2HPCB

Crystal structure of fragment d from human fibrinogen complexed with gly-pro-arg-pro-amide.
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
307
structure length
307
Chain Sequence
LYIDETVNSNIPTNLRVLRSILENLRSKIQKLESDVSAQMEYCRTPCTVSCNIPVVSGKECEEIIRKGGETSEMYLIQPDSSVKPYRVYCDMNTENGGWTVIQNRQDGSVDFGRKWDPYKQGFGNVATNTDGKNYCGLPGEYWLGNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGGFTVQNEANKYQISVNKYRGTAGNALMDGASQLMGENRTMTIHNGMFFSTYDRDNDGWLTSDPRKQCSKEDGGGWWYNRCHAANPNGRYYWGGQYTWDMAKHGTDDGVVWMNWKGSWYSMRKMSMKIRPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibrinogen alpha chain
molecule tags Blood clotting
total genus 66
structure length 307
sequence length 307
chains with identical sequence E, H, K
ec nomenclature
pdb deposition date 2006-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2hpcB01
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 2hpcB02
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 2hpcB03
1N86A 2J61B 4EPUA 2Q9IC 2HLOA 2HODB 1M1JC 3FIBA 2Z4EC 3HUSB 2FFDB 1FZBA 2J3UA 1RF1C 1JY3P 1RE3B 1RE4A 2J3OA 1FZAB 1FIDA 3GHGC 1T3UA 2H43A 2XNXA 1N86C 2FIBA 2HPCA 2OYHA 1M1JB 2Z4EB 1N73B 2H43C 1LT9B 1N86B 2XNXC 2FFDC 2HLOB 2OYHC 4R9JA 1FZFA 2WNPF 1FZAC 1FZBB 1RE4B 1FZEA 2H43B 2XNXB 1JY3O 1N73C 2HPCB 1JY2O 2OYHB 4ZFGA 2OYIA 1JY2P 1FZFC 1LT9C 1FIBA 3BVHA 1FZCA 1FZEC 2HLOC 2J2PA 1FZBC 1FICA 2OYIC 1RE4C 1RF0A 2J5ZA 1FZFB 2A45G 2JHMF 2D39A 1FZEB 3H32A 2HPCC 1FZCC 2A45I 4M7FA 2OYIB 4JYOX 1LWUA 1RF0C 2J3GA 1FZGA 3BVHB 1FZCB 1W2EA 4JZCA 2Q9IA 2JHIF 1RF0B 1Z3SA 4NYTA 3H32B 1Z3UA 1LTJA 1RF1A 2J3FD 2J1GA 2JHKF 3GHGA 1FZDA 3E1IA 2J0GA 3BVHC 1LWUB 1JC9A 1FZGB 1LTJC 2J61A 2JHLF 2HODA 1JY3N 3HUSA 3E1IC 1JY2N 2J0YA 2Q9IB 2J0HA 2FFDA 3H32C 1RE3A 1FZAA 2J60A 4R9TA 1LTJB 1RF1B 2J64A 4M7HA 1M1JA 2Z4EA 3GHGB 1LWUC 2HODC 2JHHC 3E1IB 2A45H 3HUSC 1N73A 1FZGC 1RE3C 2J3FA 2GY7A 1LT9A
chains in the Genus database with same CATH superfamily
3L71G 3QWOC 1M1JC 1DX7A 1SQPJ 2WSCJ 3GMAA 2J3OA 3L75J 2OTJP 3SSUA 5H2FH 1DIPA 4KHXA 4H13C 1IFPA 1YTZI 3B5NB 3VMYA 1OVRA 1N7LA 2NPSD 2YXQB 2WPSA 4H44C 1X79B 1LT9C 2BCCE 3CX5E 3OJAB 1CSBA 3AE5C 3FXEA 2WT7A 3H1LE 2OGUA 3HTKB 5KLVJ 1VQNP 3A5TA 2M5AA 5CJ0A 4TT3H 2W90A 3CCRP 3C8VA 4JYOX 1NTKK 2H89C 1LTIC 2HG5D 2PGDA 2B88A 1NTKE 3VN0A 2JHKF 5AW6B 5GTIH 1FJPA 2GUVA 1PPJG 2KSJA 4U3FE 