2HPCB

Crystal structure of fragment d from human fibrinogen complexed with gly-pro-arg-pro-amide.
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
307
structure length
307
Chain Sequence
LYIDETVNSNIPTNLRVLRSILENLRSKIQKLESDVSAQMEYCRTPCTVSCNIPVVSGKECEEIIRKGGETSEMYLIQPDSSVKPYRVYCDMNTENGGWTVIQNRQDGSVDFGRKWDPYKQGFGNVATNTDGKNYCGLPGEYWLGNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGGFTVQNEANKYQISVNKYRGTAGNALMDGASQLMGENRTMTIHNGMFFSTYDRDNDGWLTSDPRKQCSKEDGGGWWYNRCHAANPNGRYYWGGQYTWDMAKHGTDDGVVWMNWKGSWYSMRKMSMKIRPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Blood clotting
molecule keywords Fibrinogen alpha chain
total genus 66
structure length 307
sequence length 307
chains with identical sequence E, H, K
ec nomenclature
pdb deposition date 2006-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2hpcB01
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 2hpcB02
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 2hpcB03
2XNXA 2J0YA 2FFDB 1RF1B 1FIBA 2OYHC 2OYHB 2Z4EC 1N73C 2OYIC 1RE4C 1JY3P 3E1IA 3H32B 2XNXC 3E1IC 2J3GA 1FZEC 1N73B 1LT9B 1Z3SA 1N86B 2OYIA 1RE4B 4M7FA 2J3FD 1JY3O 1FZCB 1FICA 2FFDC 1RF1C 1JY2P 2A45I 1LT9A 2JHIF 1JC9A 1JY2N 1FZCC 2HPCA 1FZAA 1JY3N 1Z3UA 2J64A 1LTJA 2JHKF 1LWUB 3FIBA 4R9JA 2H43A 1JY2O 1FZFC 2XNXB 3HUSB 1RE3B 2J0GA 2J61A 4ZFGA 2A45G 2HPCB 1FZAB 1FZGA 2Z4EB 1LTJB 1FZBB 2HLOA 2HPCC 3H32C 1N86A 2H43C 2OYIB 1FZBC 1RE4A 2HODB 4NYTA 2Z4EA 1FZGB 2J60A 2J3OA 3BVHB 1M1JC 1RE3C 1FZFB 1M1JB 4JYOX 1FZEA 2HODA 2J3UA 2D39A 1W2EA 2HODC 1FZDA 1LWUA 2JHMF 2H43B 3BVHC 2J3FA 2FIBA 2OYHA 3HUSA 2WNPF 1FZGC 1N86C 3GHGB 1RE3A 2Q9IC 2J61B 1M1JA 2J5ZA 1FZEB 1RF0B 2GY7A 4EPUA 3H32A 2Q9IB 2HLOC 1FZBA 1N73A 2HLOB 2JHLF 1LTJC 1T3UA 1RF0C 3GHGA 2J2PA 1FZAC 4M7HA 3GHGC 2J1GA 1RF0A 2A45H 1FZCA 3HUSC 2Q9IA 4R9TA 3BVHA 1LWUC 4JZCA 2JHHC 1RF1A 2FFDA 2J0HA 1FIDA 1FZFA 1LT9C 3E1IB
chains in the Genus database with same CATH superfamily
2XNXA 1HVVA 2KI7B 5KJ7C 1FIBA 3M0DC 1GK6A 3CL3D 2IYOA 3PP5A 1FJKA 3V2RA 1NTZD 1URQA 3PJSK 1FJPA 2WSFH 2YKPA 2KSEA 2J3FD 1LJ2A 3H1LE 2A45I 1D7MA 1YJWP 4PD4H 1G2CB 1SQQE 3LIEA 1KTMA 1ZP0C 1OX3A 3H1KG 1H0TA 1DIPA 1OXZA 3H32C 4C7NA 1XTGB 2NRGA 1FZGB 1T3JA 4JBZA 1FU1A 4GDOA 2AXTE 5APYA 2J3OA 1CI6A 1NO4A 3H1LD 2FYUK 3ITKA 3O6QA 3KXDA 2KZIA 2IFNA 1FDIA 2OYHA 1SQPE 5GTIH 3Q2YA 2WSEJ 2GY7A 4UB6H 3N7NA 2WSCH 1QVFO 2ZT9C 3SWYA 1BE3D 3WUUA 2J2PA 3L70D 1L2PA 3SWKA 1NAFA 3AEGC 2BCCE 3B8EB 2FFDA 1DEBA 2ZVNB 2AXCA 3AEFC 1NVOA 1PP9D 5KAFH 2YIUB 2P67A 1FOSE 2OYHC 1NYHA 1RE4C 1H88A 5CCHA 4BRYB 3ABVC 3V4WA 4Y99C 4JF7A 1NU1K 4KHXA 4PD4I 3Q5RA 1RH5B 2Z5IA 4L75A 2JHIF 1KMIZ 1VQ8P 4L76A 1N7SC 3K5BA 2KK7A 3CCMP 1L0LK 2Q3EA 3E1RA 3CWBG 1LTJB 2KZJA 1AA0A 1NTZG 1X22A 3F5HA 5KTBA 1OW6A 3CX5D 3VMYA 1SQQJ 1VDFA 1PGPA 2WVRA 2G8YA 1FS0E 4WY4A 4ZMDA 2Q3IA 2GM4A 1M1JB 3D71A 3WU2H 4OGQD 2H43B 1GL2D 1SQBK 2J5ZA 4I2LC 3BCCE 1JM0A 1LP1A 3A0HH 3AE4C 1VPCA 3FXDA 4PV1D 3RBXA 1RF0A 1ZR4A 2P2UA 3H1KE 1SS1A 2CPSA 3L74J 3BVHA 3Q1MA 3B5NC 1L4AD 3MGNA 1Y9BA 3CXHD 1G1IA 2A06D 1HJ0A 1PGQA 1YTZI 4IL6X 2K1AA 4WWIA 5BU8B 2FYUG 3I55P 3H1HG 3SFEC 4JPZB 1H0TB 3BRTB 3VTPC 5C39A 1W5CE 3CCQP 2K37A 2OGUA 2BCCG 3CD6P 1ZMEC 2YMYA 1FZGA 1KQLA 2M0BA 1EDJA 1YQ3C 2JWAA 1S2EA 1SFCA 1AQTA 2HYNA 2JWDA 1NTKK 1VQPP 1URQC 1J2JB 4ASWA 3O6QB 4MN4C 5E79H 1OW7A 5B5EH 3U1AA 5AW2B 2PFXA 3A0BE 2WITA 2IBZE 1ZRTE 1NU1G 1RE3A 3P7KA 2HFED 1MFTA 1FZEB 2N9YB 3CC4P 2XV5A 3CMAP 1SQQD 3WMM0 2Q6QA 3KZIE 5AVQB 1PZQA 2WPQA 1L0LG 3RK2C 1NAYA 5CMZA 1M56D 1L0NJ 1NTZE 4K35A 4BRYA 3CCLP 3LIDA 3SWFA 2P58A 3L70G 2NPSA 2QM8A 1S9KD 2ZYDA 1FDMA 3HE4A 3RK3D 1MV8A 2HR3A 3G6EP 2BASA 1YI2P 1EXJA 2ZYAA 1BGYD 5KJ7D 1ZXGA 5H2FH 1SQBG 3AE3C 1L4AC 2Y0DA 1NH4A 1HWTC 1JY3N 1LNQA 3EQ2A 4ZKUA 1LTJA 3BRVB 3GW6A 3USSA 1K04A 2E74B 2N1TC 3L73G 2HPCB 2QJPC 2JO1A 1IJDB 1RQVA 1GK4A 1LTTC 1BCCE 3PTZA 3MP7B 3L73J 2R3CA 4WY4C 3I5CA 4EIJA 3H25A 4WVZA 2J3UA 3H1IG 2FYUE 4IFMA 1LWUA 1LTSC 2WNPF 1SQPK 3GHGB 2KNCB 3H1LJ 4EDFA 2ZT9B 3H32A 3AEBC 5AW6B 2WT7A 3B5ND 1T3UA 3A0HE 1N7SD 1EZVE 1L0ND 4PV1C 2KP8A 2M5AA 2C0XA 2MKVA 1YBKA 3PRJA 2WZ7A 2IZ0A 2P7JA 1OMIA 4LC1A 1L0NK 5APQA 3CWBJ 3CXHE 3BCCJ 1NTKG 3D70A 3MUDA 4EYYQ 4Y28J 1HGVA 5CJ0A 3OA7A 1YJNP 3E1IC 2YO3A 2OTKE 2E76B 1HBWA 4KT0J 2OYIA 1NTMD 1NTKJ 2POHA 2FFDC 2H8PD 2KYVA 1AJYA 5CHXA 1NTME 2QG4A 1FZAA 1LT1A 1NU1J 4D6TD 3VYIA 1FZFC 1PP9G 2XNXB 1GTWA 3H1HJ 5KLVD 3KDPB 