQP P;  3HTK A;  3G9R A;  2FYU J;  4ZMD A;  2KLU A;  3BCC D;  2FIB A;  1H88 A;  1DD4 A;  1LTJ C;  1EC5 A;  1MZ9 A;  1Z56 A;  4QMA A;  2P58 A;  2B89 A;  3VMA A;  2QM8 A;  5BU5 A;  1LP1 B;  1RF1 B;  1HJ0 A;  3B5N C;  1NTZ J;  1FOS F;  2XND H;  3B8E B;  4OVN F;  3G6E P;  1NH4 A;  1KYO D;  5KLV G;  3PTZ A;  1HH0 A;  1S4X A;  1YYC A;  5CHX A;  5AW8 B;  1VQ4 P;  1AVY A;  2E5T A;  2KZJ A;  3SFE C;  1N7L A;  3AEF C;  3FIB A;  1JTH A;  1L2P A;  4JQ0 D;  3FXD A;  1IK9 A;  4R4M A;  2E42 A;  1R8E A;  5AW5 B;  2JJL A;  4M7F A;  5TJH A;  1QVG O;  1IO4 A;  3A0B H;  4WB4 A;  2JDI H;  3NXS A;  3AE5 C;  3V2P A;  3TGU E;  1N7S C;  1LT1 A;  3H1L D;  2J60 A;  4I1L A;  3MUD C;  3CCQ P;  1KIL C;  3ZDM A;  1BDD A;  2Z4E B;  4HB1 A;  1SQV G;  1DX7 A;  3BCC J;  2JWA A;  2Q7C A;  2OTK E;  3GW6 A;  5KJ7 D;  1EZV G;  3KXD A;  1FZC A;  1Z3S A;  3IR9 A;  2PP6 A;  1NAF A;  3P7K A;  1X22 A;  1L0L E;  2IYP A;  1U7J A;  1KB9 H;  3VP8 A;  1FZE C;  1FC2 C;  2FXM A;  2I8D A;  5CCG C;  1OW8 A;  2LXC B;  5KLV E;  4PJ0 E;  3Q5S A;  1SQP K;  3EWK A;  2QJK B;  3AEA C;  2J1G A;  3F5H A;  1PP9 J;  1JCD A;  2JEE A;  4U3F E;  2H43 A;  2GM4 A;  2N1T B;  5AVZ B;  2J3U A;  1VQN P;  3TNU A;  3V5B A;  1H0T B;  1IFI A;  3C9I A;  4ZKP A;  2K9J A;  4AQR D;  4R9J A;  5GTH E;  3LW5 H;  3AE1 C;  5B66 E;  1KYO E;  1JY2 N;  2O01 J;  1JUN A;  5KAI H;  1AVO A;  2IYO A;  1FZB A;  1M1J C;  3PH0 A;  3G3Z A;  2XKM A;  4I7Z C;  1A02 F;  2FFD A;  2GA1 A;  1FZG A;  4ZKU A;  3TK1 A;  3RK3 D;  5KAF E;  1EDI A;  4D6T G;  3GF7 A;  4H44 D;  1H8A A;  2OYH A;  2E76 D;  4XE5 B;  3WU2 E;  1S3J A;  1FZF A;  1PPJ D;  2LKM A;  3H25 A;  4N3Y B;  1N2D C;  1JNM A;  1VQ7 P;  3H1I J;  3WU2 H;  1URQ D;  2NRG A;  1FZE B;  3MD0 A;  4EDF A;  4IFF A;  1KB9 I;  1K73 Q;  5DJU B;  1OXZ A;  3OJA B;  2E5Y A;  1ZXG A;  1GU4 A;  1BCC E;  1IFP A;  2FXO A;  1FDM A;  2I1K A;  1K04 A;  3CCL P;  2A06 D;  3A7O A;  2VRS A;  4I6M C;  3H1J E;  1G1J A;  4BRY A;  1FJK A;  2E75 D;  1Q86 Q;  2OYI A;  3SWK A;  1YIJ P;  4JZC A;  3CWB G;  3AEB C;  3H1J D;  4L75 A;  1YTZ T;  4RJT A;  1Z3U A;  3OAK A;  3CME P;  4KJM A;  1DD3 A;  3CX5 D;  5AVS B;  5AW9 B;  2D39 A;  3H1K D;  1N73 B;  3CWB J;  3VTP C;  3CC7 P;  1GL2 D;  1M57 D;  2C9N