2HPCB

Crystal structure of fragment d from human fibrinogen complexed with gly-pro-arg-pro-amide.
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
307
structure length
307
Chain Sequence
LYIDETVNSNIPTNLRVLRSILENLRSKIQKLESDVSAQMEYCRTPCTVSCNIPVVSGKECEEIIRKGGETSEMYLIQPDSSVKPYRVYCDMNTENGGWTVIQNRQDGSVDFGRKWDPYKQGFGNVATNTDGKNYCGLPGEYWLGNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGGFTVQNEANKYQISVNKYRGTAGNALMDGASQLMGENRTMTIHNGMFFSTYDRDNDGWLTSDPRKQCSKEDGGGWWYNRCHAANPNGRYYWGGQYTWDMAKHGTDDGVVWMNWKGSWYSMRKMSMKIRPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Blood clotting
molecule keywords Fibrinogen alpha chain
total genus 66
structure length 307
sequence length 307
chains with identical sequence E, H, K
ec nomenclature
pdb deposition date 2006-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2hpcB01
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 2hpcB02
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 2hpcB03
1FZAA 1RF0A 1N73A 2J61B 3H32C 2Z4EC 2A45I 2Q9IC 1FZAB 1N73B 4M7FA 2XNXB 2J64A 1RE3C 2FFDA 3GHGA 2J0HA 1LT9A 2J3GA 1JY3O 1FIBA 2HODA 2XNXC 2J3UA 1LT9B 1JY3N 1T3UA 1M1JA 1Z3SA 2OYHA 2HPCA 2OYIC 4EPUA 2A45H 2FIBA 2H43C 1N86B 3HUSB 1FZFA 2JHKF 1RF0B 1RF1C 4JYOX 3E1IA 1FIDA 2WNPF 4R9JA 2D39A 1N86C 3HUSC 1LTJA 1FZCA 1JY2O 1FZDA 1FZAC 1RF0C 2FFDB 1N73C 2JHMF 3GHGB 1FZCB 1JY2N 2GY7A 1FZBA 2J5ZA 2HODB 1JC9A 2FFDC 1FZBB 2J3FD 3GHGC 1LT9C 2HLOA 1FZGA 1M1JB 3BVHA 2HODC 2OYHB 4NYTA 2HPCB 1LWUA 2J3OA 1FZGB 2JHHC 2J60A 1RE4A 2J1GA 4JZCA 1JY3P 1M1JC 1FZFB 3H32A 2OYHC 2HPCC 2Q9IA 3E1IB 1FZGC 2J0YA 4M7HA 2J3FA 1FZFC 1LTJB 1RE3A 2A45G 2J61A 1FZEA 3E1IC 1Z3UA 1RE3B 2XNXA 1FZEB 2J0GA 1LTJC 3FIBA 1FZCC 2J2PA 1W2EA 2HLOB 1FICA 1FZEC 2OYIA 1FZBC 1JY2P 4ZFGA 3BVHB 2H43A 2Z4EA 1LWUB 2JHIF 4R9TA 2OYIB 2JHLF 1RE4B 2HLOC 1RF1A 3H32B 2H43B 2Z4EB 3BVHC 2Q9IB 1LWUC 1N86A 3HUSA 1RF1B 1RE4C
chains in the Genus database with same CATH superfamily
1JM0A 3LW5J 2KOGA 2PP6A 1NTME 2ZT9C 1T8ZA 3B5NB 3KXDA 5AVRB 1LT1A 1NO4A 3RK3E 2ZAEB 1JB0J 5E79H 2P2UA 1PPJE 5KTBA 1L4AA 4AYCA 4LC1A 2WNPF 3PP5A 3TK1A 3CD6P 1QL2A 5KJ7D 2KB7P 3CX5H 1SFCA 4OGQC 1OW7A 3L74E 2WWWA 2ZVNB 4JPZB 1T6AA 2OYHC 2HPCC 4I1LA 4C46A 3WUTA 1M90Q 2QVAA 2A45G 3G71P 2E75D 1SQVG 1L0NG 1MV8A 1KYOI 2CPBA 3KZIH 3TGUJ 3CX5E 3H1IG 1Y8AA 2CPSA 3WU2E 4H13D 2HFED 1NTKJ 2GUVA 4BRYB 2JKVA 1A02F 2KP8A 3RK3C 5TJHA 3ABVC 1R8EA 4Y99B 4U7JA 1M57D 1RE4C 3L70E 3KZIE 3FX0A 1BGYE 5KAFH 1N73B 2JP3A 1KQLA 2W27A 2KI7B 3MHVA 4RESB 5AVUB 1E79H 1FIBA 3CCMP 1KN7A 1JMMA 1NU1J 1T3UA 2E5TA 2E43A 2OYHA 2HPCA 3MZWB 3Q5SA 1NTZD 2G3AA 3MGNA 1JMBA 3GF3A 5KLVG 1P84D 2KNCB 4H44C 3AE2C 1HF9A 1SQXJ 2NZ2A 2K88A 1AA0A 1GL2C 1IFPA 1Q81Q 2N1TA 1Q90D 1LP1B 2IYPA 1PP9G 1MFZA 1WT6A 1DIPA 1FZBB 3VOPA 1HJ0A 2P67A 1EC5A 3RK2D 4IL6X 1RE4A 3H1KJ 3G3ZA 2JEEA 2IBZD 1T2KD 2Y0EA 4M7HA 5AW9B 3Q1MA 5APYA 1CSBA 3FIBA 1FZCC 5GTIE 2ZYAA 1MKMA 1URQD 3CLQA 1FICA 1OVVA 1KD1Q 2FKWB 3O6QA 2QJYB 5BU5A 2HLOC 1PZQA 1PGPA 1JTHA 2IFMA 3K5BA 2AXTH 1RF1B 2FY8A 4D6TJ 5CCGC 1GL2A 2YO2A 2Z4EC 1L0LD 2NPSB 4M3LA 4EIJA 1VQPP 1OWAA 2PFXA 2Q7CA 4N78E 1EZVG 1KC8Q 3M9BA 2J3GA 2QM7A 3OJAB 1FDOA 2J58A 4L73A 3II6A 3HRNA 4HYTB 1G2CA 3BCCG 2AXTE 2A45H 2O01H 2O1JA 1LTIC 3S1KA 3TYYA 1NHLA 3GG2A 1VL2A 3M06A 3TNUB 4W7YA 1FZCA 1IJDB 4N6JA 4UB6H 4PV1D 3HD7C 1R5SA 2HODB 4GIFA 2FFDC 1GU4A 1CI6B 2QJKC 3AE1C 2HLOA 3RL0B 2FYZA 3FXDA 4UB8H 1SQPK 2R3CA 2E76C 5AW3B 3HE5A 3M9HA 1NJIQ 1FZFB 5CCGA 1FC2C 2XV5A 5CBOA 2ZXEB 3I55P 1S1CX 2M0BA 3KQGA 1LTJB 1KYOH 4UB6E 1KILB 1LTAC 5DJUB 2VRSA 2KZIA 1IFDA 1HGZA 3SFEC 3VTPC 1S9KD 4YTPC 1G1IA 3U1CA 2CK3H 1NYHA 4UB8E 3BRTB 2QSIA 5KLIC 2C0WA 4N3YB 3RGUA 2FXMA 3A0HH 3L72D 1FE6A 1YITP 3H1JE 2K9JA 1KYOE 1USDA 5L8RJ 3AEBC 2NRGA 1PGOA 3AE6C 3HD7A 3EWKA 3E1RA 3LIDA 4WBAA 3V4WA 2FFDA 1YBKA 4H13C 4EOTA 3PHLA 4PD4I 2GUSA 4IOIH 2BCCE 5CCHD 5APXA 4K3AA 1M7LA 2Y9ZA 2OARA 1JY3N 2P7JA 4ZKPA 1OXZA 3KYQA 4RJTA 5TISE 1YIJP 3VP9A 2G8YA 4GODA 3USSA 1VQKP 4AUWA 2R32A 2QJPC 1DX7A 1NTZJ 2GY7A 4JBZA 3H1LE 5AW4B 1NTMG 2ITAA 1M1JB 1K9MQ 1E5WA 1GW4A 2C0XA 2QA4P 3C1LA 5AVXB 2O1KA 1YTZI 2AEMA 1JO5A 1BE3D 2K9YA 2RKLA 3L73D 2J2PA 2NPSD 2MJZA 1DD3A 2O01N 3CCLP 2M8RA 2Q3EA 1N7SC 2Y9YA 3RK2C 2K37A 1SQPE 1SQBE 1NAFA 2R5DA 1K04A 1LWUC 1BDDA 3L74G 5KAIE 2Q6QA 1EXIA 2YO3A 3PRJA 4EI2A 2I1KA 4HKZH 2C9NY 1PPJD 3V2RA 3CWBE 5AVYB 1YJNP 1L0LJ 2E75B 3B5NC 3CCVP 3L35A 1MUUA 3L75E 