3CC2P 2WPVB 5B66E 2HLOA 1M90Q 2B87B 1BE3J 4NYTA 4U7JA 2Y0EA 3OJAB 1DD3A 5AVSB 1USDA 1BGYG 1EZVI 1FZEA 2QJKB 3CCEP 3H1LG 4D6TE 4TLFA 2HLOC 2DW3A 3V6IA 2BEQD 2IBZI 2KOGA 3RK2D 4IL6E 2NZ2A 3P8CE 3Q5SA 4GOEA 2NPSD 2NPSB 2IFMA 1A02F 1HF9A 2J0HA 1QL2A 1SQXK 1JTHA 1J1DC 1KB9E 2OTJP 3HE4B 2Q1KA 3IR9A 4H44C 3L70J 3HE5A 2QM7A 3L74G 5CJ4A 2OYHB 4O9BA 2PP6A 1JO5A 4N6JA 2RKLA 1T6AA 3L71E 1N86B 3H1IE 1NWQA 3QH9A 2W8ZA 4DCKA 2PGDA 3Q3DA 1SQPG 3WU2E 3IFMA 1IK7A 3IN6A 1K9MQ 2E5TA 4A7PA 2HPCA 1J1EC 4YPCA 2FKWB 3W67A 5AW0B 4YTPC 2KB7P 1RY3A 2IPPA 3L72D 2B89A 5AW9B 2E42A 1KILD 3HTKB 3CX5E 3HD7B 3HD7D 5B5EE 3JCUE 2FYZA 3L72E 5TISE 1L0NG 4IFDK 1AFOA 1PGJA 2D2CB 2Q7CA 2QJYC 1DX7A 4PV1B 1QVGO 4WB4A 4RKUJ 2W27A 1KYOE 1N7LA 2WT7B 3U1CA 3B5NA 3L4FA 2J3FA 2Q9IC 2QA4P 1FOSF 2JDIH 5AVTB 5AVVB 1NTMG 1KORA 1RF0C 4N78E 4M7HA 4GOFA 1ZLLA 4RO0A 1S1CX 2A45H 3TF5A 3HUSC 3P8MC 2A06G 4I7ZC 4QMAA 1SQVE 3TGUE 2ZYGA 1YHQP 3PHLA 4H13C 4UB8H 1OIPA 3TNUA 2Z4EC 1N73C 2R44A 3A3YB 3M9BA 1A02J 1LTIC 3KHUA 1LP1B 1Z3SA 2ITAA 1M7LA 4R4MA 2GUVA 4I1LA 1NKZB 1JY3O 2V4HA 1K8AQ 3RK3E 3H1IJ 2KS1A 1YQ4C 4PD4D 3HUSB 3T97A 2J61A 2WSCJ 2A45G 5DJTB 4ASVA 3L74D 1GW4A 2WSEH 1SQXG 2D2CC 2Y0CA 1EC5A 3NTNA 2I1JA 1RE4A 3MTUE 4DJGA 2OARA 4HH2A 1IFPA 3JSVC 2KIKA 5BU5A 1BE3G 1KYOD 1SQPJ 3AE1C 3BVHC 2N9BA 1CSBA 2G3AA 1IFNA 1RF0B 1WRGA 2N1TD 1N73A 1HUCA 1LTJC 2H88C 3CCJP 3A5TA 2XZRA 3PH0A 2OYOA 3AECC 3WUVA 4JZCA 1FIDA 3HE5B 2YIUC 1LT9C 1RF1B 2I8DA 1JY3P 3RK3C 2XKMA 1VQ4P 1VQKP 5KKZB 2K9JA 3CPWO 1Q81Q 4BWNA 2E76D 1BDCA 1FE6A 2C0WA 2E76C 1Y8AA 2RH0A 3P8CD 2KUBA 1U7MA 3KPEA 1JC9A 5KAIH 3M06A 2JR8A 1NTMK 1SQVJ 3TGUJ 1PV3A 3L37A 2WSFJ 3HD7A 4AQRD 2CK3H 2PRRA 3O8ZA 4HYTB 1IZNB 2A06E 1NTKD 1YTZT 2WQYC 4KJMA 5BVZA 3CX5H 3H1KD 5TJHA 3L71J 2H43C 3RL0g 2AXTH 1SQXD 3MUDC 1M1JC 2BCCD 1IFDA 3FX0A 2JJLA 5AW3B 1FZFB 1KYOI 2D39A 2IDBA 2OQQA 4OWFA 3L72J 3SSUA 1X8YA 1KZUB 1NKNA 2R32A 1P84I 3H1ID 3B4SA 3CX5I 4H0LC 1KB9H 4CPGA 1SQXE 2N1TB 3V4QA 3G3ZA 2Y9YA 5AVYB 1JMMA 1QLED 1UIXA 5APXA 1SQXJ 1ZN5A 5KLVK 3L73D 3EFFK 3H32B 5AW7B 2QSIA 1BSHA 5CBNA 4W7YA 4M7FA 2M5AB 5KKZC 3V2QA 2ZXXA 1VF5D 1VF5B 2NPSC 1U57A 1JY2O 4H0LD 1AVOA 2LKMA 3AE2C 1GL2C 1EZVG 3HRNA 1BCCJ 4OGQC 2ZAEB 5APSA 4OGQB 1M57D 4U3FJ 1ZOYC 4LLHA 3M91A 3GF3A 2W6BA 2E74D 1RE3C 5AW8B 1RHZB 1PFIA 3KQGA 5K5GB 3AEDC 2HODC 3V5BA 2J58A 1VQ6P 1JCDA 1FDOA 1GU4A 4HJGH 1SQBE 2H7HA 1SP4A 4PJ0H 1PGOA 1URQB 1H89A 1FZAC 2YXQB 3CWBE 1G2CA 1OVVA 4GIFA 1FBMA 1CW5A 5KLIC 1KILB 1Q7YQ 1AVYA 3AEEC 5CCHC 3BATA 3BCCD 1E79H 5KJ7A 2XNXC 2VRSA 4C7NB 1BGYE 3S1KA 3H1JJ 3L35A 3R2PA 1RF1C 2WTYA 3H1JE 1VQ9P 3VMZA 1S9KE 2FYUD 1NHLA 5APTA 1N7SA 3FIBA 2O3JA 4R9JA 2QE7H 4NPFX 3C8VA 4ZFGA 2JP3A 1DH3A 5GTHH 4U3FG 1FZBB 2ZVOB 1N86A 1CZQA 3RBZA 3G4SP 2Z4EA 3G71P 2FYUJ 5KLVG 3M0AA 5AVZB 1X9VA 4N78D 4HB1A 1P84H 1FZDA 2YO2A 1EDKA 1VQ5P 1PPJD 1OFCX 1NU1D 3A2AA 2JHLF 1YJ9P 2QJYB 3L75G 4UB8E 2Y9ZA 2YXRB 2J1GA 1Q90D 3LW5H 1FZCA 1JCCA 3W68A 5AVUB 1JEKA 2AEFA 3V2PA 1VQLP 1EXIA 2FXPA 1J1EB 2B9BA 1KILE 4C46A 1GMJA 1VQMP 1R5LA 1EDLA 2FYNB 1NU1E 1LT9A 1JY2N 4JQ0D 1IO4A 2LXBA 1DEEG 3HTKA 1NJIQ 2J64A 2AEMA 1SQBD 1UIIA 4I7ZB 1KFNA 1MUUA 1OVRA 3FWNA 1L0LE 3B71A 2C9NY 4U3FD 4IOIH 3D6ZA 3I56P 4M3LA 3TGUG 3IF4A 1WT6A 4EI2A 2P10A 4LGDE 2Q5UA 1KB9I 1JB0J 1IK9A 3QWOC 2HODA 2CPBA 2KSJA 1BDDA 2E74C 1LTGC 1EDIA 4H44D 1KQGB 2B88A 2J61B 1G1JA 3TYYA 4NPDA 1XTCC 3H1JG 3FGAD 3HD7C 2YKOA 5APVA 1W2BO 1KILA 3L73E 4GT1A 3TNUB 1P84D 1VQNP 1BCCG 2BCCJ 2W6JH 2YMKA 4L74A 1KC8Q 5KLVE 1L0LD 1K73Q 3CXHI 1NOHA 1N73B 2XNDH 3TK1A 1SFCB 1YIJP 1KV4A 1BSNA 4YXDC 4D6TJ 1N7SB 1JY2P 2M3BA 3M0DA 3RL0B 1FZCC 4DZOA 3NXSA 3D6YA 1J1DB 3KZIH 1KN7A 5L8RJ 3CC7P 5GTIE 2R3SA 1R5SA 1RE3B 2I1KA 2J0GA 1BGYJ 3SFDC 2Z4EB 1L4AA 1JNMA 5AW1B 3IAOA 2W90A 1GZLA 2WPSA 3L70E 4DT0A 2OYIB 5TISH 2W6AA 4WBAA 2ZFCA 1NTKE 1Y47A 3CWBD 2JEEA 1SVFA 1Z56A 3A7OA 4JYOX 1W2EA 2KXPB 2YKQA 2GUSA 4I6MC 4NPEA 4AYCA 3VN0A 2FIBA 1CI6B 1N86C 3H1HD 1L0LJ 1WMKA 3CI9A 3KYQA 2ZJSE 4L73A 1U7JA 2HLOB 3FWLA 5CCGC 2JKVA 4RESB 4RJTA 1GL2A 3AEAC 2BEZF 1RF1A 1VQOP 2IYPA 1NTMJ 2M8RA 1FZFA 2L91A 1X0TA 1Q82Q 4K3AA 1VQ7P 2ZXEB 2J0YA 2FFDB 1K05A 3E7KA 3RL0C 3E1IA 3JC22 3R4YA 4XE5B 1T2KD 1PP9J 1PIXA 1BE3E 4N3YB 2IZ1A 3CMEP 1SFCC 1M1KQ 4ZKPA 3M9QA 2FBWC 1PPJE 3BCCG 1LGHB 2D2CD 2N1TA 1S5LE 1Z3UA 1KYOH 1LWUB 4H0LB 3GG2A 3EFGA 5KAIE 3AE5C 5APWA 3RK2B 1S3JA 1SQBJ 1JUNA 3CXHH 2RN0A 3TSIA 2HODB 2HG5D 5AVXB 4W7ZA 1VL2A 