Y;  2WPQ A;  2WVR A;  1J2J B;  2QJP C;  2QJY C;  4PD4 I;  2J59 M;  1S2E A;  3L72 G;  1AV1 A;  3UIA A;  1RQV A;  5KLI B;  1AJY A;  1E5W A;  4H44 C;  1BE3 D;  1ZN5 A;  2RMZ A;  5GTI H;  3AE4 C;  1U57 A;  2XU6 A;  4D6T E;  3TGU G;  3P8C E;  2BAS A;  2YO2 A;  4PJ0 H;  1S9K E;  2M3E A;  3Q3D A;  5K5G B;  4C7N A;  3CXH H;  2ZYA A;  3RL0 C;  1S9K D;  1CZQ A;  3A0H E;  3LIE A;  1JC9 A;  2BCC D;  1SQB D;  1VPC A;  2FYU K;  3H1J G;  2OYH C;  3HTK B;  1CI6 A;  1KQF B;  1N7S D;  1QL1 A;  1LWU A;  1ZLL A;  3BVH C;  1FZA C;  2AEJ A;  2OTJ P;  2M8R A;  2ZT9 C;  2O1K A;  3A2A A;  3L75 G;  2ZYD A;  2OYI C;  3L35 A;  1GK6 A;  4EPU A;  2V7Q J;  2ZVN B;  1NTK J;  4GKG A;  1USD A;  1M1J A;  1FZB B;  2WSF H;  2M5A B;  3AE6 C; 
#chains in the Genus database with same CATH homology
 3O8Z A;  4LGD E;  3T97 A;  5CJ0 A;  1URQ C;  1KFN A;  4DZO A;  5AW1 B;  2H7H A;  5CCH C;  1GZL A;  2YO3 A;  3LID A;  1L0N K;  4R9T A;  1GW4 A;  1HUC A;  2H43 B;  5AVQ B;  2WPR A;  1HTL C;  5APU A;  1NHL A;  2Z4E C;  1KQL A;  5AW6 B;  3M9B A;  3RK3 B;  1ZV8 A;  1N7S A;  2OYI B;  4JYC A;  1RE4 B;  2WTY A;  3NFQ A;  3HRN A;  3GHG C;  2J3G A;  1SQV K;  4M7H A;  1G2C B;  3E1I C;  1IFN A;  4WY4 A;  2E43 A;  1LT9 B;  2N1T D;  4EIJ A;  1RF1 A;  3OA7 A;  2YKP A;  5APT A;  3HD7 B;  1KIL B;  4Y99 C;  1RE4 A;  2W6A A;  3HTK A;  3V4Q A;  2XV5 A;  2FIB A;  1H88 A;  2JHI F;  1LTJ C;  4B86 A;  1MZ9 A;  1Z56 A;  3I5C A;  4WY4 D;  2FFD C;  2HLO B;  1LT9 A;  1GTW A;  2IFN A;  3RL0 D;  3BVH A;  2QM8 A;  5BU5 A;  1X9V A;  1SVF A;  1RF1 B;  2A45 I;  1EQ7 A;  1SFC B;  3B5N C;  1FOS F;  1KFM A;  3B8E B;  1RE4 C;  5APW A;  5AW4 B;  1X79 B;  1GL2 C;  1NH4 A;  2H8P D;  2WSE H;  3PP5 A;  3TNU B;  4C7N B;  2W27 A;  1A02 J;  3RK2 C;  1HH0 A;  1YYC A;  1J1D C;  5CHX A;  5AW8 B;  2WIT A;  1NWQ A;  1JOC A;  3BRT B;  1XTG B;  1CI6 B;  2CPS A;  2R5B A;  1JCC A;  4AUW A;  1FID A;  1YTZ I;  3EFG A;  1FZC B;  1N7L A;  1JY3 P;  2WT7 B;  2Q9I A;  1WRG A;  5CCH A;  3FIB A;  1JTH A;  2YNY A;  3E1I A;  1SLQ A;  1N86 C;  3HD7 D;  2WSC H;  3WMM 0;  2J61 A;  1IK9 A;  2E42 A;  2GUV A;  3HUS A;  5BU8 B;  2J0Y A;  3VYI A;  3U59 A;  1H89 A;  1VDF A;  5AW5 B;  3VP9 A;  2JJL A;  1SQX K;  3HE5 B;  1LTJ B;  4N6J A;  