1VF5D 3RL0D 3A5TA 4BXLA 4MN4C 4L74A 2FYUK 2ZYDA 1JY2O 1SQPJ 4ZKUA 3GHGB 3L70G 1EDIA 1N7SA 4DCKA 3LW5H 2KSJA 1BGYG 1U7JA 1KILD 3N7NA 4U3FD 1Q2NA 1Z56A 5AVWB 2B87A 3H1HD 1ZR2A 3D6ZA 1LWUA 1FZGB 2MKVA 3CX5D 3CMAP 5M1BA 1NU1K 3FXEA 3U1AA 5AW1B 1K8AQ 2J3FA 3VMYA 1IC2A 2YMKA 2W8ZA 1NKZB 3MD0A 2IDBA 1S72P 1X0TA 1FZEB 2J0GA 1AV1A 3IFMA 3B5NA 1G1JA 1GD2E 2GM4A 4AQRD 2AEJA 1AVOA 1HH0A 2WPSA 4I7ZB 2J61B 4GT1A 2V7QJ 1KMIZ 1ZP0C 4PD4H 1NKNA 2FXPA 4NPFX 1IFIA 1X79B 2JO1A 1FJPA 1S5LH 2M5AA 1Z3SA 3Q2YA 1ZR4A 1FDIA 2P1JA 1N86B 3HUSB 3R2PA 1OZHA 1URQB 5EFWB 2KK7A 2FXOA 1SQQD 1NGMB 1RQVA 4IFDK 3CXHI 4PD4E 3EFGA 1Q7YQ 1ZN5A 1AJYA 3L71D 1S5LE 1XTGB 2H88C 3TGUE 1WMKA 1ZW0A 1SP4A 1YTZT 2WPQA 4NYTA 3HE4B 1NTKE 4OWFA 2IYOA 5B5EH 1CW5A 1J1DB 2FYUE 3VMZA 3A3YB 1PGJA 4H0LD 1Y9BA 5AVTB 3WU2H 3AEAC 1W2EA 3T97A 2J59M 1GW3A 2A06E 1JY2P 2FBWC 1BE3J 2QIWA 2IZ0A 1FOSE 5B5EE 1ZLLA 2WSSH 1HTLC 3L73J 1LGHB 1NU1E 4CPGA 2H43B 3QWOC 4PV1B 1P84I 2Q5UA 2QJYC 3CI9A 2LKMA 3FGAD 4PJ0H 2JWDA 1HGVA 1SQXE 2H89C 2POHA 5CHXA 4C7RA 2FYUJ 2M3BA 1HWTC 2OYIC 2XKMA 1S2EA 3P8CD 1ZRTD 4DJGA 2ZJSE 2XDJA 2H7HA 2IZ1A 2IBZI 3HTKA 4PJ0E 3H1KE 1OW8A 1BCCE 2KIKA 3ZDMA 1L4AB 2KS1A 1DEEG 3H1JG 3Q3DA 1SQVD 2PAJA 5CJ0A 1L0ND 1EDJA 4GDOA 2E42A 3H1ID 3AE7C 3SSUA 1LT9C 1W5CE 2HODC 1SFCB 2I1JA 2BCCG 4ZMDA 3ITKA 1YJ9P 2Z5IA 3LIEA 3RL0C 2J1GA 1NWQA 4U3FJ 2E74B 1FZFC 3N4XA 1OIPA 1DEBA 4WY4D 3H1HJ 4D6TE 1L0NK 1J1EC 3S4RA 5GTIH 4JF7A 1LTJC 1OVRA 3MIWA 1KILC 3H1JD 1SLQA 4Y28J 2KUBA 2OYIA 3TF5A 1KQGB 1NTZK 1BCCJ 1IZNB 1AVYA 2WSFH 3H1LG 2D2CC 4I2LC 3D70A 2KSEA 1LTGC 5KLVD 1N8RQ 1EQ7A 3TNUA 1KB9D 5APSA 5GTHE 1LT9A 1PP9D 1FU1A 2HODA 4YPCA 1PL5A 3AE4C 2OTLP 1YQ3C 5H2FE 1H0TA 2GA1A 2RH0A 1MZ9A 1HBWA 4XE5B 1FZFA 1SQPG 1SQBG 2C9LY 5KLVK 3CXHH 3MUDC 2N9BA 1N2DC 2XU6A 3F89A 1LTJA 1XTCC 1FZAC 2OQQA 3D6YA 2JHMF 2QG4A 2N1TB 3TDKA 1ZV8A 1SQQJ 2J5UA 1JUNA 3RK3B 3L71J 3CWBG 3CXHE 1M1JC 1L0LK 1QVGO 3E1IB 3L75G 3G9RA 3VP8A 3EQ2A 2OYOA 1EZVD 1VF5B 1HVVA 3KPEA 2Z4EA 2BEZF 3BCCD 2OTJP 3MUDA 4KJMA 3O6QB 3SFDC 2PRRA 1FZAA 1JTHB 5KJ7C 2R3SA 3CCRP 2Q3IA 1GL2B 1RE3C 3P8MC 1IO4A 1L4AD 1NTZE 2J3UA 4HH2A 2QE7H 1P84E 5TISH 1M1JA 3CMEP 2R44A 2E75C 1GZLA 1GK6A 3JCUE 1RF0B 1SFCD 4JYOX 3E7KA 1PFIA 4NPDA 1FZCB 2E74D 5BVZA 1JC9A 3GHGC 2YMYA 1EXJA 1M56D 5AVZB 1SQVJ 2IBZE 1L0NJ 2LXCB 1OMIA 3WUUA 4JZCA 3H1IJ 5KJ7A 1RHZB 1NAYA 1FZGC 3B71A 1U57A 1AQTA 1KFNA 2WSEJ 1RE3A 3PJSK 1SVFA 4C7NB 4L75A 1IFNA 1FOSF 1FZEC 3PLNA 2IFNA 4R9TA 5APTA 3IAOA 3TGUG 1L0LE 5AW2B 1LTSC 3C9IA 1X9VA 4OGQD 2JJLA 5KAIH 2B88A 1GMJA 1NTKG 3JC22 4M7FA 2FYUG 2RN0A 2YNYA 3GHGA 5KKZC 4IL6E 2O3JA 2QM8A 3V2PA 3WUVA 5KLVJ 1U7MA 3UIAA 2W83C 2QJKB 2W6JH 1NTMD 4H0LB 1T2KC 2E76B 2N1TD 2AEFA 2A06G 1PP9J 1PGQA 5CBNA 1LNQA 2WZ7A 1BDCA 1NU1G 3RK3D 3CCEP 1N86C 3HUSC 3G4SP 1URQC 4YXWH 3W67A 1QGKB 5AVSB 4XA4A 5AW5B 1KQFB 5AVVB 2V7QH 1H89A 1SQXG 4TT3H 1T3JA 1USEA 3CL3D 3NTNA 1ZXGA 3L74D 2J0YA 1YJWP 1S9KE 2H8PD 4HB1A 3TSIA 2J61A 2BEQD 4IFFA 1MFTA 1J1DC 1Z3UA 3H6PA 1Y47A 3H1KG 1BCCG 1LTBC 3SWKA 4O9BA 5AW0B 1GL2D 2HYNA 3IF4A 4ZFGA 1NOHA 3M9QA 3JSVC 3CC2P 2LXBA 1ZMEC 2Q9IB 1N86A 1J2JB 2YIUB 3HUSA 4HJGH 1URQA 3EFFK 4OVNF 4PV1C 2AXCA 2XNXB 3BCCJ 2KXPB 3L70D 4D6TG 1BGYD 1KTMA 1VQ5P 4WY4B 1JEKA 2I8DA 2PGDA 2Q1KA 3HE4A 5AW7B 2FIBA 3BASA 2JHKF 5AVQB 4Y99C 2WT7B 4ZNCA 3L72J 3Q5PA 2D39A 1FDMA 3S9OA 1N73C 1VQOP 1YQ4C 2JWAA 2ZFCA 1VQ6P 3OAKA 2YKOA 1KORA 1M8OB 2KLUA 1QLED 2ZXXA 1BE3E 1HUCA 3L73E 5CJ4A 2KLVA 2WPRA 2ZYGA 5CCHC 1NH4A 1FJKA 2E74C 2WITA 4BRYA 4R4MA 1FZBC 3BVHB 3AEGC 3HD7D 3IR9A 3H32B 1SQQK 2YKPA 2XZRA 1SS1A 4DZOA 1N73A 2E76D 2A45I 3GLMA 1S4XA 2Y0CA 2J64A 4QMAA 1QVFO 2J0HA 5C39A 1JY3O 2FYNB 4N78D 3AEFC 4TLFA 4KT0J 1OFCX 2KNCA 3AE9C 2M5AB 4NPEA 3FWNA 5E79E 5CCHA 1D7MA 1RF1C 1NTMJ 1FIDA 2NPSC 1OVUA 1LP1A 1KILE 1AFOA 2WSCJ 4U3FE 1FZBA 2LR2A 3CXHD 3VN0A 3H1HE 4GOFA 4XFJA 1WRGA 4KHXA 1TU3F 2N1TC 3AE5C 1NTZG 1IK9A 4JYCA 2L91A 1KB9I 3AECC 1VQLP 3E1IC 1Q86Q 5K5GB 3B8EB 3CCUP 3L74J 1M1KQ 3T97B 2N9YB 1VF5C 3QH9A 2YXRB 1RF1A 1QX8A 3WMM0 2IBZG 2NPSA 5APVA 1SQVK 2B89A 2ZT9B 2M3EA 5KAFE 1IK7A 5GTHH 3MP7B 1KYOD 1W2BO 1DH3A 4ASVA 2R5BA 3F5HA 2WQYC 5H2FH 2KZJA 1SQQE 2BCCD 4I6MC 1X8YA 3KDPB 2K1AA 3L70J 1N7SD 1BGYJ 3L71E 2P10A 3E1IA 1L0LG 4R9JA 1GK4A 3HTKB 3GW6A 3C8VA 5AW8B 1RF0C 3CC4P 1Q82Q 2KS1B 1EZVI 1JY2N 2BASA 5APWA 4OGQB 3VMXA 1JNMA 1CI6A 3PH0A 3CCQP 2J3FD 1LTTC 5DJTB 3CCJP 4L76A 2OYHB 2HPCB 2J3OA 2JHHC 2J60A 