1HTLC 2E75C 4AUWA 1GU5A 3A0BH 1GD2E 1SFCD 2M3EA 2W83C 2JHMF 4WY4B 1QGKB 4OH8B 4GKGA 3H1JD 4PD4E 3RL0D 3H1HE 1IFMA 2E43A 4EPUA 1ZRTD 2R5BA 5AW4B 2YNYA 5EFWB 1Q86Q 2QJPB 3GHGC 3RK3B 4R9TA 2C9LY 1VF5C 4UB6E 2JHHC 1SQVK 3VMAA 2QVAA 3L75J 1EZVD 1L0NE 1NTZJ 1MZ9A 3JCUH 2V7QH 5CCGA 2OYIC 2J3GA 3WUTA 1MKMA 4ZNCA 1SLQA 4D6TG 2KLVA 3MD0A 1QL1A 2Z5HA 1SQQK 2QIWA 5H2FE 4TT3H 3L36A 4XFJA 1L4AB 3LW5J 4PJ0E 2H43A 1OW8A 5M1BA 2FY8A 2HPCC 2O01N 2E5YA 1HJBA 1LTBC 2ZT9D 5KAFE 3UIAA 3BVHB 4Z1MH 3C1LA 1JTHB 3L71G 2GA1A 2O01J 1YITP 1T8ZA 1EQ7A 3HUSA 3CCSP 3T97B 1GL2B 3CCVP 2XU6A 4YXWH 1PPJG 1FZBA 2LR2A 4HKZH 2WWWA 3V2NA 2P1JA 3L71D 2QEXP 5DJUB 2J5UA 3H1KJ 3VMXA 3TDKA 2Q9IA 1LTAC 1E5WA 2K3RA 3PLNA 5GTHE 2O1JA 3G9RA 4C7RA 3E1IB 1S4XA 1QEXA 1IC2A 5E79E 1SQVD 4OVNF 1OVUA 1ZV8A 1P84E 1FZEC 1PL5A 1YYCA 1KFMA 1N2DC 2IBZG 1RQUA 3MHVA 1KQFB 2MJZA 3F89A 4XA4A 1HGZA 1FZCB 3AE8C 4JYBA 5APUA 1URQD 1NGMB 1OWAA 2FXOA 1N8RQ 2WSSH 2WMMA 2JHKF 4H44B 3B5NB 3VP8A 2FYNC 3FXEA 2PAJA 1KD1Q 2O01H 1SQVG 1H8AA 2K9JB 3NMDA 3II6A 1FZBC 2OTLP 2J60A 1ZW0A 4W80A 2H89C 2FXMA 3GLMA 2K88A 1T2KC 1SQPD 3L75D 3CCRP 2E75D 2QJKC 1S72P 3CLQA 3N4XA 3MZWB 1SQQG 4IFFA 1TU3F 3GHGA 1AQ5A 1KB9D 4IL6H 2XDJA 5CCGD 3CCUP 2KLUA 2KS1B 3OAKA 4U3FE 1BCCD 3P32A 2AEJA 2IX7C 2LXCB 5AVRB 1JMBA 4DOJA 3OW2O 1KQSO 4EOTA 2V7QJ 1LT9B 1S5LX 1X79B 3S4RA 4JYCA 3GF7A 1RE4B 5CCHD 4GODA 1FICA 4H13B 2QRXA 3AE6C 3BASA 1KILC 1USEA 2L5GB 5B66H 1GDTA 3L75E 5AVWB 1IFIA 2RMZA 2KNCA 1HH0A 1FZAB 4R4LA 3GMAA 1FAVA 4BXLA 3TGUD 2J59M 1FC2C 3AE9C 3MIWA 3L74E 1R8EA 3VP9A 5CBOA 5KLIB 1ZR2A 2B87A 3RGUA 3Q5PA 1QX8A 3C9IA 2K9YA 1M8OB 2E75B 4WY4D 3S9OA 4Y99B 1FZGC 1M1JA 3EWKA 2UWJE 2O1KA 5AW5B 2Q9IB 1DD4A 2WPRA 1S5LH 3M9HA 2IBZD 3VOPA 1AV1A 1Q2NA 1OZHA 1IFJA 4H13D 2R5DA 3H6PA 1PP9E 3NFQA 3AE7C 1GW3A 1LWUC 3ZDMA 1NTZK 3U59A 1MFZA 5KLVJ 3L72G 4B86A 2SPZA 1JOCA
chains in the Genus database with same CATH topology
2ZXEB 2XNXA 1HVVA 5KJ7C 2J0YA 5APXA 2FFDB 1FIBA 3M0DC 3MUDA 1GK6A 1ZN5A 3CL3D 5KLVK 1HGVA 3RL0C 3E1IA 5CJ0A 3OA7A 3H32B 3E1IC 3PP5A 4XE5B 5AW7B 1FJKA 3V2RA 1T2KD 1URQA 2YO3A 1FJPA 4N3YB 2WSFH 4W7YA 1HBWA 2YKPA 2OYIA 1SFCC 4M7FA 2POHA 4ZKPA 2J3FD 2FFDC 2A45I 3V2QA 3M9QA 2H8PD 2KYVA 1G2CB 5CHXA 1LGHB 2NPSC 2N1TA 1FZAA 3LIEA 1Z3UA 1LWUB 1JY2O 2LKMA 3HRNA 3VYIA 1GL2C 1FZFC 2XNXB 1GTWA 3EFGA 3KDPB 5APSA 1OXZA 2HLOA 5APWA 3RK2B 3H32C 4C7NA 1XTGB 1JUNA 4LLHA 3TSIA 2HODB 3M91A 4NYTA 2HG5D 5AVXB 4W7ZA 1T3JA 1FZGB 1FU1A 1HTLC 2W6BA 5APYA 2J3OA 4AUWA 1GU5A 1RE3C 3OJAB 5AVSB 5AW8B 1CI6A 1GD2E 1NO4A 1PFIA 3KQGA 1SFCD 1FZEA 2HODC 2FYUK 3V5BA 2JHMF 4WY4B 2IFNA 2J58A 2OYHA 4OH8B 1JCDA 4GKGA 3RL0D 1GU4A 1IFMA 2H7HA 2E43A 2GY7A 1SP4A 4EPUA 3N7NA 2HLOC 2WSCH 2R5BA 1URQB 5AW4B 3SWYA 2YNYA 2KOGA 2J2PA 3RK2D 1H89A 1FZAC 3GHGC 3P8CE 1NAFA 3RK3B 4R9TA 2C9LY 2NPSD 2NPSB 3B8EB 2IFMA 1A02F 1G2CA 2JHHC 2FFDA 1DEBA 1SQVK 2J0HA 1QL2A 1SQXK 1JTHA 1J1DC 4GIFA 1FBMA 3HE4B 1MZ9A 1CW5A 3IR9A 1KILB 2P67A 1FOSE 5CCGA 2OYHC 3HE5A 2QM7A 2OYHB 5CJ4A 5CCHC 3BATA 2OYIC 1RE4C 4O9BA 1H88A 5CCHA 5KJ7A 2XNXC 2J3GA 2PP6A 3V4WA 1JO5A 2VRSA 4N6JA 4C7NB 3L35A 1N86B 4Y99C 1NWQA 4JF7A 1NU1K 3R2PA 1SLQA 4KHXA 1RF1C 3IFMA 2WTYA 2KLVA 3MD0A 2Z5IA 1QL1A 2JHIF 2Z5HA 1SQQK 3VMZA 2HPCA 1S9KE 3L36A 1J1EC 1L4AB 1NHLA 5APTA 2FKWB 1N7SA 5AW0B 3FIBA 4R9JA 2KB7P 1N7SC 2H43A 1RY3A 2IPPA 5AW9B 2E42A 1L0LK 1KILD 4ZFGA 1DH3A 3HTKB 1LTJB 3HD7B 1FZBB 3HD7D 2HPCC 2FYZA 1N86A 1CZQA 1HJBA 4IFDK 1LTBC 1AFOA 5KTBA 2Q7CA 2Z4EA 3UIAA 1VDFA 3VMYA 3BVHB 4WY4A 2Q3IA 1DX7A 1JTHB 2GM4A 3M0AA 5AVZB 1X9VA 1M1JB 4N78D 4WB4A 2W27A 1N7LA 2WT7B 1FZDA 3U1CA 3B5NA 1T8ZA 3L4FA 2H43B 2YO2A 1EQ7A 2J3FA 3HUSA 2Q9IC 1GL2D 1GL2B 1FOSF 5AVTB 1SQBK 2J5ZA 2XU6A 4I2LC 3A2AA 5AVVB 1FZBA 2JHLF 2WWWA 3V2NA 1RF0C 1VPCA 2P1JA 4N78E 4M7HA 3VMXA 1ZLLA 2J1GA 1RF0A 2A45H 1ZR4A 3LW5H 2P2UA 1JCCA 1FZCA 2CPSA 3HUSC 2Q9IA 3P8MC 3BVHA 5AVUB 3B5NC 1L4AD 3MGNA 3V2PA 1LTAC 1E5WA 1G1IA 2O1JA 4C7RA 3E1IB 1YTZI 1IC2A 3TNUA 1J1EB 2Z4EC 1N73C 4C46A 3A3YB 1ZV8A 3M9BA 1A02J 1LTIC 1FZEC 1YYCA 1Z3SA 1M7LA 1KFMA 1N2DC 2GUVA 5BU8B 4I1LA 1NKZB 2MJZA 1JY3O 4XA4A 1HGZA 1FZCB 4JYBA 5APUA 1LT9A 1URQD 1JY2N 1IO4A 1OWAA 3BRTB 3HTKA 3VTPC 2J64A 2JHKF 3B5NB 1KFNA 1MUUA 3HUSB 3VP8A 3T97A 2J61A 2C9NY 2A45G 2PAJA 2YMYA 2O01H 1FZGA 4M3LA 1GW4A 2WSEH 1KQLA 1H8AA 3NMDA 1WT6A 3II6A 4LGDE 1SFCA 1FZBC 3NTNA 2Q5UA 2I1JA 1RE4A 2HYNA 3MTUE 1NTKK 2J60A 1URQC 1J2JB 4W80A 2FXMA 