4M7F A;  1NU1 K;  1L4A B;  3M0D C;  1DH3 A;  1IO4 A;  1GU5 A;  3TSI A;  3VMZ A;  3A5T A;  1L4A D;  4WB4 A;  3M0D A;  1NO4 A;  1RE3 A;  3N4X A;  3NXS A;  1FZG B;  1IC2 A;  1HVV A;  1OWA A;  3H32 A;  2NPS A;  3KYQ A;  3V2P A;  1GL2 B;  2KSJ A;  3L37 A;  4OH8 B;  1LTJ A;  3HE5 A;  1N7S C;  3BAS A;  3V4W A;  4HYT B;  2J60 A;  4I1L A;  1N86 B;  5AW7 B;  2H43 C;  2P1J A;  1NKZ B;  2Q3I A;  4XA4 A;  1KIL C;  2NPS D;  5APS A;  2WPS A;  3NMD A;  2Z4E B;  1JMM A;  3V2Q A;  1N73 C;  4ZFG A;  1DX7 A;  2I1J A;  2J3F D;  1PFI A;  2J0G A;  1M7L A;  5APV A;  4EOT A;  3H6P A;  2Q7C A;  3HD7 A;  4C46 A;  5AW0 B;  1T2K C;  2JHM F;  1IFJ A;  1N86 A;  4NYT A;  5KJ7 D;  1IFD A;  1HWT C;  2KP8 A;  1IFM A;  1LGH B;  3B5N B;  4C7R A;  5AVU B;  1FZC A;  4JYB A;  2XZR A;  2C9L Y;  3IR9 A;  1N7S B;  3L4F A;  2PP6 A;  1NAF A;  1Z3S A;  3P7K A;  3V2R A;  2HG5 D;  1L0L K;  5APY A;  3U1A A;  3M06 A;  1JO5 A;  3VP8 A;  1FZE C;  2FXM A;  5CCG C;  2IX7 C;  4JF7 A;  3BAT A;  2R3C A;  1SQP K;  2YKQ A;  3VN0 A;  2MJZ A;  3M9H A;  2Q5U A;  2J1G A;  3KDP B;  2W6B A;  2GY7 A;  4GT1 A;  2OAR A;  4RES B;  1JCD A;  1HGV A;  1SFC A;  2JEE A;  2CPB A;  2H43 A;  2GM4 A;  1QL2 A;  1HJB A;  2N1T B;  1FZA A;  1URQ A;  5AVZ B;  2J3U A;  1SQQ K;  4LLH A;  2WT7 A;  3TNU A;  1LTB C;  1GD2 E;  3V5B A;  1IFI A;  3C9I A;  2JHL F;  2ZFC A;  4ZKP A;  4R9J A;  4AQR D;  1L4A C;  1DEB A;  5AW3 B;  3LW5 H;  1J1E B;  2FFD B;  1FZA B;  2YMY A;  1RF0 A;  5APQ A;  2HPC B;  1FBM A;  4W80 A;  1JY2 N;  2XNX A;  2WNP F;  1JUN A;  3KPE A;  1FZG C;  2Q9I B;  4M3L A;  1FZB A;  3BRV B;  3RK2 D;  3R2P A;  3HE4 B;  1M1J C;  3V2N A;  3G3Z A;  2XKM A;  1A02 F;  5AW2 B;  1RE3 B;  3M91 A;  2Z5I A;  2FFD A;  1FZG A;  5CCG A;  2HFE D;  3TK1 A;  1JTH B;  3RK3 D;  4ZKU A;  1FZE A;  3MTU E;  1H8A A;  1RF0 C;  5CMZ A;  1XTC C;  2OYH A;  1FAV A;  3EQ2 A;  2M3B A;  4XE5 B;  4LC1 A;  1LTI C;  3RL0 B;  1L4A A;  1X8Y A;  2WZ7 A;  5BVZ A;  1FZF A;  1CW5 A;  2LKM A;  4N3Y B;  2FYZ A;  1N2D C;  2J5Z A;  1JNM A;  1NOH A;  2P7J A;  2Z4E A;  5CJ4 A;  1IJD B;  5KTB A;  1URQ D;  5AVY B;  2GUS A;  1FZE B;  3MD0 A;  4IFF A;  5CCH D;  3P32 A;  1FZF C;  4DOJ A;  4WY4 B;  1OXZ A;  3OJA B;  3U1C A;  1CSB A;  1LTS C;  1GU4 