1L4AA 2IZ1A 3V2PA 3TGUG 3CMAP 3C1LA 3CD6P 5APWA 2J0YA 3H1HE 2XDJA 2QG4A 3HUSC 1NU1K 1N73A 3IN6A 1HJ0A 1BGYJ 1L0NG 4I1LA 1FBMA 2HODB 1K73Q 5DJUB 1FDIA 5KKZB 1L0LJ 2B87B 5CCHA 1YJ9P 2A06G 1YBKA 1JTHB 3M0DC 2E74C 4C7NA 1N7SA 1BE3D 1R8EA 4WVZA 1IFMA 2AXCA 2ZYGA 2HFED 5CCGD 3CCMP 2NRGA 4IL6X 2XNXC 3HE5A 2HLOB 1KILC 2KLVA 1FZBB 1P84E 1DD4A 2KI7B 2FXOA 2WSFJ 1QX8A 4BXLA 1FZFC 1G2CA 1ZOYC 3WMM0 2JO1A 1YIJP 1ZRTD 3E7KA 1PPJD 2E76B 3E1RA 3MZWB 3TGUD 1NOHA 3RL0g 1NTME 1A02J 4EDFA 3K5BA 1W2EA 2BCCG 1BDDA 2WPQA 2Q9IA 1OW7A 2JHIF 1LTGC 1L0ND 2J1GA 1LTTC 3I55P 3A0BE 3A3YB 5CJ4A 4LC1A 3NTNA 1OX3A 2J61A 3VP9A 1NH4A 4GT1A 2O01J 1URQA 3VMAA 3RK2C 1QVGO 1M1JA 1J1DB 1NTKG 1AVYA 2J3FA 1GK4A 2E5YA 4U3FG 3BCCE 1OW8A 5AW0B 3FIBA 4IFMA 5TISE 2FYNB 2FFDB 1ZMEC 1RE4A 1FIDA 1KC8Q 3WUVA 2YIUC 1KQGB 4RKUJ 2YMKA 2E42A 1U57A 2P2UA 3AE2C 5CMZA 3JC22 5KAIE 5KLIB 1XTGB 4EIJA 1Q2NA 1AV1A 1NU1G 3RL0B 1JMBA 3CX5D 3FWLA 4L76A 3H1JJ 1K9MQ 1EZVD 3AECC 3H1LD 2KS1B 1SFCB 3MGNA 2N1TB 1ZP0C 3FXDA 2K3RA 2K1AA 1OVUA 1MZ9A 1RHZB 2K88A 2O1JA 3IF4A 1EXIA 4IL6E 2FXMA 1VDFA 1NTKD 2ZVOB 3TK1A 1S4XA 1SQXJ 2Q3IA 2J58A 3CCQP 4GKGA 3MTUE 5APXA 1PGQA 3S1KA 2M8RA 3L35A 4RESB 3HUSA 3H1HD 5KTBA 3WU2E 3H25A 1VQOP 2P7JA 3L72G 2AEMA 5AW7B 1RF1B 1EXJA 2LXCB 1RE3C 3M0DA 1WRGA 3LIEA 4BRYA 3PHLA 3PP5A 3GF3A 2XNXA 1KILA 1KTMA 1P84D 1FZFA 2WWWA 3U1CA 1OXZA 1FZAC 3SFDC 1SQQJ 2HPCB 5B5EE 1AQTA 3G4SP 3LW5J 1SVFA 1SQPE 1FICA 3CLQA 3L75E 1KZUB 3GF7A 4WY4D 1NTMD 2NPSA 2N9YB 3CXHE 4NPEA 4K35A 3FX0A 1S9KD 2IBZD 4UB8H 1SS1A 1GZLA 1SQBD 2QRXA 1Y8AA 5AW8B 3AEEC 1KB9E 2V7QH 4D6TJ 1MV8A 1PZQA 1BCCJ 4HB1A 1LWUB 1JC9A 4H0LB 2FYUD 2JWAA 2QJKC 4Y28J 2MKVA 2C9LY 1GDTA 3L73J 4HKZH 1VQ5P 3MUDC 3O6QB 2ZT9B 1K04A 5AVZB 2WPRA 3B8EB 3BCCD 4JF7A 4GOFA 1EZVI 2WTYA 2Z4EC 2WITA 1SP4A 2D2CD 1RH5B 5AVWB 1HGZA 1J1EC 1TU3F 3BATA 4OH8B 1U7JA 1S5LH 2E5TA 1Z56A 4I7ZC 1N73C 1USDA 3H1IJ 4JBZA 1DD3A 1R5SA 3WUUA 3CCSP 3HE4A 1VQLP 4IFFA 3D71A 3PH0A 3FWNA 3PJSK 3A0BH 2BEQD 5CCGA 1BSNA 1FZCC 2P1JA 4DJGA 4M7FA 2XU6A 2KUBA 1FC2C 1FZGA 1LTBC 1YQ4C 2KIKA 2W6BA 2K9JA 5AW5B 1NWQA 1NVOA 3GHGA 1ZLLA 4JYCA 1MKMA 3B5ND 2AXTE 1LTJC 3V2NA 1P84I 2YKPA 1H88A 3L37A 1L0NK 1RE3A 2Q3EA 3CWBD 5AW9B 1LT1A 4WB4A 4WY4C 5KAIH 3NFQA 1N8RQ 2Q9IC 3FGAD 3JCUE 1CI6A 4L73A 5BU5A 2M3EA 2I8DA 2YKQA 1KD1Q 3L74D 2R5BA 3EWKA 1GTWA 4BWNA 1LT9B 2IBZI 