2OARA 4HH2A 1IK9A 1T2KC 3U1AA 5BU5A 5AW2B 2HODA 2CPBA 2KSJA 2WITA 3BVHC 2N9BA 1LTGC 3CLQA 1CSBA 1RE3A 3N4XA 2J61B 1G1JA 1IFNA 3P7KA 3TYYA 2HFED 1FZEB 1RF0B 1XTCC 1WRGA 4IFFA 2N1TD 1N73A 1HUCA 2XV5A 1LTJC 3HD7C 3WMM0 3GHGA 3A5TA 2XZRA 2YKOA 5AVQB 1AQ5A 2WPQA 5APVA 3RK2C 1KILA 2XDJA 5CCGD 5CMZA 4JZCA 4GT1A 3TNUB 1FIDA 3HE5B 3OAKA 1LT9C 3P32A 2IX7C 3LIDA 3SWFA 5AVRB 2NPSA 2QM8A 4DOJA 1RF1B 1S9KD 4EOTA 1JY3P 3RK3C 1FDMA 2XKMA 3HE4A 1NOHA 3RK3D 1MV8A 1N73B 1LT9B 1X79B 3TK1A 4JYCA 1SFCB 1RE4B 2BASA 2C0WA 5CCHD 1FICA 3P8CD 1N7SB 1JY2P 5KJ7D 2M3BA 3BASA 3KPEA 1KILC 3M0DA 1JC9A 1L4AC 3RL0B 1FZCC 4DZOA 3M06A 3NXSA 2L5GB 1NTMK 1J1DB 1NH4A 1HWTC 3L37A 1JY3N 1GDTA 3EQ2A 4ZKUA 1LTJA 3HD7A 5AVWB 4AQRD 3BRVB 1IFIA 3O8ZA 4HYTB 1RE3B 2I1KA 2J0GA 2N1TC 1HH0A 2HPCB 1FZAB 2Z4EB 1L4AA 1JNMA 1YTZT 5AW1B 5BVZA 1IJDB 1FAVA 1GK4A 2H43C 1LTTC 1GZLA 2WPSA 2OYIB 2W6AA 4WBAA 2J59M 2ZFCA 3MIWA 2R3CA 4WY4C 1M1JC 3I5CA 3VP9A 1IFDA 2JEEA 4EIJA 2JJLA 1ZR2A 5AW3B 1FZFB 1SVFA 1Z56A 3A7OA 4JYOX 2J3UA 3C9IA 2D39A 1W2EA 2YKQA 2GUSA 4I6MC 4AYCA 4IFMA 1LWUA 3VN0A 1LTSC 4WY4D 2FIBA 4Y99B 2WNPF 1SQPK 1CI6B 3GHGB 1N86C 1FZGC 1M1JA 3CI9A 3H32A 2O1KA 3KYQA 5AW5B 2Q9IB 2WPRA 5AW6B 1X8YA 3M9HA 2WT7A 2HLOB 3B5ND 3VOPA 1KZUB 1NKNA 1T3UA 2R32A 5CCGC 1IFJA 1N7SD 2R5DA 4RESB 1GL2A 3H6PA 2KP8A 3NFQA 1GW3A 2C0XA 1LWUC 1RF1A 2WZ7A 2M8RA 1FZFA 2N1TB 1NTZK 3U59A 3V4QA 1MFZA 2P7JA 3G3ZA 4LC1A 1L0NK 4B86A 5APQA 5AVYB 1JOCA 1JMMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XNX A;  2J0Y A;  2FFD B;  1RF1 B;  1FIB A;  2OYH C;  2OYH B;  2Z4E C;  1N73 C;  2OYI C;  1RE4 C;  1JY3 P;  3E1I A;  3H32 B;  2XNX C;  3E1I C;  2J3G A;  1FZE C;  1N73 B;  1LT9 B;  1Z3S A;  1N86 B;  2OYI A;  1RE4 B;  4M7F A;  2J3F D;  1JY3 O;  1FZC B;  1FIC A;  2FFD C;  1RF1 C;  1JY2 P;  2A45 I;  1LT9 A;  2JHI F;  1JC9 A;  1JY2 N;  1FZC C;  2HPC A;  1FZA A;  1JY3 N;  1Z3U A;  2J64 A;  1LTJ A;  2JHK F;  1LWU B;  3FIB A;  4R9J A;  2H43 A;  1JY2 O;  1FZF C;  2XNX B;  3HUS B;  1RE3 B;  2J0G A;  2J61 A;  4ZFG A;  2A45 G;  2HPC B;  1FZA B;  1FZG A;  2Z4E B;  1LTJ B;  1FZB B;  2HLO A;  2HPC C;  3H32 C;  1N86 A;  2H43 C;  2OYI B;  1FZB C;  1RE4 A;  2HOD B;  4NYT A;  2Z4E A;  1FZG B;  2J60 A;  2J3O A;  3BVH B;  1M1J C;  1RE3 C;  1FZF B;  1M1J B;  4JYO X;  1FZE A;  2HOD A;  2J3U A;  2D39 A;  1W2E A;  2HOD C;  1FZD A;  1LWU A;  2JHM F;  2H43 B;  3BVH C;  2J3F A;  2FIB A;  2OYH A;  3HUS A;  2WNP F;  1FZG C;  1N86 C;  3GHG B;  1RE3 A;  2Q9I C;  2J61 B;  1M1J A;  2J5Z A;  1FZE B;  1RF0 B;  2GY7 A;  4EPU A;  3H32 A;  2Q9I B;  2HLO C;  1FZB A;  1N73 A;  2HLO B;  2JHL F;  1LTJ C;  1T3U A;  1RF0 C;  3GHG A;  2J2P A;  1FZA C;  4M7H A;  3GHG C;  2J1G A;  1RF0 A;  2A45 H;  1FZC A;  3HUS C;  2Q9I A;  4R9T A;  3BVH A;  1LWU C;  4JZC A;  2JHH C;  1RF1 A;  2FFD A;  2J0H A;  1FID A;  1FZF A;  1LT9 C;  3E1I B; 
#chains in the Genus database with same CATH topology
 2XNX A;  1HVV A;  2KI7 B;  5KJ7 C;  1FIB A;  3M0D C;  1GK6 A;  3CL3 D;  2IYO A;  3PP5 A;  1FJK A;  3V2R A;  1NTZ D;  1URQ A;  3PJS K;  1FJP A;  2WSF H;  2YKP A;  2KSE A;  2J3F D;  1LJ2 A;  3H1L E;  2A45 I;  1D7M A;  1YJW P;  4PD4 H;  1G2C B;  1SQQ E;  3LIE A;  1KTM A;  1ZP0 C;  1OX3 A;  3H1K G;  1H0T A;  1DIP A;  1OXZ A;  3H32 C;  4C7N A;  1XTG B;  2NRG A;  1FZG B;  1T3J A;  4JBZ A;  1FU1 A;  4GDO A;  2AXT E;  5APY A;  2J3O A;  1CI6 A;  1NO4 A;  3H1L D;  2FYU K;  3ITK A;  3O6Q A;  3KXD A;  2KZI A;  2IFN A;  1FDI A;  2OYH A;  1SQP E;  5GTI H;  3Q2Y A;  2WSE J;  2GY7 A;  4UB6 H;  3N7N A;  2WSC H;  1QVF O;  2ZT9 C;  3SWY A;  1BE3 D;  3WUU A;  2J2P A;  3L70 D;  1L2P A;  3SWK A;  1NAF A;  3AEG C;  2BCC E;  3B8E B;  2FFD A;  1DEB A;  2ZVN B;  2AXC A;  3AEF C;  1NVO A;  1PP9 D;  5KAF H;  2YIU B;  2P67 A;  1FOS E;  2OYH C;  1NYH A;  1RE4 C;  1H88 A;  5CCH A;  4BRY B;  3ABV C;  3V4W A;  4Y99 C;  4JF7 A;  1NU1 K;  4KHX A;  4PD4 I;  3Q5R A;  1RH5 B;  2Z5I A;  4L75 A;  2JHI F;  1KMI Z;  1VQ8 P;  4L76 A;  1N7S C;  3K5B A;  2KK7 A;  3CCM P;  1L0L K;  2Q3E A;  3E1R A;  3CWB G;  1LTJ B;  2KZJ A;  1AA0 A;  1NTZ G;  1X22 A;  3F5H A;  5KTB A;  1OW6 A;  3CX5 D;  3VMY A;  1SQQ J;  1VDF A;  1PGP A;  2WVR A;  2G8Y A;  1FS0 E;  4WY4 A;  4ZMD A;  2Q3I A;  2GM4 A;  1M1J B;  3D71 A;  3WU2 H;  4OGQ D;  2H43 B;  1GL2 D;  1SQB K;  2J5Z A;  4I2L C;  3BCC E;  1JM0 A;  1LP1 A;  3A0H H;  3AE4 C;  1VPC A;  3FXD