A;  1GW3 A;  2J2P A;  1M1J B;  1SFC D;  2KYV A;  2YKO A;  5CCG D;  3E1I B;  1MV8 A;  1FDM A;  3MUD A;  1RY3 A;  2HOD C;  2I1K A;  4AYC A;  2J3F A;  1LWU C;  3VMY A;  3CI9 A;  1KZU B;  2IPP A;  2P67 A;  3MIW A;  2QM7 A;  3A7O A;  2IFM A;  3BVH B;  2VRS A;  3II6 A;  1SQB K;  2C0W A;  4I6M C;  2J64 A;  1T3J A;  1T8Z A;  1G1J A;  1WT6 A;  1FJK A;  1N73 A;  1RE3 C;  2OYI A;  3NTN A;  5AVT B;  2HLO C;  1JY3 O;  4JZC A;  4W7Z A;  1HBW A;  4GIF A;  4IFD K;  3B5N A;  1NKN A;  2XNX B;  1YTZ T;  3SWF A;  1Z3U A;  3OAK A;  1RF1 C;  4N78 E;  1FJP A;  4WY4 C;  1G2C A;  2HPC C;  5AVS B;  3GHG A;  1HGZ A;  5AW9 B;  1FZB C;  1ZR4 A;  2D39 A;  2A45 G;  2KOG A;  1N73 B;  2PAJ A;  3CL3 D;  3VTP C;  2N1T A;  3KQG A;  1URQ B;  5KJ7 C;  1LTG C;  1GL2 D;  2OYH B;  1MFZ A;  2C9N Y;  2WPQ A;  1FZD A;  2Z5H A;  1NTM K;  3P8M C;  2HLO A;  1J2J B;  1FIB A;  2J59 M;  2J0H A;  3UIA A;  5KLV K;  3VOP A;  1JY3 N;  1E5W A;  2HPC A;  5AVR B;  1FU1 A;  1J1D B;  3H32 C;  1ZN5 A;  2HYN A;  3TYY A;  1NTZ K;  4I2L C;  2XU6 A;  4Y99 B;  2Q9I C;  2L5G B;  2N1T C;  3P8C D;  2ZXE B;  5APX A;  1W2E A;  3P8C E;  2BAS A;  2NPS B;  2FKW B;  2YO2 A;  1T3U A;  3A3Y B;  2XDJ A;  1SP4 A;  1S9K E;  2R5D A;  3HUS C;  3SWY A;  1LTT C;  1LT9 C;  4HH2 A;  1RF0 B;  2HOD A;  2JHH C;  1GK4 A;  1LTA C;  4C7N A;  1FZF B;  3RL0 C;  2J58 A;  4JYO X;  2R32 A;  1SFC C;  1S9K D;  1CZQ A;  1JY2 O;  2POH A;  2P2U A;  1AQ5 A;  3LIE A;  1JC9 A;  2O1J A;  3B5N D;  1FIC A;  3HE4 A;  1VPC A;  1KIL A;  4W7Y A;  2FYU K;  1FZC C;  2C0X A;  2OYH C;  3HTK B;  1ZR2 A;  1CI6 A;  3RK2 B;  2J3O A;  1N7S D;  2HOD B;  5KJ7 A;  3L36 A;  1QL1 A;  5AVW B;  1GDT A;  3MGN A;  4IFM A;  3M0A A;  3GHG B;  4O9B A;  1LWU A;  2JHK F;  1ZLL A;  3BVH C;  1J1E C;  3IFM A;  1FZA C;  3M9Q A;  1AFO A;  4N78 D;  5AVV B;  1JY2 P;  2M8R A;  1MUU A;  3N7N A;  2A45 H;  2O1K A;  3VMX A;  1KIL D;  1G1I A;  2NPS C;  3A2A A;  1GL2 A;  2J61 B;  1FOS E;  3H32 B;  3RK3 C;  2OYI C;  2WWW A;  3L35 A;  3HUS B;  2XNX C;  2N9B A;  1GK6 A;  4EPU A;  2KB7 P;  1LWU B;  3CLQ A;  1T2K D;  1NTK K;  4WBA A;  2KLV A;  4KHX A;  4GKG A;  1M1J A;  2O01 H;  1FZB B;  5AVX B;  2WSF H;  3HD7 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...