1JY3P 3H1LD 4WWIA 3B5ND 1NVOA 1KILA 1VQ7P 2IX7C 1KV4A 1RQUA 3CCSP 2JR8A 3NXSA 3MTUE 2W6BA 3M91A 3O8ZA 1KQSO 4DT0A 2OYIB 4K35A 1RE4B 3BATA 1SQPD 1SQBD 2IPPA 1RF0A 3I5CA 2WMMA 4B86A 2OGUA 1GU5A 1KZUB 3CPWO 1CZQA 2WSEH 1VQ4P 3AE8C 1LT9B 1ZRTE 3P8CE 3V5BA 1P84H 3V2NA 2P58A 2WSFJ 2QEXP 3I56P 1JOCA 3L72G 3U59A 4EPUA 4H44B 4ASWA 3CWBD 1H0TB 1SQVE 3JCUH 1L0NE 2W90A 4H0LC 1K73Q 1GTWA 1SQBK 1H8AA 3H1IE 1VQMP 3L75D 1J1EB 2HR3A 3RBZA 3RBXA 4C7NA 2B9BA 2J5ZA 3NFQA 1KFMA 4WB4A 2UWJE 1FBMA 4GOEA 2W6AA 3SWYA 1G2CB 1LJ2A 1RH5B 2KYVA 3V6IA 2D2CB 2WTYA 1AQ5A 1KB9H 2E5YA 3AEEC 3GF7A 3IN6A 4JQ0D 1HJBA 2ZT9D 3V4QA 2O01J 3VMAA 1DD4A 2HLOB 3G6EP 1FAVA 5KLVE 4EYYQ 2DW3A 4YXDC 1BSNA 1YHQP 3HE5B 1S5LX 2Z4EB 3OW2O 3A0HE 1QL1A 1KB9E 4EDFA 1IFJA 1VQNP 5CMZA 1PP9E 1YYCA 4BWNA 1BE3G 2Q9IC 1FZAB 2YIUC 1PIXA 3L73G 4IL6H 2XNXC 4LGDE 4DOJA 3H1JJ 2WPVB 3A7OA 2Z5HA 4IFMA 4WY4C 2K9JB 1N7LA 4I7ZC 3H25A 4LLHA 1L2PA 1R5LA 3HD7B 3OA7A 2BCCJ 1FZDA 2FFDB 4A7PA 3P32A 1IFMA 1PPJG 4PD4D 3VYIA 1A02J 1RY3A 1UIXA 3CX5I 4GKGA 1FZGA 1BSHA 2L5GB 3P7KA 3TGUD 1ZOYC 3SWFA 5APQA 1FS0E 3R4YA 2Q9IA 4Z1MH 1GDTA 2V4HA 1EZVE 1NTKD 2YKQA 3M0DC 1FZEA 1EDKA 1JCCA 5AW6B 1RE3B 2FYUD 2XNXA 3H1LJ 5KLIB 1NTMK 2K3RA 3BCCE 3W68A 4U3FG 3H1HG 4OH8B 4WY4A 1EDLA 2JHIF 3BRVB 3D71A 3BVHC 2A06D 3B4SA 3L37A 2WT7A 1VPCA 3H32C 3CC7P 1NTKK 1NU1D 4H13B 1YI2P 4H44D 1VQ8P 3L72E 1X22A 1SQBJ 3M0AA 2OTKE 1SQXD 1UIIA 3AEDC 2QJPB 2FYNC 2H43C 4R4LA 1H88A 3M0DA 2XNDH 1S3JA 2WVRA 3FWLA 3KHUA 3A0BH 3L4FA 2D2CD 3RL0g 1OW6A 1JCDA 3CWBJ 2ZVOB 3H1KD 1BCCD 3A2AA 1PV3A 3L36A 5B66H 4WVZA 3L75J 1SQXK 3BVHA 1VDFA 3AE3C 4RO0A 3NMDA 4W7ZA 3H32A 3A0BE 4RKUJ 1VQ9P 1SQQG 3Q5RA 5CCGD 2HG5D 3V2QA 1L4AC 3L71G 5APUA 2Y0DA 2YXQB 5KKZB 1OX3A 5BU8B 1N7SB 3RK2B 4W80A 1QEXA 5B66E 4D6TD 3GMAA 2B87B 2WSCH 2RMZA 2H43A 1LWUB 1SFCC 2SPZA 2JDIH 2JHLF 1K05A 3PTZA 2QRXA 4JYBA
chains in the Genus database with same CATH topology
1FZAA 1JTHB 5KJ7C 2KOGA 2Q3IA 2PP6A 1GL2B 2YO3A 1RE3C 3P8MC 1DH3A 2C9NY 1T8ZA 2I1KA 3B5NB 1IO4A 5AVRB 2R5BA 1L4AD 3V2RA 5AVYB 2J3UA 4HH2A 3B5NC 1M1JA 1NO4A 4I6MC 1X8YA 3L35A 3KDPB 1MUUA 1N7SD 3RL0D 2P2UA 1GZLA 1GK6A 3A5TA 1RF0B 5KTBA 1L4AA 1SFCD 4AYCA 4JYOX 4LC1A 3E1IA 2FYUK 2WNPF 4R9JA 1GK4A 3HTKB 1JY2O 5AW8B 3PP5A 1RF0C 1PFIA 3TK1A 1QL2A 4ZKUA 3GHGB 1FZCB 1JY2N 5APWA 2BASA 3VMXA 1JNMA 5KJ7D 5BVZA 2KB7P 1JC9A 1CI6A 1N7SA 3LW5H 2KSJA 1KILD 1SFCA 3N7NA 2J3FD 3GHGC 2YMYA 1LTTC 1Z56A 5AVWB 5AVZB 2OYHB 2HPCB 1ZR2A 2WWWA 1LWUA 2J3OA 1FZGB 2JHHC 2J60A 4JZCA 1JY3P 5KJ7A 1NU1K 3B5ND 2OYHC 2HPCC 4I1LA 4C46A 3U1AA 1FZGC 5AW1B 1KILA 1KFNA 2J3FA 1RE3A 2A45G 3VMYA 1SVFA 2IX7C 1IC2A 1MV8A 3MD0A 1NKZB 2CPBA 4C7NB 1FZEB 2J0GA 3IFMA 3NXSA 3MTUE 2CPSA 1IFNA 3B5NA 2W6BA 1FOSF 2HFED 3M91A 1G1JA 3O8ZA 1FZEC 2IFNA 1GD2E 2GUVA 2GM4A 1A02F 4AQRD 4R9TA 5APTA 2KP8A 2OYIB 1RE4B 3RK3C 5AW2B 1LTSC 3C9IA 1X9VA 3BATA 2JJLA 4Y99B 1HH0A 2WPSA 2IPPA 1RE4C 1RF0A 2J61B 3I5CA 4GT1A 4B86A 1GU5A 1N73B 4M7FA 1KZUB 1KQLA 2W27A 1CZQA 2YNYA 1NKNA 3GHGA 4RESB 5AVUB 2QM8A 3V2PA 1IFIA 2WSEH 1X79B 1FIBA 1FJPA 3UIAA 1LT9B 3P8CE 1JMMA 3V5BA 3V2NA 1T3UA 1Z3SA 2E43A 2OYHA 1T2KC 2HPCA 1JOCA 4EPUA 3U59A 2N1TD 1ZR4A 2P1JA 1N86B 3MGNA 3HUSB 3R2PA 1URQB 1GTWA 1SQBK 2WZ7A 3RK3D 1H8AA 4IFDK 1N86C 3EFGA 3HUSC 1J1EB 1URQC 1ZN5A 1GL2C 2N1TA 4C7NA 2J5ZA 1MFZA 5AVSB 1WT6A 4XA4A 3NFQA 1XTGB 5AW5B 1KFMA 4WB4A 1FZBB 5AVVB 1H89A 3VOPA 1FBMA 1SP4A 1T3JA 2W6AA 1YTZT 2P67A 2WPQA 3CL3D 4NYTA 3SWYA 1G2CB 3RK2D 3HE4B 2KYVA 1RE4A 3G3ZA 3NTNA 2JEEA 1CW5A 1J1DB 2J0YA 1T2KD 2WTYA 1S9KE 1AQ5A 2H8PD 4M7HA 3TSIA 5AW9B 3VMZA 2J61A 5APYA 3A3YB 4IFFA 1J1DC 1Z3UA 1CSBA 3H6PA 1HJBA 1LTBC 5AVTB 3FIBA 4O9BA 1FZCC 1W2EA 3T97A 2J59M 3V4QA 1URQD 5AW0B 1GW3A 3CLQA 2HLOB 1GL2D 2HYNA 1FICA 4ZFGA 1JY2P 1FAVA 1NOHA 2FKWB 1FOSE 1ZLLA 3M9QA 1HTLC 5BU5A 3HE5B 1LGHB 2HLOC 2H43B 2Z4EB 1QL1A 2Q9IB 2IFMA 1JTHA 1N86A 1J2JB 3HUSA 2Q5UA 1RF1B 1IFJA 1URQA 5CCGC 3CI9A 1GL2A 2YO2A 5CMZA 2Z4EC 1YYCA 2NPSB 2LKMA 2Q9IC 4M3LA 1FZAB 4EIJA 1OWAA 2Q7CA 2XNXB 1HGVA 4N78E 2POHA 3M9BA 2J3GA 2QM7A 3OJAB 5CHXA 4C7RA 4LGDE 2J58A 4DOJA 2XNXC 3II6A 4WY4B 3HRNA 4HYTB 2M3BA 1HWTC 1G2CA 3A7OA 2OYIC 2XKMA 2Z5HA 3HE4A 4IFMA 2A45H 5AW7B 3P8CD 2FIBA 2O01H 2XDJA 3BASA 4WY4C 2H7HA 2JHKF 2O1JA 5AVQB 4Y99C 1N7LA 1LTIC 3HTKA 2WT7B 3TYYA 1NHLA 4LLHA 3M06A 2D39A 3HD7B 3OA7A 3TNUB 1L4AB 4W7YA 1FZCA 1FDMA 1FZDA 2PAJA 5CJ0A 2FFDB 1N73C 1IJDB 4N6JA 3P32A 2ZFCA 2E42A 