A;  4PV1 D;  3RBX A;  1RF0 A;  1ZR4 A;  2P2U A;  3H1K E;  1SS1 A;  2CPS A;  3L74 J;  3BVH A;  3Q1M A;  3B5N C;  1L4A D;  3MGN A;  1Y9B A;  3CXH D;  1G1I A;  2A06 D;  1HJ0 A;  1PGQ A;  1YTZ I;  4IL6 X;  2K1A A;  4WWI A;  5BU8 B;  2FYU G;  3I55 P;  3H1H G;  3SFE C;  4JPZ B;  1H0T B;  3BRT B;  3VTP C;  5C39 A;  1W5C E;  3CCQ P;  2K37 A;  2OGU A;  2BCC G;  3CD6 P;  1ZME C;  2YMY A;  1FZG A;  1KQL A;  2M0B A;  1EDJ A;  1YQ3 C;  2JWA A;  1S2E A;  1SFC A;  1AQT A;  2HYN A;  2JWD A;  1NTK K;  1VQP P;  1URQ C;  1J2J B;  4ASW A;  3O6Q B;  4MN4 C;  5E79 H;  1OW7 A;  5B5E H;  3U1A A;  5AW2 B;  2PFX A;  3A0B E;  2WIT A;  2IBZ E;  1ZRT E;  1NU1 G;  1RE3 A;  3P7K A;  2HFE D;  1MFT A;  1FZE B;  2N9Y B;  3CC4 P;  2XV5 A;  3CMA P;  1SQQ D;  3WMM 0;  2Q6Q A;  3KZI E;  5AVQ B;  1PZQ A;  2WPQ A;  1L0L G;  3RK2 C;  1NAY A;  5CMZ A;  1M56 D;  1L0N J;  1NTZ E;  4K35 A;  4BRY A;  3CCL P;  3LID A;  3SWF A;  2P58 A;  3L70 G;  2NPS A;  2QM8 A;  1S9K D;  2ZYD A;  1FDM A;  3HE4 A;  3RK3 D;  1MV8 A;  2HR3 A;  3G6E P;  2BAS A;  1YI2 P;  1EXJ A;  2ZYA A;  1BGY D;  5KJ7 D;  1ZXG A;  5H2F H;  1SQB G;  3AE3 C;  1L4A C;  2Y0D A;  1NH4 A;  1HWT C;  1JY3 N;  1LNQ A;  3EQ2 A;  4ZKU A;  1LTJ A;  3BRV B;  3GW6 A;  3USS A;  1K04 A;  2E74 B;  2N1T C;  3L73 G;  2HPC B;  2QJP C;  2JO1 A;  1IJD B;  1RQV A;  1GK4 A;  1LTT C;  1BCC E;  3PTZ A;  3MP7 B;  3L73 J;  2R3C A;  4WY4 C;  3I5C A;  4EIJ A;  3H25 A;  4WVZ A;  2J3U A;  3H1I G;  2FYU E;  4IFM A;  1LWU A;  1LTS C;  2WNP F;  1SQP K;  3GHG B;  2KNC B;  3H1L J;  4EDF A;  2ZT9 B;  3H32 A;  3AEB C;  5AW6 B;  2WT7 A;  3B5N D;  1T3U A;  3A0H E;  1N7S D;  1EZV E;  1L0N D;  4PV1 C;  2KP8 A;  2M5A A;  2C0X A;  2MKV A;  1YBK A;  3PRJ A;  2WZ7 A;  2IZ0 A;  2P7J A;  1OMI A;  4LC1 A;  1L0N K;  5APQ A;  3CWB J;  3CXH E;  3BCC J;  1NTK G;  3D70 A;  3MUD A;  4EYY Q;  4Y28 J;  1HGV A;  5CJ0 A;  3OA7 A;  1YJN P;  3E1I C;  2YO3 A;  2OTK E;  2E76 B;  1HBW A;  4KT0 J;  2OYI A;  1NTM D;  1NTK J;  2POH A;  2FFD C;  2H8P D;  2KYV A;  1AJY A;  5CHX A;  1NTM E;  2QG4 A;  1FZA A;  1LT1 A;  1NU1 J;  4D6T D;  3VYI A;  1FZF C;  1PP9 G;  2XNX B;  1GTW A;  3H1H J;  5KLV D;  3KDP B;  3CC2 P;  2WPV B;  5B66 E;  2HLO A;  1M90 Q;  2B87 B;  1BE3 J;  4NYT A;  4U7J A;  2Y0E A;  3OJA B;  1DD3 A;  5AVS B;  1USD A;  1BGY G;  1EZV I;  1FZE A;  2QJK B;  3CCE P;  3H1L G;  4D6T E;  4TLF A;  2HLO C;  2DW3 A;  3V6I A;  2BEQ D;  2IBZ I;  2KOG A;  3RK2 D;  4IL6 E;  2NZ2 A;  3P8C E;  3Q5S A;  4GOE A;  2NPS D;  2NPS B;  2IFM A;  1A02 F;  1HF9 A;  2J0H A;  1QL2 A;  1SQX K;  1JTH A;  1J1D C;  1KB9 E;  2OTJ P;  3HE4 B;  2Q1K A;  3IR9 A;  4H44 C;  3L70 J;  3HE5 A;  2QM7 A;  3L74 G;  5CJ4 A;  2OYH B;  4O9B A;  2PP6 A;  1JO5 A;  4N6J A;  2RKL A;  1T6A A;  3L71 E;  1N86 B;  3H1I E;  1NWQ A;  3QH9 A;  2W8Z A;  4DCK A;  2PGD A;  3Q3D A;  1SQP G;  3WU2 E;  3IFM A;  1IK7 A;  3IN6 A;  1K9M Q;  2E5T A;  4A7P A;  2HPC A;  1J1E C;  4YPC A;  2FKW B;  3W67 A;  5AW0 B;  4YTP C;  2KB7 P;  1RY3 A;  2IPP A;  3L72 D;  2B89 A;  5AW9 B;  2E42 A;  1KIL D;  3HTK B;  3CX5 E;  3HD7 B;  3HD7 D;  5B5E E;  3JCU E;  2FYZ A;  3L72 E;  5TIS E;  1L0N G;  4IFD K;  1AFO A;  1PGJ A;  2D2C B;  2Q7C A;  2QJY C;  1DX7 A;  4PV1 B;  1QVG O;  4WB4 A;  4RKU J;  2W27 A;  1KYO E;  1N7L A;  2WT7 B;  3U1C A;  3B5N A;  3L4F A;  2J3F A;  2Q9I C;  2QA4 P;  1FOS F;  2JDI H;  5AVT B;  5AVV B;  1NTM G;  1KOR A;  1RF0 C;  4N78 E;  4M7H A;  4GOF A;  1ZLL A;  4RO0 A;  1S1C X;  2A45 H;  3TF5 A;  3HUS C;  3P8M C;  2A06 G;  4I7Z C;  4QMA A;  1SQV E;  3TGU E;  2ZYG A;  1YHQ P;  3PHL A;  4H13 C;  4UB8 H;  1OIP A;  3TNU A;  2Z4E C;  1N73 C;  2R44 A;  3A3Y B;  3M9B A;  1A02 J;  1LTI C;  3KHU A;  1LP1 B;  1Z3S A;  2ITA A;  1M7L A;  4R4M A;  2GUV A;  4I1L A;  1NKZ B;  1JY3 O;  2V4H A;  1K8A Q;  3RK3 E;  3H1I J;  2KS1 A;  1YQ4 C;  4PD4 D;  3HUS B;  3T97 A;  2J61 A;  2WSC J;  2A45 G;  5DJT B;  4ASV A;  3L74 D;  1GW4 A;  2WSE H;  1SQX G;  2D2C C;  2Y0C A;  1EC5 A;  3NTN A;  2I1J A;  1RE4 A;  3MTU E;  4DJG A;  2OAR A;  4HH2 A;  1IFP A;  3JSV C;  2KIK A;  5BU5 A;  1BE3 G;  1KYO D;  1SQP J;  3AE1 C;  3BVH C;  2N9B A;  1CSB A;  2G3A A;  1IFN A;  1RF0 B;  1WRG A;  2N1T D;  1N73 A;  1HUC A;  1LTJ C;  2H88 C;  3CCJ P;  3A5T A;  2XZR A;  3PH0 A;  2OYO A;  3AEC C;  3WUV A;  4JZC A;  1FID A;  3HE5 B;  2YIU C;  1LT9 C;  1RF1 B;  2I8D A;  1JY3 P;  3RK3 C;  