4RO0A 4ASVA 2WSEH 1OFCX 1URQC 4IFDK 5AW1B 2H43B 1QL2A 3GG2A 4KT0J 2OYHB 3RBXA 2QJPC 2E75C 4PD4D 4CPGA 3BVHA 1SQPD 2JP3A 1M56D 1JUNA 1RE4C 2D2CC 3L75D 1LTSC 2D39A 1FZEB 3D70A 2OYIB 3CXHD 3AEAC 3L4FA 3R2PA 5B66E 4JZCA 3PTZA 2XNDH 1RF0B 2QM7A 1KB9D 3RK3B 1JOCA 4UB6E 2B9BA 4NPFX 1BE3G 1EZVE 2RMZA 4HH2A 4KJMA 1VF5C 3TDKA 3MUDA 3ABVC 5E79E 5KLVD 1K8AQ 1IZNB 2PFXA 5C39A 3CCUP 2Z4EA 1VQ7P 2E76D 1VQ8P 4W7ZA 3CC2P 2PAJA 2IYOA 3QH9A 1GW4A 3TNUB 5B5EH 1GMJA 3IAOA 1LGHB 3L71J 1X9VA 3TYYA 4I6MC 5AW3B 1FE6A 1NTZK 3OAKA 2H7HA 5APUA 1LP1A 4PJ0H 1HJBA 3V2QA 2C0WA 5L8RJ 1BGYD 1NTZE 3OW2O 1FIBA 1FZCA 1VL2A 4XE5B 4WWIA 3H32A 3Q5PA 4W7YA 1KQSO 1DH3A 3AE9C 1MFZA 3Q3DA 4IOIH 1LTJA 1SQQE 1NTMK 2OTLP 2QM8A 1E79H 2QJYB 2JJLA 3RK2B 1IFNA 2Q1KA 4QMAA 2KSEA 3T97A 4WY4A 1IFDA 3RL0D 1SQBK 3GLMA 3F89A 4EOTA 3Q5RA 1L2PA 5GTHH 1SLQA 1S9KE 2IBZE 2HODC 1SFCD 1EZVG 2NPSC 2FYUK 2XKMA 3H1LG 4PD4I 2N1TD 1SQBE 5EFWB 2WPVB 1H0TB 3Q5SA 4AUWA 3V4WA 1KFNA 4Y99B 2FYUE 2ZXEB 5BU8B 3CXHI 2QE7H 5M1BA 5BVZA 1N86B 4O9BA 3BASA 3CMEP 1KB9I 1JY2P 2Z5HA 2E76C 3H1HG 3M91A 1IFIA 3S9OA 1GL2B 2YKOA 3V2RA 5K5GB 2R3SA 2A45I 5AVYB 2WSSH 4C7RA 2RN0A 2KNCB 2FY8A 3JSVC 1HH0A 2QIWA 4DZOA 1NTZG 1FOSE 3AE8C 4OGQB 3W68A 2YNYA 5TJHA 2BCCJ 4R4LA 1VQ9P 3H1IE 5KAFE 3AE3C 4WBAA 3L70E 3HD7B 2ZVNB 1YJWP 1J1DC 1H8AA 1SQVK 1J2JB 3AE4C 5CCGC 3E1IB 1IK7A 1NO4A 1FZGC 1SQQG 1WMKA 2FYNC 1SQVE 2PP6A 2Y0EA 1NTKJ 3B5NA 3TSIA 1G1IA 3CCJP 1FZAB 4U3FJ 1LJ2A 1SQXD 3GHGC 1KN7A 1NTMG 1M90Q 2QEXP 2CPSA 2IPPA 2IBZG 2W27A 3VMXA 3CWBE 1ZN5A 3USSA 3MHVA 2C0XA 4ZKUA 1OZHA 3RK3E 2CPBA 4YXWH 1SQBG 1ZR2A 3HTKA 1OVVA 2OYOA 3PRJA 3AE7C 3IR9A 4H0LD 1JY3O 1NTZD 2FYUG 2V7QJ 5B66H 3KZIE 3CX5H 1R5LA 3LIDA 1NU1J 3U59A 2ZT9D 3L74E 1IO4A 1NAYA 1WT6A 1FDMA 1N2DC 2BASA 5AVUB 3BCCG 1BSHA 1SQPK 1VQMP 1PP9J 3P8CE 2WT7B 1MUUA 2QJKB 2OARA 4PD4E 1SQQD 2M5AB 1UIXA 1PGPA 5GTIE 2IFMA 3P7KA 3BVHC 2KP8A 1T2KD 3MP7B 1KYOD 2HODA 3WUTA 2IFNA 2NZ2A 4YTPC 1H89A 2B87A 2FBWC 3HRNA 1JTHA 3A0HE 1S2EA 3SFEC 4A7PA 1NKZB 5KLVK 3H1IG 3L72J 2GY7A 1L4AB 2HLOA 2KB7P 4I2LC 3SWFA 3L70G 1FZBA 1E5WA 4D6TD 2R44A 2Q7CA 2PRRA 1M7LA 4LGDE 1X0TA 5KLVE 3ITKA 1N73B 4HYTB 1YQ3C 3W67A 1PV3A 2L5GB 2W83C 1SQVG 1P84H 5KJ7D 1AQ5A 4W80A 4ZFGA 4C7NB 2JWDA 1N7SB 1IC2A 4L74A 2W6JH 5APSA 1NJIQ 4ZNCA 2GA1A 3HE5B 3CWBG 2J5ZA 4AQRD 4PV1B 1W2BO 1EDJA 2KYVA 1KORA 1YYCA 2WMMA 