3HD7C 1IFMA 3OAKA 2HODB 2YKOA 3VYIA 1A02J 4GIFA 2FFDC 1GU4A 1RY3A 1CI6B 1LT9C 2HLOA 4GKGA 3RL0B 1FZGA 2HODC 1SFCB 2I1JA 2FYZA 2L5GB 1SQPK 2R3CA 3P7KA 2Z5IA 5AW3B 3HE5A 3M9HA 3LIEA 3RL0C 2J1GA 5CCGA 3SWFA 1FZFB 2XV5A 1HUCA 5APQA 2Q9IA 2ZXEB 1NWQA 5CJ4A 2KLVA 1GDTA 3KQGA 1LTJB 3N4XA 1FZFC 1DEBA 2WPRA 2YKQA 3M0DC 1FJKA 1FZEA 1NH4A 4WY4D 1KILB 1LTAC 5CCHC 1JCCA 2VRSA 5AW6B 1IFDA 1HGZA 1L0NK 1J1EC 3VTPC 1RE3B 2XNXA 2WITA 4JF7A 1LTJC 1S9KD 1G1IA 1NTMK 3MIWA 1KILC 3U1CA 1SLQA 1FZBC 2OYIA 3BVHB 1NTZK 3BRTB 3HD7D 4OH8B 2C0WA 4WY4A 2JHIF 3BRVB 3IR9A 4N3YB 2WSFH 2FXMA 3H32B 1SQQK 4I2LC 3BVHC 2YKPA 2XZRA 3L37A 1LTGC 4DZOA 2WT7A 1VPCA 1N73A 3H32C 1NTKK 1EQ7A 2A45I 3HD7A 3TNUA 3LIDA 4WBAA 2J64A 3V4WA 5APSA 2FFDA 4EOTA 2J0HA 1LT9A 2GUSA 5CCHD 1JY3O 5APXA 1FU1A 2HODA 3M0AA 1M7LA 2OARA 2P7JA 1JY3N 4ZKPA 1OXZA 3KYQA 4N78D 1MZ9A 3VP9A 1HBWA 2H43C 4XE5B 1FZFA 1H88A 3M0DA 2C9LY 5CCHA 5KLVK 4AUWA 1RF1C 2R32A 2N9BA 1FIDA 1DX7A 3L4FA 1N2DC 2XU6A 1LTJA 2NPSC 1XTCC 1JCDA 1FZAC 1AFOA 2JHMF 2GY7A 1FZBA 3VN0A 3A2AA 2N1TB 1ZV8A 1WRGA 3L36A 5AW4B 1M1JB 4KHXA 1SQXK 1JUNA 3BVHA 1E5WA 1VDFA 2N1TC 3RK3B 1GW4A 2C0XA 3NMDA 4W7ZA 1IK9A 1M1JC 3H32A 4JYCA 1L0LK 3E1IB 5AVXB 2O1KA 1YTZI 5CCGD 2HG5D 1JO5A 3V2QA 1L4AC 3VP8A 3E1IC 3EQ2A 5APUA 3B8EB 5BU8B 1N7SB 3RK2B 4W80A 2J2PA 2NPSD 2MJZA 1HVVA 3KPEA 2M8RA 1N7SC 2WSCH 3RK2C 2H43A 2Z4EA 1LWUB 1SFCC 1NAFA 2JHLF 1RF1A 2R5DA 3MUDA 3WMM0 1LWUC 2NPSA 5APVA 4JYBA 1SQVK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FZA A;  1RF0 A;  1N73 A;  2J61 B;  3H32 C;  2Z4E C;  2A45 I;  2Q9I C;  1FZA B;  1N73 B;  4M7F A;  2XNX B;  2J64 A;  1RE3 C;  2FFD A;  3GHG A;  2J0H A;  1LT9 A;  2J3G A;  1JY3 O;  1FIB A;  2HOD A;  2XNX C;  2J3U A;  1LT9 B;  1JY3 N;  1T3U A;  1M1J A;  1Z3S A;  2OYH A;  2HPC A;  2OYI C;  4EPU A;  2A45 H;  2FIB A;  2H43 C;  1N86 B;  3HUS B;  1FZF A;  2JHK F;  1RF0 B;  1RF1 C;  4JYO X;  3E1I A;  1FID A;  2WNP F;  4R9J A;  2D39 A;  1N86 C;  3HUS C;  1LTJ A;  1FZC A;  1JY2 O;  1FZD A;  1FZA C;  1RF0 C;  2FFD B;  1N73 C;  2JHM F;  3GHG B;  1FZC B;  1JY2 N;  2GY7 A;  1FZB A;  2J5Z A;  2HOD B;  1JC9 A;  2FFD C;  1FZB B;  2J3F D;  3GHG C;  1LT9 C;  2HLO A;  1FZG A;  1M1J B;  3BVH A;  2HOD C;  2OYH B;  4NYT A;  2HPC B;  1LWU A;  2J3O A;  1FZG B;  2JHH C;  2J60 A;  1RE4 A;  2J1G A;  4JZC A;  1JY3 P;  1M1J C;  1FZF B;  3H32 A;  2OYH C;  2HPC C;  2Q9I A;  3E1I B;  1FZG C;  2J0Y A;  4M7H A;  2J3F A;  1FZF C;  1LTJ B;  1RE3 A;  2A45 G;  2J61 A;  1FZE A;  3E1I C;  1Z3U A;  1RE3 B;  2XNX A;  1FZE B;  2J0G A;  1LTJ C;  3FIB A;  1FZC C;  2J2P A;  1W2E A;  2HLO B;  1FIC A;  1FZE C;  2OYI A;  1FZB C;  1JY2 P;  4ZFG A;  3BVH B;  2H43 A;  2Z4E A;  1LWU B;  2JHI F;  4R9T A;  2OYI B;  2JHL F;  1RE4 B;  2HLO C;  1RF1 A;  3H32 B;  2H43 B;  2Z4E B;  3BVH C;  2Q9I B;  1LWU C;  1N86 A;  3HUS A;  1RF1 B;  1RE4 C; 
#chains in the Genus database with same CATH topology
 1JM0 A;  3LW5 J;  2KOG A;  2PP6 A;  1NTM E;  2ZT9 C;  1T8Z A;  3B5N B;  3KXD A;  5AVR B;  1LT1 A;  1NO4 A;  3RK3 E;  2ZAE B;  1JB0 J;  5E79 H;  2P2U A;  1PPJ E;  5KTB A;  1L4A A;  4AYC A;  4LC1 A;  2WNP F;  3PP5 A;  3TK1 A;  3CD6 P;  1QL2 A;  5KJ7 D;  2KB7 P;  3CX5 H;  1SFC A;  4OGQ C;  1OW7 A;  3L74 E;  2WWW A;  2ZVN B;  4JPZ B;  1T6A A;  2OYH C;  2HPC C;  4I1L A;  4C46 A;  3WUT A;  1M90 Q;  2QVA A;  2A45 G;  3G71 P;  2E75 D;  1SQV G;  1L0N G;  1MV8 A;  1KYO I;  2CPB A;  3KZI H;  3TGU J;  3CX5 E;  3H1I G;  1Y8A A;  2CPS A;  3WU2 E;  4H13 D;  2HFE D;  1NTK J;  2GUV A;  4BRY B;  2JKV A;  1A02 F;  2KP8 A;  3RK3 C;  5TJH A;  3ABV C;  1R8E A;  4Y99 B;  4U7J A;  1M57 D;  1RE4 C;  3L70 E;  3KZI E;  3FX0 A;  1BGY E;  5KAF H;  1N73 B;  2JP3 A;  1KQL A;  2W27 A;  2KI7 B;  3MHV A;  4RES B;  5AVU B;  1E79 H;  1FIB A;  3CCM P;  1KN7 A;  1JMM A;  1NU1 J;  1T3U A;  2E5T A;  2E43 A;  2OYH A;  2HPC A;  3MZW B;  3Q5S A;  1NTZ D;  2G3A A;  3MGN A;  1JMB A;  3GF3 A;  5KLV G;  1P84 D;  2KNC B;  4H44 C;  3AE2 C;  1HF9 A;  1SQX J;  2NZ2 A;  2K88 A;  1AA0 A;  1GL2 C;  1IFP A;  1Q81 Q;  2N1T A;  1Q90 D;  1LP1 B;  2IYP A;  1PP9 G;  1MFZ A;  1WT6 A;  1DIP A;  1FZB B;  3VOP A;  1HJ0 A;  2P67 A;  1EC5 A;  3RK2 D;  4IL6 X;  1RE4 A;  3H1K J;  3G3Z A;  2JEE A;  2IBZ D;  1T2K D;  2Y0E A;  4M7H A;  5AW9 B;  3Q1M A;  5APY A;  1CSB A;  3FIB A;  1FZC C;  5GTI E;  2ZYA A;  1MKM A;  1URQ D;  3CLQ A;  1FIC A;  1OVV A;  