2XKM A;  1VQ4 P;  1VQK P;  5KKZ B;  2K9J A;  3CPW O;  1Q81 Q;  4BWN A;  2E76 D;  1BDC A;  1FE6 A;  2C0W A;  2E76 C;  1Y8A A;  2RH0 A;  3P8C D;  2KUB A;  1U7M A;  3KPE A;  1JC9 A;  5KAI H;  3M06 A;  2JR8 A;  1NTM K;  1SQV J;  3TGU J;  1PV3 A;  3L37 A;  2WSF J;  3HD7 A;  4AQR D;  2CK3 H;  2PRR A;  3O8Z A;  4HYT B;  1IZN B;  2A06 E;  1NTK D;  1YTZ T;  2WQY C;  4KJM A;  5BVZ A;  3CX5 H;  3H1K D;  5TJH A;  3L71 J;  2H43 C;  3RL0 g;  2AXT H;  1SQX D;  3MUD C;  1M1J C;  2BCC D;  1IFD A;  3FX0 A;  2JJL A;  5AW3 B;  1FZF B;  1KYO I;  2D39 A;  2IDB A;  2OQQ A;  4OWF A;  3L72 J;  3SSU A;  1X8Y A;  1KZU B;  1NKN A;  2R32 A;  1P84 I;  3H1I D;  3B4S A;  3CX5 I;  4H0L C;  1KB9 H;  4CPG A;  1SQX E;  2N1T B;  3V4Q A;  3G3Z A;  2Y9Y A;  5AVY B;  1JMM A;  1QLE D;  1UIX A;  5APX A;  1SQX J;  1ZN5 A;  5KLV K;  3L73 D;  3EFF K;  3H32 B;  5AW7 B;  2QSI A;  1BSH A;  5CBN A;  4W7Y A;  4M7F A;  2M5A B;  5KKZ C;  3V2Q A;  2ZXX A;  1VF5 D;  1VF5 B;  2NPS C;  1U57 A;  1JY2 O;  4H0L D;  1AVO A;  2LKM A;  3AE2 C;  1GL2 C;  1EZV G;  3HRN A;  1BCC J;  4OGQ C;  2ZAE B;  5APS A;  4OGQ B;  1M57 D;  4U3F J;  1ZOY C;  4LLH A;  3M91 A;  3GF3 A;  2W6B A;  2E74 D;  1RE3 C;  5AW8 B;  1RHZ B;  1PFI A;  3KQG A;  5K5G B;  3AED C;  2HOD C;  3V5B A;  2J58 A;  1VQ6 P;  1JCD A;  1FDO A;  1GU4 A;  4HJG H;  1SQB E;  2H7H A;  1SP4 A;  4PJ0 H;  1PGO A;  1URQ B;  1H89 A;  1FZA C;  2YXQ B;  3CWB E;  1G2C A;  1OVV A;  4GIF A;  1FBM A;  1CW5 A;  5KLI C;  1KIL B;  1Q7Y Q;  1AVY A;  3AEE C;  5CCH C;  3BAT A;  3BCC D;  1E79 H;  5KJ7 A;  2XNX C;  2VRS A;  4C7N B;  1BGY E;  3S1K A;  3H1J J;  3L35 A;  3R2P A;  1RF1 C;  2WTY A;  3H1J E;  1VQ9 P;  3VMZ A;  1S9K E;  2FYU D;  1NHL A;  5APT A;  1N7S A;  3FIB A;  2O3J A;  4R9J A;  2QE7 H;  4NPF X;  3C8V A;  4ZFG A;  2JP3 A;  1DH3 A;  5GTH H;  4U3F G;  1FZB B;  2ZVO B;  1N86 A;  1CZQ A;  3RBZ A;  3G4S P;  2Z4E A;  3G71 P;  2FYU J;  5KLV G;  3M0A A;  5AVZ B;  1X9V A;  4N78 D;  4HB1 A;  1P84 H;  1FZD A;  2YO2 A;  1EDK A;  1VQ5 P;  1PPJ D;  1OFC X;  1NU1 D;  3A2A A;  2JHL F;  1YJ9 P;  2QJY B;  3L75 G;  4UB8 E;  2Y9Z A;  2YXR B;  2J1G A;  1Q90 D;  3LW5 H;  1FZC A;  1JCC A;  3W68 A;  5AVU B;  1JEK A;  2AEF A;  3V2P A;  1VQL P;  1EXI A;  2FXP A;  1J1E B;  2B9B A;  1KIL E;  4C46 A;  1GMJ A;  1VQM P;  1R5L A;  1EDL A;  2FYN B;  1NU1 E;  1LT9 A;  1JY2 N;  4JQ0 D;  1IO4 A;  2LXB A;  1DEE G;  3HTK A;  1NJI Q;  2J64 A;  2AEM A;  1SQB D;  1UII A;  4I7Z B;  1KFN A;  1MUU A;  1OVR A;  3FWN A;  1L0L E;  3B71 A;  2C9N Y;  4U3F D;  4IOI H;  3D6Z A;  3I56 P;  4M3L A;  3TGU G;  3IF4 A;  1WT6 A;  4EI2 A;  2P10 A;  4LGD E;  2Q5U A;  1KB9 I;  1JB0 J;  1IK9 A;  3QWO C;  2HOD A;  2CPB A;  2KSJ A;  1BDD A;  2E74 C;  1LTG C;  1EDI A;  4H44 D;  1KQG B;  2B88 A;  2J61 B;  1G1J A;  3TYY A;  4NPD A;  1XTC C;  3H1J G;  3FGA D;  3HD7 C;  2YKO A;  5APV A;  1W2B O;  1KIL A;  3L73 E;  4GT1 A;  3TNU B;  1P84 D;  1VQN P;  1BCC G;  2BCC J;  2W6J H;  2YMK A;  4L74 A;  1KC8 Q;  5KLV E;  1L0L D;  1K73 Q;  3CXH I;  1NOH A;  1N73 B;  2XND H;  3TK1 A;  1SFC B;  1YIJ P;  1KV4 A;  1BSN A;  4YXD C;  4D6T J;  1N7S B;  1JY2 P;  2M3B A;  3M0D A;  3RL0 B;  1FZC C;  4DZO A;  3NXS A;  3D6Y A;  1J1D B;  3KZI H;  1KN7 A;  5L8R J;  3CC7 P;  5GTI E;  2R3S A;  1R5S A;  1RE3 B;  2I1K A;  2J0G A;  1BGY J;  3SFD C;  2Z4E B;  1L4A A;  1JNM A;  5AW1 B;  3IAO A;  2W90 A;  1GZL A;  2WPS A;  3L70 E;  4DT0 A;  2OYI B;  5TIS H;  2W6A A;  4WBA A;  2ZFC A;  1NTK E;  1Y47 A;  3CWB D;  2JEE A;  1SVF A;  1Z56 A;  3A7O A;  4JYO X;  1W2E A;  2KXP B;  2YKQ A;  2GUS A;  4I6M C;  4NPE A;  4AYC A;  3VN0 A;  2FIB A;  1CI6 B;  1N86 C;  3H1H D;  1L0L J;  1WMK A;  3CI9 A;  3KYQ A;  2ZJS E;  4L73 A;  1U7J A;  2HLO B;  3FWL A;  5CCG C;  2JKV A;  4RES B;  4RJT A;  1GL2 A;  3AEA C;  2BEZ F;  1RF1 A;  1VQO P;  2IYP A;  1NTM J;  2M8R A;  1FZF A;  2L91 A;  1X0T A;  1Q82 Q;  4K3A A;  1VQ7 P;  2ZXE B;  2J0Y A;  2FFD B;  1K05 A;  3E7K A;  3RL0 C;  3E1I A;  3JC2 2;  3R4Y A;  4XE5 B;  1T2K D;  1PP9 J;  1PIX A;  1BE3 E;  4N3Y B;  2IZ1 A;  3CME P;  1SFC C;  1M1K Q;  4ZKP A;  3M9Q A;  2FBW C;  1PPJ E;  3BCC G;  1LGH B;  2D2C D;  2N1T A;  1S5L E;  1Z3U A;  1KYO H;  1LWU B;  4H0L B;  3GG2 A;  3EFG A;  5KAI E;  3AE5 C;  5APW A;  3RK2 B;  1S3J A;  1SQB J;  1JUN A;  3CXH H;  2RN0 A;  3TSI A;  2HOD B;  2HG5 D;  5AVX B;  4W7Z A;  1VL2 A;  1HTL C;  