2J3GA 1G2CB 2POHA 1L0LK 3CCLP 1QVFO 5AVTB 1JEKA 1BGYE 4N78E 3CC7P 5APYA 3L74G 4H0LC 3H1ID 3AEDC 1VQKP 2R32A 1L0LE 3I5CA 2ZAEB 3V5BA 1HUCA 4NPDA 2K9YA 2C9NY 2W6AA 3L70D 4JPZB 2M3BA 2JHLF 2ZT9C 4MN4C 3KXDA 2Q9IB 1LNQA 2FFDA 3H32C 2WSEJ 5CBOA 3P32A 2XV5A 2G3AA 1A02F 2YO2A 1SQPG 3UIAA 1SQVD 2SPZA 3L75G 2J61B 5TISH 2XZRA 3IFMA 1PIXA 3AEGC 3P8MC 4GODA 1U7MA 1S3JA 1URQB 2Y0DA 3VOPA 2RKLA 1M1JB 1QGKB 3H1KJ 2QJPB 3RK3D 2KS1A 2E75B 3C9IA 1SFCA 2YMYA 3CCEP 3NXSA 2N1TA 1S1CX 3KQGA 2GM4A 1RE4B 4H13B 2Z5IA 1OMIA 5AVXB 4AYCA 5KLVG 3D6YA 1YITP 1KYOI 4RJTA 1YI2P 4H44B 2A45G 5KAFH 2AEFA 2ZJSE 1AJYA 1NHLA 1VQPP 1VF5B 1YHQP 1HF9A 2A06E 3VYIA 4OVNF 3P8CD 4IL6H 1Q90D 1HBWA 1Z3SA 2WVRA 1RF1A 1ZR4A 4C46A 2IYPA 1S5LX 3SWYA 3WU2H 2J0HA 1OIPA 2OTKE 3GW6A 3Q1MA 1BGYG 4R9TA 3ZDMA 1L0LG 4DT0A 1OW6A 2ITAA 3HUSB 2KZIA 2UWJE 3H1JE 1IK9A 3PLNA 3KZIH 2J3UA 1T3UA 4OWFA 3V4QA 2FIBA 2R5DA 2HPCA 2KZJA 1M8OB 3VMZA 1AA0A 4R4MA 2W8ZA 4M3LA 2WQYC 2H43C 2E74B 3B71A 5APQA 2OYHC 4L75A 1SQXK 3M9HA 3O8ZA 1IFJA 3RK2D 4BRYB 1JCDA 1EQ7A 2XNXB 4ASWA 1KILB 1FJKA 1K05A 1SQXE 4PD4H 1FZEC 2V4HA 3G71P 3B5NC 2WSCH 2CK3H 2OYIC 1FZFB 3L71D 1GK6A 1W5CE 4JQ0D 4GDOA 1FS0E 1USEA 2ZYAA 3M9BA 1LWUA 1RF0C 4N6JA 3CXHH 3RK3C 2ZYDA 1X22A 1JNMA 1Q7YQ 4N78D 3N7NA 2ZXXA 4UB8E 3NMDA 2J5UA 3A0HH 1KB9H 1L0LD 3O6QA 2O3JA 1FZDA 3MD0A 2NPSB 1BE3J 1ZXGA 1NU1E 1PGJA 4JYBA 2HYNA 4K3AA 1D7MA 1JY3N 2KK7A 1SQQK 1OWAA 2RH0A 3S4RA 1RQVA 4M7HA 1GL2D 3OA7A 2A45H 1GU5A 1HWTC 5AVQB 1JB0J 1PP9E 3II6A 1LTAC 1AVOA 5APTA 2HR3A 1KYOE 1T8ZA 2YO3A 1X8YA 4OGQD 3TGUJ 1M57D 1G1JA 2YIUB 2K37A 5KKZC 3VP8A 2WNPF 1S5LE 5CHXA 2E43A 2BEZF 3H1JG 4XFJA 3G6EP 3HD7D 3U1AA 1JY2O 1L0NJ 2MJZA 4D6TE 3L72E 2J2PA 2HLOC 4LLHA 1BCCE 2QA4P 1T6AA 2GUSA 1QLED 1FZBC 1KQLA 1HTLC 3L73E 2LR2A 2WZ7A 1FOSF 5KJ7A 2A06D 3V6IA 3HE4B 3L36A 1SQXG 2JEEA 2QJYC 2B89A 1JCCA 2VRSA 2WSFH 2LXBA 2J0GA 5AW4B 2AXTH 4ZMDA 3CI9A 2I1JA 1FZGB 1PFIA 1EDLA 1Q82Q 2Y9ZA 3I56P 3CCVP 1KQFB 2J60A 1DEEG 1VPCA 2LKMA 2FXPA 2K9JB 3GHGB 2JHHC 2P67A 2G8YA 3F5HA 4Y99C 3AEBC 1LT9A 3JCUH 2H8PD 3VTPC 3H1JD 2J59M 2KLUA 3H1LJ 3A2AA 2IX7C 1RE3B 2BCCD 2H43A 1N86C 1FDOA 2OYHA 3A7OA 1HVVA 1QL1A 3EFGA 1AFOA 1KFMA 2FFDC 1CI6B 2O01H 5AW2B 5AVRB 1PP9G 1FZEA 2Q5UA 1GL2C 3BRVB 2JR8A 2OYIA 1JM0A 3RBZA 2N9BA 3RGUA 2DW3A 1RY3A 4YPCA 1M1KQ 3EQ2A 5KLIC 5AVVB 1RF0A 4U3FD 5H2FE 2OQQA 3H1HJ 