1KD1 Q;  2FKW B;  3O6Q A;  2QJY B;  5BU5 A;  2HLO C;  1PZQ A;  1PGP A;  1JTH A;  2IFM A;  3K5B A;  2AXT H;  1RF1 B;  2FY8 A;  4D6T J;  5CCG C;  1GL2 A;  2YO2 A;  2Z4E C;  1L0L D;  2NPS B;  4M3L A;  4EIJ A;  1VQP P;  1OWA A;  2PFX A;  2Q7C A;  4N78 E;  1EZV G;  1KC8 Q;  3M9B A;  2J3G A;  2QM7 A;  3OJA B;  1FDO A;  2J58 A;  4L73 A;  3II6 A;  3HRN A;  4HYT B;  1G2C A;  3BCC G;  2AXT E;  2A45 H;  2O01 H;  2O1J A;  1LTI C;  3S1K A;  3TYY A;  1NHL A;  3GG2 A;  1VL2 A;  3M06 A;  3TNU B;  4W7Y A;  1FZC A;  1IJD B;  4N6J A;  4UB6 H;  4PV1 D;  3HD7 C;  1R5S A;  2HOD B;  4GIF A;  2FFD C;  1GU4 A;  1CI6 B;  2QJK C;  3AE1 C;  2HLO A;  3RL0 B;  2FYZ A;  3FXD A;  4UB8 H;  1SQP K;  2R3C A;  2E76 C;  5AW3 B;  3HE5 A;  3M9H A;  1NJI Q;  1FZF B;  5CCG A;  1FC2 C;  2XV5 A;  5CBO A;  2ZXE B;  3I55 P;  1S1C X;  2M0B A;  3KQG A;  1LTJ B;  1KYO H;  4UB6 E;  1KIL B;  1LTA C;  5DJU B;  2VRS A;  2KZI A;  1IFD A;  1HGZ A;  3SFE C;  3VTP C;  1S9K D;  4YTP C;  1G1I A;  3U1C A;  2CK3 H;  1NYH A;  4UB8 E;  3BRT B;  2QSI A;  5KLI C;  2C0W A;  4N3Y B;  3RGU A;  2FXM A;  3A0H H;  3L72 D;  1FE6 A;  1YIT P;  3H1J E;  2K9J A;  1KYO E;  1USD A;  5L8R J;  3AEB C;  2NRG A;  1PGO A;  3AE6 C;  3HD7 A;  3EWK A;  3E1R A;  3LID A;  4WBA A;  3V4W A;  2FFD A;  1YBK A;  4H13 C;  4EOT A;  3PHL A;  4PD4 I;  2GUS A;  4IOI H;  2BCC E;  5CCH D;  5APX A;  4K3A A;  1M7L A;  2Y9Z A;  2OAR A;  1JY3 N;  2P7J A;  4ZKP A;  1OXZ A;  3KYQ A;  4RJT A;  5TIS E;  1YIJ P;  3VP9 A;  2G8Y A;  4GOD A;  3USS A;  1VQK P;  4AUW A;  2R32 A;  2QJP C;  1DX7 A;  1NTZ J;  2GY7 A;  4JBZ A;  3H1L E;  5AW4 B;  1NTM G;  2ITA A;  1M1J B;  1K9M Q;  1E5W A;  1GW4 A;  2C0X A;  2QA4 P;  3C1L A;  5AVX B;  2O1K A;  1YTZ I;  2AEM A;  1JO5 A;  1BE3 D;  2K9Y A;  2RKL A;  3L73 D;  2J2P A;  2NPS D;  2MJZ A;  1DD3 A;  2O01 N;  3CCL P;  2M8R A;  2Q3E A;  1N7S C;  2Y9Y A;  3RK2 C;  2K37 A;  1SQP E;  1SQB E;  1NAF A;  2R5D A;  1K04 A;  1LWU C;  1BDD A;  3L74 G;  5KAI E;  2Q6Q A;  1EXI A;  2YO3 A;  3PRJ A;  4EI2 A;  2I1K A;  4HKZ H;  2C9N Y;  1PPJ D;  3V2R A;  3CWB E;  5AVY B;  1YJN P;  1L0L J;  2E75 B;  3B5N C;  3CCV P;  3L35 A;  1MUU A;  3L75 E;  1VF5 D;  3RL0 D;  3A5T A;  4BXL A;  4MN4 C;  4L74 A;  2FYU K;  2ZYD A;  1JY2 O;  1SQP J;  4ZKU A;  3GHG B;  3L70 G;  1EDI A;  1N7S A;  4DCK A;  3LW5 H;  2KSJ A;  1BGY G;  1U7J A;  1KIL D;  3N7N A;  4U3F D;  1Q2N A;  1Z56 A;  5AVW B;  2B87 A;  3H1H D;  1ZR2 A;  3D6Z A;  1LWU A;  1FZG B;  2MKV A;  3CX5 D;  3CMA P;  5M1B A;  1NU1 K;  3FXE A;  3U1A A;  5AW1 B;  1K8A Q;  2J3F A;  3VMY A;  1IC2 A;  2YMK A;  2W8Z A;  1NKZ B;  3MD0 A;  2IDB A;  1S72 P;  1X0T A;  1FZE B;  2J0G A;  1AV1 A;  3IFM A;  3B5N A;  1G1J A;  1GD2 E;  2GM4 A;  4AQR D;  2AEJ A;  1AVO A;  1HH0 A;  2WPS A;  4I7Z B;  2J61 B;  4GT1 A;  2V7Q J;  1KMI Z;  1ZP0 C;  4PD4 H;  1NKN A;  2FXP A;  4NPF X;  1IFI A;  1X79 B;  2JO1 A;  1FJP A;  1S5L H;  2M5A A;  1Z3S A;  3Q2Y A;  1ZR4 A;  1FDI A;  2P1J A;  1N86 B;  3HUS B;  3R2P A;  1OZH A;  1URQ B;  5EFW B;  2KK7 A;  2FXO A;  1SQQ D;  1NGM B;  1RQV A;  4IFD K;  3CXH I;  4PD4 E;  3EFG A;  1Q7Y Q;  1ZN5 A;  1AJY A;  3L71 D;  1S5L E;  1XTG B;  2H88 C;  3TGU E;  1WMK A;  1ZW0 A;  1SP4 A;  1YTZ T;  2WPQ A;  4NYT A;  3HE4 B;  1NTK E;  4OWF A;  2IYO A;  5B5E H;  1CW5 A;  1J1D B;  2FYU E;  3VMZ A;  3A3Y B;  1PGJ A;  4H0L D;  1Y9B A;  5AVT B;  3WU2 H;  3AEA C;  1W2E A;  3T97 A;  2J59 M;  1GW3 A;  2A06 E;  1JY2 P;  2FBW C;  1BE3 J;  2QIW A;  2IZ0 A;  1FOS E;  5B5E E;  1ZLL A;  2WSS H;  1HTL C;  3L73 J;  1LGH B;  1NU1 E;  4CPG A;  2H43 B;  3QWO C;  4PV1 B;  1P84 I;  2Q5U A;  2QJY C;  3CI9 A;  2LKM A;  3FGA D;  4PJ0 H;  2JWD A;  1HGV A;  1SQX E;  2H89 C;  2POH A;  5CHX A;  4C7R A;  2FYU J;  2M3B A;  1HWT C;  2OYI C;  2XKM A;  1S2E A;  3P8C D;  1ZRT D;  4DJG A;  2ZJS E;  2XDJ A;  2H7H A;  2IZ1 A;  2IBZ I;  3HTK A;  4PJ0 E;  3H1K E;  1OW8 A;  1BCC E;  2KIK A;  3ZDM A;  1L4A B;  2KS1 A;  1DEE G;  3H1J G;  3Q3D A;  1SQV D;  2PAJ A;  5CJ0 A;  1L0N D;  1EDJ A;  4GDO A;  2E42 A;  3H1I D;  3AE7 C;  3SSU A;  1LT9 C;  1W5C E;  2HOD C;  1SFC B;  2I1J A;  2BCC G;  4ZMD A;  3ITK A;  1YJ9 P;  2Z5I A;  3LIE A;  3RL0 C;  2J1G A;  1NWQ A;  4U3F J;  2E74 B;  1FZF C;  3N4X A;  1OIP A;  1DEB A;  4WY4 D;  3H1H J;  4D6T E;  1L0N K;  1J1E C;  3S4R A;  5GTI H;  4JF7 A;  1LTJ C;  1OVR A;  3MIW A;  1KIL C;  3H1J D;  