2E75 C;  4AUW A;  1GU5 A;  3A0B H;  1GD2 E;  1SFC D;  2M3E A;  2W83 C;  2JHM F;  4WY4 B;  1QGK B;  4OH8 B;  4GKG A;  3H1J D;  4PD4 E;  3RL0 D;  3H1H E;  1IFM A;  2E43 A;  4EPU A;  1ZRT D;  2R5B A;  5AW4 B;  2YNY A;  5EFW B;  1Q86 Q;  2QJP B;  3GHG C;  3RK3 B;  4R9T A;  2C9L Y;  1VF5 C;  4UB6 E;  2JHH C;  1SQV K;  3VMA A;  2QVA A;  3L75 J;  1EZV D;  1L0N E;  1NTZ J;  1MZ9 A;  3JCU H;  2V7Q H;  5CCG A;  2OYI C;  2J3G A;  3WUT A;  1MKM A;  4ZNC A;  1SLQ A;  4D6T G;  2KLV A;  3MD0 A;  1QL1 A;  2Z5H A;  1SQQ K;  2QIW A;  5H2F E;  4TT3 H;  3L36 A;  4XFJ A;  1L4A B;  3LW5 J;  4PJ0 E;  2H43 A;  1OW8 A;  5M1B A;  2FY8 A;  2HPC C;  2O01 N;  2E5Y A;  1HJB A;  1LTB C;  2ZT9 D;  5KAF E;  3UIA A;  3BVH B;  4Z1M H;  3C1L A;  1JTH B;  3L71 G;  2GA1 A;  2O01 J;  1YIT P;  1T8Z A;  1EQ7 A;  3HUS A;  3CCS P;  3T97 B;  1GL2 B;  3CCV P;  2XU6 A;  4YXW H;  1PPJ G;  1FZB A;  2LR2 A;  4HKZ H;  2WWW A;  3V2N A;  2P1J A;  3L71 D;  2QEX P;  5DJU B;  2J5U A;  3H1K J;  3VMX A;  3TDK A;  2Q9I A;  1LTA C;  1E5W A;  2K3R A;  3PLN A;  5GTH E;  2O1J A;  3G9R A;  4C7R A;  3E1I B;  1S4X A;  1QEX A;  1IC2 A;  5E79 E;  1SQV D;  4OVN F;  1OVU A;  1ZV8 A;  1P84 E;  1FZE C;  1PL5 A;  1YYC A;  1KFM A;  1N2D C;  2IBZ G;  1RQU A;  3MHV A;  1KQF B;  2MJZ A;  3F89 A;  4XA4 A;  1HGZ A;  1FZC B;  3AE8 C;  4JYB A;  5APU A;  1URQ D;  1NGM B;  1OWA A;  2FXO A;  1N8R Q;  2WSS H;  2WMM A;  2JHK F;  4H44 B;  3B5N B;  3VP8 A;  2FYN C;  3FXE A;  2PAJ A;  1KD1 Q;  2O01 H;  1SQV G;  1H8A A;  2K9J B;  3NMD A;  3II6 A;  1FZB C;  2OTL P;  2J60 A;  1ZW0 A;  4W80 A;  2H89 C;  2FXM A;  3GLM A;  2K88 A;  1T2K C;  1SQP D;  3L75 D;  3CCR P;  2E75 D;  2QJK C;  1S72 P;  3CLQ A;  3N4X A;  3MZW B;  1SQQ G;  4IFF A;  1TU3 F;  3GHG A;  1AQ5 A;  1KB9 D;  4IL6 H;  2XDJ A;  5CCG D;  3CCU P;  2KLU A;  2KS1 B;  3OAK A;  4U3F E;  1BCC D;  3P32 A;  2AEJ A;  2IX7 C;  2LXC B;  5AVR B;  1JMB A;  4DOJ A;  3OW2 O;  1KQS O;  4EOT A;  2V7Q J;  1LT9 B;  1S5L X;  1X79 B;  3S4R A;  4JYC A;  3GF7 A;  1RE4 B;  5CCH D;  4GOD A;  1FIC A;  4H13 B;  2QRX A;  3AE6 C;  3BAS A;  1KIL C;  1USE A;  2L5G B;  5B66 H;  1GDT A;  3L75 E;  5AVW B;  1IFI A;  2RMZ A;  2KNC A;  1HH0 A;  1FZA B;  4R4L A;  3GMA A;  1FAV A;  4BXL A;  3TGU D;  2J59 M;  1FC2 C;  3AE9 C;  3MIW A;  3L74 E;  1R8E A;  3VP9 A;  5CBO A;  5KLI B;  1ZR2 A;  2B87 A;  3RGU A;  3Q5P A;  1QX8 A;  3C9I A;  2K9Y A;  1M8O B;  2E75 B;  4WY4 D;  3S9O A;  4Y99 B;  1FZG C;  1M1J A;  3EWK A;  2UWJ E;  2O1K A;  5AW5 B;  2Q9I B;  1DD4 A;  2WPR A;  1S5L H;  3M9H A;  2IBZ D;  3VOP A;  1AV1 A;  1Q2N A;  1OZH A;  1IFJ A;  4H13 D;  2R5D A;  3H6P A;  1PP9 E;  3NFQ A;  3AE7 C;  1GW3 A;  1LWU C;  3ZDM A;  1NTZ K;  3U59 A;  1MFZ A;  5KLV J;  3L72 G;  4B86 A;  2SPZ A;  1JOC A; 
#chains in the Genus database with same CATH homology
 2ZXE B;  2XNX A;  1HVV A;  5KJ7 C;  2J0Y A;  5APX A;  2FFD B;  1FIB A;  3M0D C;  3MUD A;  1GK6 A;  1ZN5 A;  3CL3 D;  5KLV K;  1HGV A;  3RL0 C;  3E1I A;  5CJ0 A;  3OA7 A;  3H32 B;  3E1I C;  3PP5 A;  4XE5 B;  5AW7 B;  1FJK A;  3V2R A;  1T2K D;  1URQ A;  2YO3 A;  1FJP A;  4N3Y B;  2WSF H;  4W7Y A;  1HBW A;  2YKP A;  2OYI A;  1SFC C;  4M7F A;  2POH A;  4ZKP A;  2J3F D;  2FFD C;  2A45 I;  3V2Q A;  3M9Q A;  2H8P D;  2KYV A;  1G2C B;  5CHX A;  1LGH B;  2NPS C;  2N1T A;  1FZA A;  3LIE A;  1Z3U A;  1LWU B;  1JY2 O;  2LKM A;  3HRN A;  3VYI A;  1GL2 C;  1FZF C;  2XNX B;  1GTW A;  3EFG A;  3KDP B;  5APS A;  1OXZ A;  2HLO A;  5APW A;  3RK2 B;  3H32 C;  4C7N A;  1XTG B;  1JUN A;  4LLH A;  3TSI A;  2HOD B;  3M91 A;  4NYT A;  2HG5 D;  5AVX B;  4W7Z A;  1T3J A;  1FZG B;  1FU1 A;  1HTL C;  2W6B A;  5APY A;  2J3O A;  4AUW A;  1GU5 A;  1RE3 C;  3OJA B;  5AVS B;  5AW8 B;  1CI6 A;  1GD2 E;  1NO4 A;  1PFI A;  3KQG A;  1SFC D;  1FZE A;  2HOD C;  2FYU K;  3V5B A;  2JHM F;  4WY4 B;  2IFN A;  2J58 A;  2OYH A;  4OH8 B;  1JCD A;  4GKG A;  3RL0 D;  1GU4 A;  1IFM A;  2H7H A;  2E43 A;  2GY7 A;  1SP4 A;  4EPU A;  3N7N A;  2HLO C;  2WSC H;  2R5B A;  1URQ B;  5AW4 B;  3SWY A;  2YNY A;  2KOG A;  2J2P A;  3RK2 D;  1H89 A;  1FZA C;  3GHG C;  3P8C E;  1NAF A;  3RK3 B;  4R9T A;  2C9L Y;  2NPS D;  2NPS B;  3B8E B;  2IFM A;  1A02 F;  1G2C A;  2JHH C;  2FFD A;  1DEB A;  1SQV K;  2J0H A;  1QL2 A;  1SQX K;  1JTH A;  1J1D C;  4GIF A;  1FBM A;  3HE4 B;  1MZ9 A;  1CW5 A;  3IR9 A;  1KIL B;  2P67 A;  1FOS E;  5CCG