3AE1C 3RL0C 2JDIH 1ZW0A 1L4AD 3H1KE 4OGQC 1MFTA 1XTCC 2Q6QA 1SFCC 4EYYQ 3BVHB 5AVSB 2N1TC 1BDCA 4D6TG 3TF5A 4DCKA 1BCCG 4UB6H 1KV4A 1NTZJ 4NYTA 3G3ZA 3HD7C 3R4YA 3L73G 1NU1D 1VQ4P 5E79H 5CCHD 2Y0CA 2P58A 3TNUA 3E1IC 3CPWO 1CW5A 1N7SD 1YTZT 1KILE 4Z1MH 2P10A 1S72P 1FAVA 1PP9D 1IJDB 4PV1D 4EPUA 1VQ6P 2YXRB 4EI2A 2JKVA 1RF1C 1JY3P 2O1KA 2Z4EB 2QSIA 2FYZA 3BRTB 1NTMJ 3KDPB 3MIWA 2ZFCA 2L91A 1KMIZ 4ZKPA 1J1EB 4PJ0E 1NYHA 1SQBJ 4B86A 3M9QA 2M0BA 3L72D 1NAFA 4I7ZB 1BCCD 3KPEA 1JMMA 2FYUJ 1GD2E 2IDBA 1LP1B 2JHMF 5CBNA 2HPCC 3L73D 1YJNP 3H6PA 2FKWB 2AEJA 1FZCB 1GW3A 3BCCJ 1URQD 5APVA 3CX5I 3CL3D 3H32B 1Z3UA 2J3FD 2E75D 1DEBA 1T3JA 3EFFK 4DOJA 3L71E 2O01N 1Y47A 3H1KG 3LW5H 4GOEA 1H0TA 1KYOH 4H13D 3N4XA 4U7JA 4XA4A 5GTHE 1FU1A 1LTJB 1L4AC 1Y9BA 1LWUC 3D6ZA 4H44D 3CC4P 4TLFA 4HJGH 1N86A 3KYQA 3T97B 1RQUA 4WY4B 1NKNA 3G9RA 1VF5D 1PL5A 3AEFC 2QVAA 3L70J 1BE3E 5CCHC 5DJTB 1UIIA 1GL2A 1EDKA 1EDIA 1EC5A 4R9JA 3KHUA 1N7SC 1Q81Q 1NGMB 1SQVJ 3AE6C 4N3YB 2KNCA 1QEXA 1Q86Q 2H88C 2KOGA 4PV1C 1ZV8A 1T2KC 4YXDC 1ZRTE 2R3CA 1PPJE 1HGVA 3H1KD 3CWBJ 3M0AA 2D2CB 3TGUE 3HD7A 1GU4A 3M06A 3B4SA 2KXPB 1PGOA 1L0NE 3E1IA 2E74D 1CZQA 3L74J 2IZ0A 1JO5A 1JY2N 1KILD 1FZAA 5KJ7C 3SWKA 2J64A 4GIFA 3Q2YA 2I1KA 2Y9YA
chains in the Genus database with same CATH topology
2WTYA 2PP6A 1M1JC 3II6A 1DX7A 2Z4EC 2WITA 1LTAC 3B5NA 1SP4A 3TSIA 2J3OA 1G1IA 5APTA 1FZAB 3GHGC 5AVWB 1T8ZA 2YO3A 1X8YA 2CPSA 1HGZA 2IPPA 2W27A 3VMXA 1J1EC 1ZN5A 1G1JA 3BATA 2C0XA 4KHXA 4ZKUA 2CPBA 4OH8B 1ZR2A 1YTZI 3HTKA 3VP8A 2WNPF 3B5NB 3IR9A 1Z56A 5CHXA 3VMYA 2E43A 1N7LA 2NPSD 1JY3O 1N73C 3HD7D 2WPSA 3U1AA 1JY2O 2MJZA 1X79B 1LT9C 3HE4A 2J2PA 2HLOC 3OJAB 4LLHA 4IFFA 1CSBA 2GUSA 3LIDA 3U59A 2WT7A 1FZBC 1IO4A 3HTKB 1KQLA 1WT6A 3A5TA 5CJ0A 1FDMA 1N2DC 1HTLC 5CCGA 1FZCC 2BASA 2P1JA 4M7FA 5AVUB 1FOSF 2WZ7A 2XU6A 5KJ7A 4JYOX 1SQPK 1NTKK 1FZGA 3HE4B 1LTIC 3L36A 1LTBC 2HG5D 3P8CE 2WT7B 1MUUA 2JEEA 2OARA 1JCCA 2W6BA 5AW5B 2VRSA 2WSFH 3VN0A 2JHKF 1NWQA 5AW6B 3GHGA 1ZLLA 1FJPA 2GUVA 2KSJA 4JYCA 2IFMA 3P7KA 2J0GA 5AW4B 3BVHC 2KP8A 3B5ND 1T2KD 3CI9A 2I1JA 1FZGB 1LTJC 1L4AA 2HODA 3V2PA 1PFIA 3V2NA 2YKPA 1H88A 3L37A 2IFNA 5APWA 2J0YA 1H89A 1L0NK 1RE3A 2XDJA 5AW9B 2J60A 1VPCA 2LKMA 3HRNA 1JTHA 3GHGB 4WB4A 2JHHC 4WY4C 2P67A 3HUSC 1NU1K 1N73A 4Y99C 1NKZB 4I1LA 5KLVK 3NFQA 2GY7A 1LT9A 1FBMA 2H8PD 