1SLQ A;  4Y28 J;  2KUB A;  2OYI A;  3TF5 A;  1KQG B;  1NTZ K;  1BCC J;  1IZN B;  1AVY A;  2WSF H;  3H1L G;  2D2C C;  4I2L C;  3D70 A;  2KSE A;  1LTG C;  5KLV D;  1N8R Q;  1EQ7 A;  3TNU A;  1KB9 D;  5APS A;  5GTH E;  1LT9 A;  1PP9 D;  1FU1 A;  2HOD A;  4YPC A;  1PL5 A;  3AE4 C;  2OTL P;  1YQ3 C;  5H2F E;  1H0T A;  2GA1 A;  2RH0 A;  1MZ9 A;  1HBW A;  4XE5 B;  1FZF A;  1SQP G;  1SQB G;  2C9L Y;  5KLV K;  3CXH H;  3MUD C;  2N9B A;  1N2D C;  2XU6 A;  3F89 A;  1LTJ A;  1XTC C;  1FZA C;  2OQQ A;  3D6Y A;  2JHM F;  2QG4 A;  2N1T B;  3TDK A;  1ZV8 A;  1SQQ J;  2J5U A;  1JUN A;  3RK3 B;  3L71 J;  3CWB G;  3CXH E;  1M1J C;  1L0L K;  1QVG O;  3E1I B;  3L75 G;  3G9R A;  3VP8 A;  3EQ2 A;  2OYO A;  1EZV D;  1VF5 B;  1HVV A;  3KPE A;  2Z4E A;  2BEZ F;  3BCC D;  2OTJ P;  3MUD A;  4KJM A;  3O6Q B;  3SFD C;  2PRR A;  1FZA A;  1JTH B;  5KJ7 C;  2R3S A;  3CCR P;  2Q3I A;  1GL2 B;  1RE3 C;  3P8M C;  1IO4 A;  1L4A D;  1NTZ E;  2J3U A;  4HH2 A;  2QE7 H;  1P84 E;  5TIS H;  1M1J A;  3CME P;  2R44 A;  2E75 C;  1GZL A;  1GK6 A;  3JCU E;  1RF0 B;  1SFC D;  4JYO X;  3E7K A;  1PFI A;  4NPD A;  1FZC B;  2E74 D;  5BVZ A;  1JC9 A;  3GHG C;  2YMY A;  1EXJ A;  1M56 D;  5AVZ B;  1SQV J;  2IBZ E;  1L0N J;  2LXC B;  1OMI A;  3WUU A;  4JZC A;  3H1I J;  5KJ7 A;  1RHZ B;  1NAY A;  1FZG C;  3B71 A;  1U57 A;  1AQT A;  1KFN A;  2WSE J;  1RE3 A;  3PJS K;  1SVF A;  4C7N B;  4L75 A;  1IFN A;  1FOS F;  1FZE C;  3PLN A;  2IFN A;  4R9T A;  5APT A;  3IAO A;  3TGU G;  1L0L E;  5AW2 B;  1LTS C;  3C9I A;  1X9V A;  4OGQ D;  2JJL A;  5KAI H;  2B88 A;  1GMJ A;  1NTK G;  3JC2 2;  4M7F A;  2FYU G;  2RN0 A;  2YNY A;  3GHG A;  5KKZ C;  4IL6 E;  2O3J A;  2QM8 A;  3V2P A;  3WUV A;  5KLV J;  1U7M A;  3UIA A;  2W83 C;  2QJK B;  2W6J H;  1NTM D;  4H0L B;  1T2K C;  2E76 B;  2N1T D;  2AEF A;  2A06 G;  1PP9 J;  1PGQ A;  5CBN A;  1LNQ A;  2WZ7 A;  1BDC A;  1NU1 G;  3RK3 D;  3CCE P;  1N86 C;  3HUS C;  3G4S P;  1URQ C;  4YXW H;  3W67 A;  1QGK B;  5AVS B;  4XA4 A;  5AW5 B;  1KQF B;  5AVV B;  2V7Q H;  1H89 A;  1SQX G;  4TT3 H;  1T3J A;  1USE A;  3CL3 D;  3NTN A;  1ZXG A;  3L74 D;  2J0Y A;  1YJW P;  1S9K E;  2H8P D;  4HB1 A;  3TSI A;  2J61 A;  2BEQ D;  4IFF A;  1MFT A;  1J1D C;  1Z3U A;  3H6P A;  1Y47 A;  3H1K G;  1BCC G;  1LTB C;  3SWK A;  4O9B A;  5AW0 B;  1GL2 D;  2HYN A;  3IF4 A;  4ZFG A;  1NOH A;  3M9Q A;  3JSV C;  3CC2 P;  2LXB A;  1ZME C;  2Q9I B;  1N86 A;  1J2J B;  2YIU B;  3HUS A;  4HJG H;  1URQ A;  3EFF K;  4OVN F;  4PV1 C;  2AXC A;  2XNX B;  3BCC J;  2KXP B;  3L70 D;  4D6T G;  1BGY D;  1KTM A;  1VQ5 P;  4WY4 B;  1JEK A;  2I8D A;  2PGD A;  2Q1K A;  3HE4 A;  5AW7 B;  2FIB A;  3BAS A;  2JHK F;  5AVQ B;  4Y99 C;  2WT7 B;  4ZNC A;  3L72 J;  3Q5P A;  2D39 A;  1FDM A;  3S9O A;  1N73 C;  1VQO P;  1YQ4 C;  2JWA A;  2ZFC A;  1VQ6 P;  3OAK A;  2YKO A;  1KOR A;  1M8O B;  2KLU A;  1QLE D;  2ZXX A;  1BE3 E;  1HUC A;  3L73 E;  5CJ4 A;  2KLV A;  2WPR A;  2ZYG A;  5CCH C;  1NH4 A;  1FJK A;  2E74 C;  2WIT A;  4BRY A;  4R4M A;  1FZB C;  3BVH B;  3AEG C;  3HD7 D;  3IR9 A;  3H32 B;  1SQQ K;  2YKP A;  2XZR A;  1SS1 A;  4DZO A;  1N73 A;  2E76 D;  2A45 I;  3GLM A;  1S4X A;  2Y0C A;  2J64 A;  4QMA A;  1QVF O;  2J0H A;  5C39 A;  1JY3 O;  2FYN B;  4N78 D;  3AEF C;  4TLF A;  4KT0 J;  1OFC X;  2KNC A;  3AE9 C;  2M5A B;  4NPE A;  3FWN A;  5E79 E;  5CCH A;  1D7M A;  1RF1 C;  1NTM J;  1FID A;  2NPS C;  1OVU A;  1LP1 A;  1KIL E;  1AFO A;  2WSC J;  4U3F E;  1FZB A;  2LR2 A;  3CXH D;  3VN0 A;  3H1H E;  4GOF A;  4XFJ A;  1WRG A;  4KHX A;  1TU3 F;  2N1T C;  3AE5 C;  1NTZ G;  1IK9 A;  4JYC A;  2L91 A;  1KB9 I;  3AEC C;  1VQL P;  3E1I C;  1Q86 Q;  5K5G B;  3B8E B;  3CCU P;  3L74 J;  1M1K Q;  3T97 B;  2N9Y B;  1VF5 C;  3QH9 A;  2YXR B;  1RF1 A;  1QX8 A;  3WMM 0;  2IBZ G;  2NPS A;  5APV A;  1SQV K;  2B89 A;  2ZT9 B;  2M3E A;  5KAF E;  1IK7 A;  5GTH H;  3MP7 B;  1KYO D;  1W2B O;  1DH3 A;  4ASV A;  2R5B A;  3F5H A;  2WQY C;  5H2F H;  2KZJ A;  1SQQ E;  2BCC D;  4I6M C;  1X8Y A;  3KDP B;  2K1A A;  3L70 J;  1N7S D;  1BGY J;  3L71 E;  2P10 A;  3E1I A;  1L0L G;  4R9J A;  1GK4 A;  3HTK B;  3GW6 A;  3C8V A;  5AW8 B;  1RF0 C;  3CC4 P;  1Q82 Q;  2KS1 B;  1EZV I;  1JY2 N;  2BAS A;  5APW A;  4OGQ B;  3VMX A;  1JNM A;  1CI6 A;  3PH0 A;  3CCQ P;  2J3F D;  1LTT C;  5DJT B;  3CCJ P;  4L76 A;  2OYH B;  2HPC B;  2J3O A;  2JHH C;  2J60 A;  1JY3 P;  3H1L