4M7HA

Crystal structure of tetrameric fibrinogen-like recognition domain of fibcd1
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
219
structure length
219
Chain Sequence
SRPRDCLDVLLSGQQDDGVYSVFPTHYPAGFQVYCDMRTDGGGWTVFQRREDGSVNFFRGWDAYRDGFGRLTGEHWLGLKRIHALTTQAAYELHVDLEDFENGTAYARYGSFGVGLFSVDPEEDGYPLTVADYSGTAGDSLLKHSGMRFTTKDRDSDHSENNCAAFYRGAWWYRNCHTSNLNGQYLRGAHASYADGVEWSSWTGWQYSLKFSEMKIRPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Fibrinogen C domain-containing protein 1
publication title Crystal Structure of the Tetrameric Fibrinogen-like Recognition Domain of Fibrinogen C Domain Containing 1 (FIBCD1) Protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Sugar binding protein
total genus 81
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 4m7hA01
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 4m7hA02
2JHLF 1FICA 2JHKF 2J0YA 3E1IC 1Z3UA 2J60A 4JYOX 3HUSC 3E1IB 3HUSB 2J5ZA 3BVHB 1N86C 2HLOC 2FFDB 2J64A 1FZEB 2WNPF 2J1GA 2J0GA 1N86B 2HPCB 2GY7A 2J61A 1FZAC 1N73C 2J3FD 4EPUA 1FZAB 1N73B 4M7HA 1RF0C 1FZGC 1RE4C 3BVHC 2OYIC 2FFDC 1FZEC 3FIBA 1RF0B 1FZGB 1RE4B 1Z3SA 2OYIB 2HPCC 2Z4EB 2HODC 1FZCC 2FIBA 1M1JC 4NYTA 2J2PA 2JHIF 2HODB 2J0HA 1FZCB 1M1JB 2D39A 1FZBB 3GHGC 2JHHC 1LWUC 3H32B 4JZCA 2J3GA 2J3FA 2H43C 4R9TA 2Z4EC 1LWUB 2H43B 4M7FA 4R9JA 1FIDA 1RE3C 1FZBC 1RE3B 1LT9C 1LTJC 1LT9B 1LTJB 2JHMF 2XNXC 2Q9IC 1FZDA 3H32C 2OYHC 1JC9A 2J61B 2XNXB 1FZFC 2Q9IB 1FIBA 2OYHB 2J3OA 1RF1C 4ZFGA 1FZFB 2HLOB 2J3UA 1RF1B
chains in the Genus database with same CATH superfamily
2JHLF 1FICA 2JHKF 2J0YA 3E1IC 1Z3UA 2J60A 4JYOX 3HUSC 3E1IB 3HUSB 2J5ZA 3BVHB 1N86C 2HLOC 2FFDB 2J64A 1FZEB 2WNPF 2J1GA 2J0GA 1N86B 2HPCB 2GY7A 2J61A 1FZAC 1N73C 2J3FD 4EPUA 1FZAB 1N73B 4M7HA 3GHGB 1RF0C 1FZGC 1RE4C 3BVHC 2OYIC 2FFDC 1FZEC 3FIBA 1RF0B 1FZGB 1RE4B 1Z3SA 2OYIB 2HPCC 2Z4EB 2HODC 1FZCC 2FIBA 1M1JC 4NYTA 2J2PA 2JHIF 2HODB 2J0HA 1FZCB 1M1JB 2D39A 1FZBB 3GHGC 2JHHC 1LWUC 3H32B 4JZCA 2J3GA 2J3FA 2H43C 4R9TA 2Z4EC 1LWUB 2H43B 4M7FA 4R9JA 1FIDA 1RE3C 1FZBC 1RE3B 1LT9C 1LTJC 1LT9B 1LTJB 2JHMF 2XNXC 2Q9IC 1FZDA 3H32C 2OYHC 1JC9A 2J61B 2XNXB 1FZFC 2Q9IB 1FIBA 2OYHB 2J3OA 1RF1C 4ZFGA 1FZFB 2HLOB 2J3UA 1RF1B
chains in the Genus database with same CATH topology
2JHLF 1FICA 2JHKF 2J0YA 3E1IC 1Z3UA 2J60A 4JYOX 3HUSC 3E1IB 3HUSB 2J5ZA 3BVHB 1N86C 2HLOC 2FFDB 2J64A 1FZEB 2WNPF 2J1GA 2J0GA 1N86B 2HPCB 2GY7A 2J61A 1FZAC 1N73C 2J3FD 4EPUA 1FZAB 1N73B 4M7HA 1RF0C 1FZGC 1RE4C 3BVHC 2OYIC 2FFDC 1FZEC 3FIBA 1RF0B 1FZGB 1RE4B 1Z3SA 2OYIB 2HPCC 2Z4EB 2HODC 1FZCC 2FIBA 1M1JC 4NYTA 2J2PA 2JHIF 2HODB 2J0HA 1FZCB 1M1JB 2D39A 1FZBB 3GHGC 2JHHC 1LWUC 3H32B 4JZCA 2J3GA 2J3FA 2H43C 4R9TA 2Z4EC 1LWUB 2H43B 4M7FA 4R9JA 1FIDA 1RE3C 1FZBC 1RE3B 1LT9C 1LTJC 1LT9B 1LTJB 2JHMF 2XNXC 2Q9IC 1FZDA 3H32C 2OYHC 1JC9A 2J61B 2XNXB 1FZFC 2Q9IB 1FIBA 2OYHB 2J3OA 1RF1C 4ZFGA 1FZFB 2HLOB 2J3UA 1RF1B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JHL F;  1FIC A;  2JHK F;  2J0Y A;  3E1I