3VTPC 2Q9IC 1L4AB 2J59M 2HLOA 2HODB 1CI6A 2KB7P 4I2LC 3SWFA 3A2AA 5BU5A 1FZBA 2IX7C 1E5WA 5CCHA 1RE3B 2Q7CA 2H43A 1M7LA 4LGDE 1N86C 1JTHB 3M0DC 2YKQA 2OYHA 4C7NA 3A7OA 1N7SA 1N73B 1HVVA 4HYTB 1IFMA 1QL1A 2R5BA 3EFGA 2L5GB 2HFED 1GTWA 1LT9B 5CCGD 2XNXC 1AFOA 1KFMA 3HE5A 2FFDC 2HLOB 1CI6B 1KILC 2O01H 2KLVA 2WSEH 5AW2B 5AVRB 5KJ7D 1AQ5A 1FZBB 1URQC 4IFDK 1FZEA 5AW1B 4W80A 2H43B 1QL2A 2Q5UA 1GL2C 3BRVB 2OYHB 4ZFGA 4C7NB 2OYIA 1N7SB 1IC2A 1FZFC 2N9BA 1G2CA 5APSA 3BVHA 3WMM0 1RY3A 3EQ2A 3HE5B 1JUNA 5AVVB 2J5ZA 1RE4C 1RF0A 4AQRD 1LTSC 2D39A 1FZEB 3RL0C 1L4AD 2KYVA 2OYIB 1YYCA 2J3GA 3L4FA 1G2CB 1NOHA 1XTCC 2POHA 1SFCC 1L0LK 3BVHB 1A02J 5AVSB 5AVTB 2N1TC 3R2PA 1W2EA 4JZCA 2WPQA 4N78E 2Q9IA 2JHIF 1RF0B 2QM7A 5APYA 3RK3B 1JOCA 4NYTA 1LTGC 3G3ZA 3HD7C 2J1GA 1LTTC 4HH2A 2R32A 3I5CA 3V5BA 2C9NY 1HUCA 3A3YB 5CJ4A 2W6AA 4LC1A 3MUDA 3NTNA 5CCHD 2M3BA 2J61A 2JHLF 3VP9A 1NH4A 3TNUA 3E1IC 2Q9IB 4GT1A 2FFDA 1CW5A 1N7SD 3H32C 1YTZT 3P32A 2XV5A 1URQA 1A02F 3RK2C 1M1JA 2Z4EA 2YO2A 1J1DB 3UIAA 1FAVA 2J3FA 1IJDB 1GK4A 4W7ZA 2J61B 4EPUA 2PAJA 2XZRA 5AW0B 3FIBA 4IFMA 1GW4A 3TNUB 3IFMA 2FFDB 3P8MC 1RF1C 1JY3P 1RE4A 1LGHB 2O1KA 1FIDA 1URQB 3VOPA 1X9VA 1M1JB 2Z4EB 3TYYA 2FYZA 4I6MC 3BRTB 2E42A 5AW3B 2P2UA 3RK3D 3KDPB 3MIWA 3C9IA 5CMZA 1NTZK 3OAKA 1SFCA 2YMYA 2H7HA 3NXSA 2N1TA 2ZFCA 5APUA 1XTGB 3KQGA 4EIJA 4ZKPA 1HJBA 1J1EB 2GM4A 1RE4B 3V2QA 2C0WA 3RL0B 2Z5IA 4B86A 3M9QA 5AVXB 4AYCA 1NAFA 1FIBA 1FZCA 3KPEA 1JMMA 1SFCB 1GD2E 3MGNA 4XE5B 2N1TB 2A45G 2JHMF 2HPCC 3H32A 4W7YA 3H6PA 1NHLA 1DH3A 1MZ9A 2FKWB 1MFZA 3VYIA 1FZCB 2O1JA 3P8CD 1GW3A 1URQD 5APVA 2FXMA 1VDFA 1HBWA 1Z3SA 3CL3D 3H32B 3TK1A 1LTJA 1RF1A 1JO5A 1Z3UA 2J3FD 1DEBA 1NTMK 2QM8A 2Q3IA 1T3JA 2JJLA 3RK2B 2J58A 4DOJA 1ZR4A 4GKGA 3MTUE 1IFNA 5APXA 4C46A 3LW5H 3T97A 2M8RA 3L35A 4RESB 4WY4A 1IFDA 3HUSA 3SWYA 5KTBA 3RL0D 1SQBK 2J0HA 3N4XA 4XA4A 4EOTA 2P7JA 1SLQA 1S9KE 4R9TA 5AW7B 1FU1A 1LTJB 1RF1B 1L4AC 2HODC 1LWUC 1SFCD 2NPSC 2FYUK 2XKMA 2N1TD 1RE3C 1N86A 3M0DA 3KYQA 1WRGA 4WY4B 3HUSB 3LIEA 4AUWA 1NKNA 1IK9A 3V4WA 2J3UA 1KFNA 4Y99B 1T3UA 3PP5A 2XNXA 3V4QA 2FIBA 2R5DA 2HPCA 2ZXEB 3VMZA 1KILA 4M3LA 5BU8B 5CCHC 2H43C 5BVZA 1N86B 1GL2A 4O9BA 3BASA 5APQA 2OYHC 4R9JA 2WWWA 3U1CA 1N7SC 1FZFA 1OXZA 1SQXK 3M9HA 3O8ZA 1FZAC 1IFJA 3RK2D 1JCDA 1EQ7A 2XNXB 2HPCB 4N3YB 1KILB 1FJKA 1JY2P 2Z5HA 2KOGA 3M91A 