D;  4WWI A;  3B5N D;  1NVO A;  1KIL A;  1VQ7 P;  2IX7 C;  1KV4 A;  1RQU A;  3CCS P;  2JR8 A;  3NXS A;  3MTU E;  2W6B A;  3M91 A;  3O8Z A;  1KQS O;  4DT0 A;  2OYI B;  4K35 A;  1RE4 B;  3BAT A;  1SQP D;  1SQB D;  2IPP A;  1RF0 A;  3I5C A;  2WMM A;  4B86 A;  2OGU A;  1GU5 A;  1KZU B;  3CPW O;  1CZQ A;  2WSE H;  1VQ4 P;  3AE8 C;  1LT9 B;  1ZRT E;  3P8C E;  3V5B A;  1P84 H;  3V2N A;  2P58 A;  2WSF J;  2QEX P;  3I56 P;  1JOC A;  3L72 G;  3U59 A;  4EPU A;  4H44 B;  4ASW A;  3CWB D;  1H0T B;  1SQV E;  3JCU H;  1L0N E;  2W90 A;  4H0L C;  1K73 Q;  1GTW A;  1SQB K;  1H8A A;  3H1I E;  1VQM P;  3L75 D;  1J1E B;  2HR3 A;  3RBZ A;  3RBX A;  4C7N A;  2B9B A;  2J5Z A;  3NFQ A;  1KFM A;  4WB4 A;  2UWJ E;  1FBM A;  4GOE A;  2W6A A;  3SWY A;  1G2C B;  1LJ2 A;  1RH5 B;  2KYV A;  3V6I A;  2D2C B;  2WTY A;  1AQ5 A;  1KB9 H;  2E5Y A;  3AEE C;  3GF7 A;  3IN6 A;  4JQ0 D;  1HJB A;  2ZT9 D;  3V4Q A;  2O01 J;  3VMA A;  1DD4 A;  2HLO B;  3G6E P;  1FAV A;  5KLV E;  4EYY Q;  2DW3 A;  4YXD C;  1BSN A;  1YHQ P;  3HE5 B;  1S5L X;  2Z4E B;  3OW2 O;  3A0H E;  1QL1 A;  1KB9 E;  4EDF A;  1IFJ A;  1VQN P;  5CMZ A;  1PP9 E;  1YYC A;  4BWN A;  1BE3 G;  2Q9I C;  1FZA B;  2YIU C;  1PIX A;  3L73 G;  4IL6 H;  2XNX C;  4LGD E;  4DOJ A;  3H1J J;  2WPV B;  3A7O A;  2Z5H A;  4IFM A;  4WY4 C;  2K9J B;  1N7L A;  4I7Z C;  3H25 A;  4LLH A;  1L2P A;  1R5L A;  3HD7 B;  3OA7 A;  2BCC J;  1FZD A;  2FFD B;  4A7P A;  3P32 A;  1IFM A;  1PPJ G;  4PD4 D;  3VYI A;  1A02 J;  1RY3 A;  1UIX A;  3CX5 I;  4GKG A;  1FZG A;  1BSH A;  2L5G B;  3P7K A;  3TGU D;  1ZOY C;  3SWF A;  5APQ A;  1FS0 E;  3R4Y A;  2Q9I A;  4Z1M H;  1GDT A;  2V4H A;  1EZV E;  1NTK D;  2YKQ A;  3M0D C;  1FZE A;  1EDK A;  1JCC A;  5AW6 B;  1RE3 B;  2FYU D;  2XNX A;  3H1L J;  5KLI B;  1NTM K;  2K3R A;  3BCC E;  3W68 A;  4U3F G;  3H1H G;  4OH8 B;  4WY4 A;  1EDL A;  2JHI F;  3BRV B;  3D71 A;  3BVH C;  2A06 D;  3B4S A;  3L37 A;  2WT7 A;  1VPC A;  3H32 C;  3CC7 P;  1NTK K;  1NU1 D;  4H13 B;  1YI2 P;  4H44 D;  1VQ8 P;  3L72 E;  1X22 A;  1SQB J;  3M0A A;  2OTK E;  1SQX D;  1UII A;  3AED C;  2QJP B;  2FYN C;  2H43 C;  4R4L A;  1H88 A;  3M0D A;  2XND H;  1S3J A;  2WVR A;  3FWL A;  3KHU A;  3A0B H;  3L4F A;  2D2C D;  3RL0 g;  1OW6 A;  1JCD A;  3CWB J;  2ZVO B;  3H1K D;  1BCC D;  3A2A A;  1PV3 A;  3L36 A;  5B66 H;  4WVZ A;  3L75 J;  1SQX K;  3BVH A;  1VDF A;  3AE3 C;  4RO0 A;  3NMD A;  4W7Z A;  3H32 A;  3A0B E;  4RKU J;  1VQ9 P;  1SQQ G;  3Q5R A;  5CCG D;  2HG5 D;  3V2Q A;  1L4A C;  3L71 G;  5APU A;  2Y0D A;  2YXQ B;  5KKZ B;  1OX3 A;  5BU8 B;  1N7S B;  3RK2 B;  4W80 A;  1QEX A;  5B66 E;  4D6T D;  3GMA A;  2B87 B;  2WSC H;  2RMZ A;  2H43 A;  1LWU B;  1SFC C;  2SPZ A;  2JDI H;  2JHL F;  1K05 A;  3PTZ A;  2QRX A;  4JYB A; 
#chains in the Genus database with same CATH homology
 1FZA A;  1JTH B;  5KJ7 C;  2KOG A;  2Q3I A;  2PP6 A;  1GL2 B;  2YO3 A;  1RE3 C;  3P8M C;  1DH3 A;  2C9N Y;  1T8Z A;  2I1K A;  3B5N B;  1IO4 A;  5AVR B;  2R5B A;  1L4A D;  3V2R A;  5AVY B;  2J3U A;  4HH2 A;  3B5N C;  1M1J A;  1NO4 A;  4I6M C;  1X8Y A;  3L35 A;  3KDP B;  1MUU A;  1N7S D;  3RL0 D;  2P2U A;  1GZL A;  1GK6 A;  3A5T A;  1RF0 B;  5KTB A;  1L4A A;  1SFC D;  4AYC A;  4JYO X;  4LC1 A;  3E1I A;  2FYU K;  2WNP F;  4R9J A;  1GK4 A;  3HTK B;  1JY2 O;  5AW8 B;  3PP5 A;  1RF0 C;  1PFI A;  3TK1 A;  1QL2 A;  4ZKU A;  3GHG B;  1FZC B;  1JY2 N;  5APW A;  2BAS A;  3VMX A;  1JNM A;  5KJ7 D;  5BVZ A;  2KB7 P;  1JC9 A;  1CI6 A;  1N7S A;  3LW5 H;  2KSJ A;  1KIL D;  1SFC A;  3N7N A;  2J3F D;  3GHG C;  2YMY A;  1LTT C;  1Z56 A;  5AVW B;  5AVZ B;  2OYH B;  2HPC B;  1ZR2 A;  2WWW A;  1LWU A;  2J3O A;  1FZG B;  2JHH C;  2J60 A;  4JZC A;  1JY3 P;  5KJ7 A;  1NU1 K;  3B5N D;  2OYH C;  2HPC C;  4I1L A;  4C46 A;  3U1A A;  1FZG C;  5AW1 B;  1KIL A;  1KFN A;  2J3F A;  1RE3 A;  2A45 G;  3VMY A;  1SVF A;  2IX7 C;  1IC2 A;  1MV8 A;  3MD0 A;  1NKZ B;  2CPB A;  4C7N B;  1FZE B;  2J0G A;  3IFM A;  3NXS A;  3MTU E;  2CPS A;  1IFN A;  3B5N A;  2W6B A;  1FOS F;  2HFE D;  3M91 A;  1G1J A;  3O8Z A;  1FZE C;  2IFN A;  1GD2 E;  2GUV A;  2GM4 A;  1A02 F;  4AQR D;  4R9T A;  5APT A;  2KP8 A;  2OYI B;  1RE4 B;  3RK3 C;  5AW2 B;  1LTS C;  3C9I A;  1X9V A;  3BAT A;  2JJL A;  4Y99 B;  1HH0 A;  2WPS A;  2IPP A;  1RE4 C;  1RF0 A;  2J61 B;  3I5C A;  4GT1 A;  4B86 A;  1GU5 A;  1N73 B;  4M7F A;  1KZU B;  1KQL