C;  1Z3U A;  2J60 A;  4JYO X;  3HUS C;  3E1I B;  3HUS B;  2J5Z A;  3BVH B;  1N86 C;  2HLO C;  2FFD B;  2J64 A;  1FZE B;  2WNP F;  2J1G A;  2J0G A;  1N86 B;  2HPC B;  2GY7 A;  2J61 A;  1FZA C;  1N73 C;  2J3F D;  4EPU A;  1FZA B;  1N73 B;  4M7H A;  1RF0 C;  1FZG C;  1RE4 C;  3BVH C;  2OYI C;  2FFD C;  1FZE C;  3FIB A;  1RF0 B;  1FZG B;  1RE4 B;  1Z3S A;  2OYI B;  2HPC C;  2Z4E B;  2HOD C;  1FZC C;  2FIB A;  1M1J C;  4NYT A;  2J2P A;  2JHI F;  2HOD B;  2J0H A;  1FZC B;  1M1J B;  2D39 A;  1FZB B;  3GHG C;  2JHH C;  1LWU C;  3H32 B;  4JZC A;  2J3G A;  2J3F A;  2H43 C;  4R9T A;  2Z4E C;  1LWU B;  2H43 B;  4M7F A;  4R9J A;  1FID A;  1RE3 C;  1FZB C;  1RE3 B;  1LT9 C;  1LTJ C;  1LT9 B;  1LTJ B;  2JHM F;  2XNX C;  2Q9I C;  1FZD A;  3H32 C;  2OYH C;  1JC9 A;  2J61 B;  2XNX B;  1FZF C;  2Q9I B;  1FIB A;  2OYH B;  2J3O A;  1RF1 C;  4ZFG A;  1FZF B;  2HLO B;  2J3U A;  1RF1 B; 
#chains in the Genus database with same CATH topology
 2JHL F;  1FIC A;  2JHK F;  2J0Y A;  3E1I C;  1Z3U A;  2J60 A;  4JYO X;  3HUS C;  3E1I B;  3HUS B;  2J5Z A;  3BVH B;  1N86 C;  2HLO C;  2FFD B;  2J64 A;  1FZE B;  2WNP F;  2J1G A;  2J0G A;  1N86 B;  2HPC B;  2GY7 A;  2J61 A;  1FZA C;  1N73 C;  2J3F D;  4EPU A;  1FZA B;  1N73 B;  4M7H A;  3GHG B;  1RF0 C;  1FZG C;  1RE4 C;  3BVH C;  2OYI C;  2FFD C;  1FZE C;  3FIB A;  1RF0 B;  1FZG B;  1RE4 B;  1Z3S A;  2OYI B;  2HPC C;  2Z4E B;  2HOD C;  1FZC C;  2FIB A;  1M1J C;  4NYT A;  2J2P A;  2JHI F;  2HOD B;  2J0H A;  1FZC B;  1M1J B;  2D39 A;  1FZB B;  3GHG C;  2JHH C;  1LWU C;  3H32 B;  4JZC A;  2J3G A;  2J3F A;  2H43 C;  4R9T A;  2Z4E C;  1LWU B;  2H43 B;  4M7F A;  4R9J A;  1FID A;  1RE3 C;  1FZB C;  1RE3 B;  1LT9 C;  1LTJ C;  1LT9 B;  1LTJ B;  2JHM F;  2XNX C;  2Q9I C;  1FZD A;  3H32 C;  2OYH C;  1JC9 A;  2J61 B;  2XNX B;  1FZF C;  2Q9I B;  1FIB A;  2OYH B;  2J3O A;  1RF1 C;  4ZFG A;  1FZF B;  2HLO B;  2J3U A;  1RF1 B; 
#chains in the Genus database with same CATH homology
 2JHL F;  1FIC A;  2JHK F;  2J0Y A;  3E1I C;  1Z3U A;  2J60 A;  4JYO X;  3HUS C;  3E1I B;  3HUS B;  2J5Z A;  3BVH B;  1N86 C;  2HLO C;  2FFD B;  2J64 A;  1FZE B;  2WNP F;  2J1G A;  2J0G A;  1N86 B;  2HPC B;  2GY7 A;  2J61 A;  1FZA C;  1N73 C;  2J3F D;  4EPU A;  1FZA B;  1N73 B;  4M7H A;  1RF0 C;  1FZG C;  1RE4 C;  3BVH C;  2OYI C;  2FFD C;  1FZE C;  3FIB A;  1RF0 B;  1FZG B;  1RE4 B;  1Z3S A;  2OYI B;  2HPC C;  2Z4E B;  2HOD C;  1FZC C;  2FIB A;  1M1J C;  4NYT A;  2J2P A;  2JHI F;  2HOD B;  2J0H A;  1FZC B;  1M1J B;  2D39 A;  1FZB B;  3GHG C;  2JHH C;  1LWU C;  3H32 B;  4JZC A;  2J3G A;  2J3F A;  2H43 C;  4R9T A;  2Z4E C;  1LWU B;  2H43 B;  4M7F A;  4R9J A;  1FID A;  1RE3 C;  1FZB C;  1RE3 B;  1LT9 C;  1LTJ C;  1LT9 B;  1LTJ B;  2JHM F;  2XNX C;  2Q9I C;  1FZD A;  3H32 C;  2OYH C;  1JC9 A;  2J61 B;  2XNX B;  1FZF C;  2Q9I B;  1FIB A;  2OYH B;  2J3O A;  1RF1 C;  4ZFG A;  1FZF B;  2HLO B;  2J3U A;  1RF1 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...