1FZEC 1IFIA 1GL2B 1SVFA 2YKOA 1ZV8A 2WSCH 3B5NC 3V2RA 1T2KC 1FICA 3CLQA 2OYIC 1FZFB 2R3CA 1GK6A 1HGVA 2A45I 5AVYB 3M0AA 4C7RA 1KZUB 3M9BA 4WY4D 1LWUA 1RF0C 4N6JA 2NPSA 3RK3C 1HH0A 4DZOA 1JNMA 3HD7A 1S9KD 1FOSE 4N78D 1GU4A 3M06A 3N7NA 1GZLA 3NMDA 2YNYA 5AW8B 1MV8A 1FZDA 3E1IA 1LWUB 3MD0A 1CZQA 1JC9A 2NPSB 4WBAA 3HD7B 4JYBA 2HYNA 1JY3N 1SQQK 1J1DC 1JY2N 1OWAA 1H8AA 1SQVK 1J2JB 1KILD 5CCGC 1GDTA 2C9LY 1FZAA 5KJ7C 2J64A 4M7HA 5AVZB 3E1IB 1GL2D 3OA7A 2A45H 2WPRA 1NO4A 4GIFA 1FZGC 2I1KA 3B8EB 1GU5A 1HWTC 5AVQB 4JF7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N86 A;  2J61 B;  4EPU A;  2Q9I C;  2HLO A;  2HOD B;  1M1J C;  3FIB A;  2Z4E C;  3HUS B;  2FFD B;  1FZB A;  2J3U A;  1RF1 C;  1JY3 P;  1RE3 B;  1RE4 A;  2J3O A;  1FZA B;  1FID A;  3GHG C;  1T3U A;  2H43 A;  2XNX A;  1N86 C;  2FIB A;  2HPC A;  2OYH A;  1M1J B;  2Z4E B;  1N73 B;  2H43 C;  1LT9 B;  1N86 B;  2XNX C;  2FFD C;  2HLO B;  2OYH C;  4R9J A;  1FZF A;  2WNP F;  1FZA C;  1FZB B;  1RE4 B;  1FZE A;  2H43 B;  2XNX B;  1JY3 O;  1N73 C;  2HPC B;  1JY2 O;  2OYH B;  4ZFG A;  2OYI A;  1JY2 P;  1FZF C;  1LT9 C;  1FIB A;  3BVH A;  1FZC A;  1FZE C;  2HLO C;  2J2P A;  1FZB C;  1FIC A;  2OYI C;  1RE4 C;  1RF0 A;  2J5Z A;  1FZF B;  2A45 G;  2JHM F;  2D39 A;  1FZE B;  3H32 A;  2HPC C;  1FZC C;  2A45 I;  4M7F A;  2OYI B;  4JYO X;  1LWU A;  1RF0 C;  2J3G A;  1FZG A;  3BVH B;  1FZC B;  1W2E A;  4JZC A;  2Q9I A;  2JHI F;  1RF0 B;  1Z3S A;  4NYT A;  3H32 B;  1Z3U A;  1LTJ A;  1RF1 A;  2J3F D;  2J1G A;  2JHK F;  3GHG A;  1FZD A;  3E1I A;  2J0G A;  3BVH C;  1LWU B;  1JC9 A;  1FZG B;  1LTJ C;  2J61 A;  2JHL F;  2HOD A;  1JY3 N;  3HUS A;  3E1I C;  1JY2 N;  2J0Y A;  2Q9I B;  2J0H A;  2FFD A;  3H32 C;  1RE3 A;  1FZA A;  2J60 A;  4R9T A;  1LTJ B;  1RF1 B;  2J64 A;  4M7H A;  1M1J A;  2Z4E A;  3GHG B;  1LWU C;  2HOD C;  2JHH C;  3E1I B;  2A45 H;  3HUS C;  1N73 A;  1FZG C;  1RE3 C;  2J3F A;  2GY7 A;  1LT9 A; 
#chains in the Genus database with same CATH topology