A;  2W27 A;  1CZQ A;  2YNY A;  1NKN A;  3GHG A;  4RES B;  5AVU B;  2QM8 A;  3V2P A;  1IFI A;  2WSE H;  1X79 B;  1FIB A;  1FJP A;  3UIA A;  1LT9 B;  3P8C E;  1JMM A;  3V5B A;  3V2N A;  1T3U A;  1Z3S A;  2E43 A;  2OYH A;  1T2K C;  2HPC A;  1JOC A;  4EPU A;  3U59 A;  2N1T D;  1ZR4 A;  2P1J A;  1N86 B;  3MGN A;  3HUS B;  3R2P A;  1URQ B;  1GTW A;  1SQB K;  2WZ7 A;  3RK3 D;  1H8A A;  4IFD K;  1N86 C;  3EFG A;  3HUS C;  1J1E B;  1URQ C;  1ZN5 A;  1GL2 C;  2N1T A;  4C7N A;  2J5Z A;  1MFZ A;  5AVS B;  1WT6 A;  4XA4 A;  3NFQ A;  1XTG B;  5AW5 B;  1KFM A;  4WB4 A;  1FZB B;  5AVV B;  1H89 A;  3VOP A;  1FBM A;  1SP4 A;  1T3J A;  2W6A A;  1YTZ T;  2P67 A;  2WPQ A;  3CL3 D;  4NYT A;  3SWY A;  1G2C B;  3RK2 D;  3HE4 B;  2KYV A;  1RE4 A;  3G3Z A;  3NTN A;  2JEE A;  1CW5 A;  1J1D B;  2J0Y A;  1T2K D;  2WTY A;  1S9K E;  1AQ5 A;  2H8P D;  4M7H A;  3TSI A;  5AW9 B;  3VMZ A;  2J61 A;  5APY A;  3A3Y B;  4IFF A;  1J1D C;  1Z3U A;  1CSB A;  3H6P A;  1HJB A;  1LTB C;  5AVT B;  3FIB A;  4O9B A;  1FZC C;  1W2E A;  3T97 A;  2J59 M;  3V4Q A;  1URQ D;  5AW0 B;  1GW3 A;  3CLQ A;  2HLO B;  1GL2 D;  2HYN A;  1FIC A;  4ZFG A;  1JY2 P;  1FAV A;  1NOH A;  2FKW B;  1FOS E;  1ZLL A;  3M9Q A;  1HTL C;  5BU5 A;  3HE5 B;  1LGH B;  2HLO C;  2H43 B;  2Z4E B;  1QL1 A;  2Q9I B;  2IFM A;  1JTH A;  1N86 A;  1J2J B;  3HUS A;  2Q5U A;  1RF1 B;  1IFJ A;  1URQ A;  5CCG C;  3CI9 A;  1GL2 A;  2YO2 A;  5CMZ A;  2Z4E C;  1YYC A;  2NPS B;  2LKM A;  2Q9I C;  4M3L A;  1FZA B;  4EIJ A;  1OWA A;  2Q7C A;  2XNX B;  1HGV A;  4N78 E;  2POH A;  3M9B A;  2J3G A;  2QM7 A;  3OJA B;  5CHX A;  4C7R A;  4LGD E;  2J58 A;  4DOJ A;  2XNX C;  3II6 A;  4WY4 B;  3HRN A;  4HYT B;  2M3B A;  1HWT C;  1G2C A;  3A7O A;  2OYI C;  2XKM A;  2Z5H A;  3HE4 A;  4IFM A;  2A45 H;  5AW7 B;  3P8C D;  2FIB A;  2O01 H;  2XDJ A;  3BAS A;  4WY4 C;  2H7H A;  2JHK F;  2O1J A;  5AVQ B;  4Y99 C;  1N7L A;  1LTI C;  3HTK A;  2WT7 B;  3TYY A;  1NHL A;  4LLH A;  3M06 A;  2D39 A;  3HD7 B;  3OA7 A;  3TNU B;  1L4A B;  4W7Y A;  1FZC A;  1FDM A;  1FZD A;  2PAJ A;  5CJ0 A;  2FFD B;  1N73 C;  1IJD B;  4N6J A;  3P32 A;  2ZFC A;  2E42 A;  3HD7 C;  1IFM A;  3OAK A;  2HOD B;  2YKO A;  3VYI A;  1A02 J;  4GIF A;  2FFD C;  1GU4 A;  1RY3 A;  1CI6 B;  1LT9 C;  2HLO A;  4GKG A;  3RL0 B;  1FZG A;  2HOD C;  1SFC B;  2I1J A;  2FYZ A;  2L5G B;  1SQP K;  2R3C A;  3P7K A;  2Z5I A;  5AW3 B;  3HE5 A;  3M9H A;  3LIE A;  3RL0 C;  2J1G A;  5CCG A;  3SWF A;  1FZF B;  2XV5 A;  1HUC A;  5APQ A;  2Q9I A;  2ZXE B;  1NWQ A;  5CJ4 A;  2KLV A;  1GDT A;  3KQG A;  1LTJ B;  3N4X A;  1FZF C;  1DEB A;  2WPR A;  2YKQ A;  3M0D C;  1FJK A;  1FZE A;  1NH4 A;  4WY4 D;  1KIL B;  1LTA C;  5CCH C;  1JCC A;  2VRS A;  5AW6 B;  1IFD A;  1HGZ A;  1L0N K;  1J1E C;  3VTP C;  1RE3 B;  2XNX A;  2WIT A;  4JF7 A;  1LTJ C;  1S9K D;  1G1I A;  1NTM K;  3MIW A;  1KIL C;  3U1C A;  1SLQ A;  1FZB C;  2OYI A;  3BVH B;  1NTZ K;  3BRT B;  3HD7 D;  4OH8 B;  2C0W A;  4WY4 A;  2JHI F;  3BRV B;  3IR9 A;  4N3Y B;  2WSF H;  2FXM A;  3H32 B;  1SQQ K;  4I2L C;  3BVH C;  2YKP A;  2XZR A;  3L37 A;  1LTG C;  4DZO A;  2WT7 A;  1VPC A;  1N73 A;  3H32 C;  1NTK K;  1EQ7 A;  2A45 I;  3HD7 A;  3TNU A;  3LID A;  4WBA A;  2J64 A;  3V4W A;  5APS A;  2FFD A;  4EOT A;  2J0H A;  1LT9 A;  2GUS A;  5CCH D;  1JY3 O;  5APX A;  1FU1 A;  2HOD A;  3M0A A;  1M7L A;  2OAR A;  2P7J A;  1JY3 N;  4ZKP A;  1OXZ A;  3KYQ A;  4N78 D;  1MZ9 A;  3VP9 A;  1HBW A;  2H43 C;  4XE5 B;  1FZF A;  1H88 A;  3M0D A;  2C9L Y;  5CCH A;  5KLV K;  4AUW A;  1RF1 C;  2R32 A;  2N9B A;  1FID A;  1DX7 A;  3L4F A;  1N2D C;  2XU6 A;  1LTJ A;  2NPS C;  1XTC C;  1JCD A;  1FZA C;  1AFO A;  2JHM F;  2GY7 A;  1FZB A;  3VN0 A;  3A2A A;  2N1T B;  1ZV8 A;  1WRG A;  3L36 A;  5AW4 B;  1M1J B;  4KHX A;  1SQX K;  1JUN A;  3BVH A;  1E5W A;  1VDF A;  2N1T C;  3RK3 B;  1GW4 A;  2C0X A;  3NMD A;  4W7Z A;  1IK9 A;  1M1J C;  3H32 A;  4JYC A;  1L0L K;  3E1I B;  5AVX B;  2O1K A;  1YTZ I;  5CCG D;  2HG5 D;  1JO5 A;  3V2Q A;  1L4A C;  3VP8 A;  3E1I C;  3EQ2 A;  5APU A;  3B8E B;  5BU8 B;  1N7S B;  3RK2 B;  4W80 A;  2J2P A;  2NPS D;  2MJZ A;  1HVV A;  3KPE A;  2M8R A;  1N7S C;  2WSC H;  3RK2 C;  2H43 A;  2Z4E A;  1LWU B;  1SFC C;  1NAF A;  2JHL F;  1RF1 A;  2R5D A;  3MUD A;  3WMM 0;  1LWU C;  2NPS A;  5APV A;  4JYB A;  1SQV K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...