A;  2OYH C;  3HE5 A;  2QM7 A;  2OYH B;  5CJ4 A;  5CCH C;  3BAT A;  2OYI C;  1RE4 C;  4O9B A;  1H88 A;  5CCH A;  5KJ7 A;  2XNX C;  2J3G A;  2PP6 A;  3V4W A;  1JO5 A;  2VRS A;  4N6J A;  4C7N B;  3L35 A;  1N86 B;  4Y99 C;  1NWQ A;  4JF7 A;  1NU1 K;  3R2P A;  1SLQ A;  4KHX A;  1RF1 C;  3IFM A;  2WTY A;  2KLV A;  3MD0 A;  2Z5I A;  1QL1 A;  2JHI F;  2Z5H A;  1SQQ K;  3VMZ A;  2HPC A;  1S9K E;  3L36 A;  1J1E C;  1L4A B;  1NHL A;  5APT A;  2FKW B;  1N7S A;  5AW0 B;  3FIB A;  4R9J A;  2KB7 P;  1N7S C;  2H43 A;  1RY3 A;  2IPP A;  5AW9 B;  2E42 A;  1L0L K;  1KIL D;  4ZFG A;  1DH3 A;  3HTK B;  1LTJ B;  3HD7 B;  1FZB B;  3HD7 D;  2HPC C;  2FYZ A;  1N86 A;  1CZQ A;  1HJB A;  4IFD K;  1LTB C;  1AFO A;  5KTB A;  2Q7C A;  2Z4E A;  3UIA A;  1VDF A;  3VMY A;  3BVH B;  4WY4 A;  2Q3I A;  1DX7 A;  1JTH B;  2GM4 A;  3M0A A;  5AVZ B;  1X9V A;  1M1J B;  4N78 D;  4WB4 A;  2W27 A;  1N7L A;  2WT7 B;  1FZD A;  3U1C A;  3B5N A;  1T8Z A;  3L4F A;  2H43 B;  2YO2 A;  1EQ7 A;  2J3F A;  3HUS A;  2Q9I C;  1GL2 D;  1GL2 B;  1FOS F;  5AVT B;  1SQB K;  2J5Z A;  2XU6 A;  4I2L C;  3A2A A;  5AVV B;  1FZB A;  2JHL F;  2WWW A;  3V2N A;  1RF0 C;  1VPC A;  2P1J A;  4N78 E;  4M7H A;  3VMX A;  1ZLL A;  2J1G A;  1RF0 A;  2A45 H;  1ZR4 A;  3LW5 H;  2P2U A;  1JCC A;  1FZC A;  2CPS A;  3HUS C;  2Q9I A;  3P8M C;  3BVH A;  5AVU B;  3B5N C;  1L4A D;  3MGN A;  3V2P A;  1LTA C;  1E5W A;  1G1I A;  2O1J A;  4C7R A;  3E1I B;  1YTZ I;  1IC2 A;  3TNU A;  1J1E B;  2Z4E C;  1N73 C;  4C46 A;  3A3Y B;  1ZV8 A;  3M9B A;  1A02 J;  1LTI C;  1FZE C;  1YYC A;  1Z3S A;  1M7L A;  1KFM A;  1N2D C;  2GUV A;  5BU8 B;  4I1L A;  1NKZ B;  2MJZ A;  1JY3 O;  4XA4 A;  1HGZ A;  1FZC B;  4JYB A;  5APU A;  1LT9 A;  1URQ D;  1JY2 N;  1IO4 A;  1OWA A;  3BRT B;  3HTK A;  3VTP C;  2J64 A;  2JHK F;  3B5N B;  1KFN A;  1MUU A;  3HUS B;  3VP8 A;  3T97 A;  2J61 A;  2C9N Y;  2A45 G;  2PAJ A;  2YMY A;  2O01 H;  1FZG A;  4M3L A;  1GW4 A;  2WSE H;  1KQL A;  1H8A A;  3NMD A;  1WT6 A;  3II6 A;  4LGD E;  1SFC A;  1FZB C;  3NTN A;  2Q5U A;  2I1J A;  1RE4 A;  2HYN A;  3MTU E;  1NTK K;  2J60 A;  1URQ C;  1J2J B;  4W80 A;  2FXM A;  2OAR A;  4HH2 A;  1IK9 A;  1T2K C;  3U1A A;  5BU5 A;  5AW2 B;  2HOD A;  2CPB A;  2KSJ A;  2WIT A;  3BVH C;  2N9B A;  1LTG C;  3CLQ A;  1CSB A;  1RE3 A;  3N4X A;  2J61 B;  1G1J A;  1IFN A;  3P7K A;  3TYY A;  2HFE D;  1FZE B;  1RF0 B;  1XTC C;  1WRG A;  4IFF A;  2N1T D;  1N73 A;  1HUC A;  2XV5 A;  1LTJ C;  3HD7 C;  3WMM 0;  3GHG A;  3A5T A;  2XZR A;  2YKO A;  5AVQ B;  1AQ5 A;  2WPQ A;  5APV A;  3RK2 C;  1KIL A;  2XDJ A;  5CCG D;  5CMZ A;  4JZC A;  4GT1 A;  3TNU B;  1FID A;  3HE5 B;  3OAK A;  1LT9 C;  3P32 A;  2IX7 C;  3LID A;  3SWF A;  5AVR B;  2NPS A;  2QM8 A;  4DOJ A;  1RF1 B;  1S9K D;  4EOT A;  1JY3 P;  3RK3 C;  1FDM A;  2XKM A;  3HE4 A;  1NOH A;  3RK3 D;  1MV8 A;  1N73 B;  1LT9 B;  1X79 B;  3TK1 A;  4JYC A;  1SFC B;  1RE4 B;  2BAS A;  2C0W A;  5CCH D;  1FIC A;  3P8C D;  1N7S B;  1JY2 P;  5KJ7 D;  2M3B A;  3BAS A;  3KPE A;  1KIL C;  3M0D A;  1JC9 A;  1L4A C;  3RL0 B;  1FZC C;  4DZO A;  3M06 A;  3NXS A;  2L5G B;  1NTM K;  1J1D B;  1NH4 A;  1HWT C;  3L37 A;  1JY3 N;  1GDT A;  3EQ2 A;  4ZKU A;  1LTJ A;  3HD7 A;  5AVW B;  4AQR D;  3BRV B;  1IFI A;  3O8Z A;  4HYT B;  1RE3 B;  2I1K A;  2J0G A;  2N1T C;  1HH0 A;  2HPC B;  1FZA B;  2Z4E B;  1L4A A;  1JNM A;  1YTZ T;  5AW1 B;  5BVZ A;  1IJD B;  1FAV A;  1GK4 A;  2H43 C;  1LTT C;  1GZL A;  2WPS A;  2OYI B;  2W6A A;  4WBA A;  2J59 M;  2ZFC A;  3MIW A;  2R3C A;  4WY4 C;  1M1J C;  3I5C A;  3VP9 A;  1IFD A;  2JEE A;  4EIJ A;  2JJL A;  1ZR2 A;  5AW3 B;  1FZF B;  1SVF A;  1Z56 A;  3A7O A;  4JYO X;  2J3U A;  3C9I A;  2D39 A;  1W2E A;  2YKQ A;  2GUS A;  4I6M C;  4AYC A;  4IFM A;  1LWU A;  3VN0 A;  1LTS C;  4WY4 D;  2FIB A;  4Y99 B;  2WNP F;  1SQP K;  1CI6 B;  3GHG B;  1N86 C;  1FZG C;  1M1J A;  3CI9 A;  3H32 A;  2O1K A;  3KYQ A;  5AW5 B;  2Q9I B;  2WPR A;  5AW6 B;  1X8Y A;  3M9H A;  2WT7 A;  2HLO B;  3B5N D;  3VOP A;  1KZU B;  1NKN A;  1T3U A;  2R32 A;  5CCG C;  1IFJ A;  1N7S D;  2R5D A;  4RES B;  1GL2 A;  3H6P A;  2KP8 A;  3NFQ A;  1GW3 A;  2C0X A;  1LWU C;  1RF1 A;  2WZ7 A;  2M8R A;  1FZF A;  2N1T B;  1NTZ K;  3U59 A;  3V4Q A;  1MFZ A;  2P7J A;  3G3Z A;  4LC1 A;  1L0N K;  4B86 A;  5APQ A;  5AVY B;  1JOC A;  1JMM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...