 3L71 G;  3QWO C;  1M1J C;  1DX7 A;  1SQP J;  2WSC J;  3GMA A;  2J3O A;  3L75 J;  2OTJ P;  3SSU A;  5H2F H;  1DIP A;  4KHX A;  4H13 C;  1IFP A;  1YTZ I;  3B5N B;  3VMY A;  1OVR A;  1N7L A;  2NPS D;  2YXQ B;  2WPS A;  4H44 C;  1X79 B;  1LT9 C;  2BCC E;  3CX5 E;  3OJA B;  1CSB A;  3AE5 C;  3FXE A;  2WT7 A;  3H1L E;  2OGU A;  3HTK B;  5KLV J;  1VQN P;  3A5T A;  2M5A A;  5CJ0 A;  4TT3 H;  2W90 A;  3CCR P;  3C8V A;  4JYO X;  1NTK K;  2H89 C;  1LTI C;  2HG5 D;  2PGD A;  2B88 A;  1NTK E;  3VN0 A;  2JHK F;  5AW6 B;  5GTI H;  1FJP A;  2GUV A;  1PPJ G;  2KSJ A;  4U3F E;  1L4A A;  2IZ1 A;  3V2P A;  3TGU G;  3CMA P;  3C1L A;  3CD6 P;  5APW A;  2J0Y A;  3H1H E;  2XDJ A;  2QG4 A;  3HUS C;  1NU1 K;  1N73 A;  3IN6 A;  1HJ0 A;  1BGY J;  1L0N G;  4I1L A;  1FBM A;  2HOD B;  1K73 Q;  5DJU B;  1FDI A;  5KKZ B;  1L0L J;  2B87 B;  5CCH A;  1YJ9 P;  2A06 G;  1YBK A;  1JTH B;  3M0D C;  2E74 C;  4C7N A;  1N7S A;  1BE3 D;  1R8E A;  4WVZ A;  1IFM A;  2AXC A;  2ZYG A;  2HFE D;  5CCG D;  3CCM P;  2NRG A;  4IL6 X;  2XNX C;  3HE5 A;  2HLO B;  1KIL C;  2KLV A;  1FZB B;  1P84 E;  1DD4 A;  2KI7 B;  2FXO A;  2WSF J;  1QX8 A;  4BXL A;  1FZF C;  1G2C A;  1ZOY C;  3WMM 0;  2JO1 A;  1YIJ P;  1ZRT D;  3E7K A;  1PPJ D;  2E76 B;  3E1R A;  3MZW B;  3TGU D;  1NOH A;  3RL0 g;  1NTM E;  1A02 J;  4EDF A;  3K5B A;  1W2E A;  2BCC G;  1BDD A;  2WPQ A;  2Q9I A;  1OW7 A;  2JHI F;  1LTG C;  1L0N D;  2J1G A;  1LTT C;  3I55 P;  3A0B E;  3A3Y B;  5CJ4 A;  4LC1 A;  3NTN A;  1OX3 A;  2J61 A;  3VP9 A;  1NH4 A;  4GT1 A;  2O01 J;  1URQ A;  3VMA A;  3RK2 C;  1QVG O;  1M1J A;  1J1D B;  1NTK G;  1AVY A;  2J3F A;  1GK4 A;  2E5Y A;  4U3F G;  3BCC E;  1OW8 A;  5AW0 B;  3FIB A;  4IFM A;  5TIS E;  2FYN B;  2FFD B;  1ZME C;  1RE4 A;  1FID A;  1KC8 Q;  3WUV A;  2YIU C;  1KQG B;  4RKU J;  2YMK A;  2E42 A;  1U57 A;  2P2U A;  3AE2 C;  5CMZ A;  3JC2 2;  5KAI E;  5KLI B;  1XTG B;  4EIJ A;  1Q2N A;  1AV1 A;  1NU1 G;  3RL0 B;  1JMB A;  3CX5 D;  3FWL A;  4L76 A;  3H1J J;  1K9M Q;  1EZV D;  3AEC C;  3H1L D;  2KS1 B;  1SFC B;  3MGN A;  2N1T B;  1ZP0 C;  3FXD A;  2K3R A;  2K1A A;  1OVU A;  1MZ9 A;  1RHZ B;  2K88 A;  2O1J A;  3IF4 A;  1EXI A;  4IL6 E;  2FXM A;  1VDF A;  1NTK D;  2ZVO B;  3TK1 A;  1S4X A;  1SQX J;  2Q3I A;  2J58 A;  3CCQ P;  4GKG A;  3MTU E;  5APX A;  1PGQ A;  3S1K A;  2M8R A;  3L35 A;  4RES B;  3HUS A;  3H1H D;  5KTB A;  3WU2 E;  3H25 A;  1VQO P;  2P7J A;  3L72 G;  2AEM A;  5AW7 B;  1RF1 B;  1EXJ A;  2LXC B;  1RE3 C;  3M0D A;  1WRG A;  3LIE A;  4BRY A;  3PHL A;  3PP5 A;  3GF3 A;  2XNX A;  1KIL A;  1KTM A;  1P84 D;  1FZF A;  2WWW A;  3U1C A;  1OXZ A;  1FZA C;  3SFD C;  1SQQ J;  2HPC B;  5B5E E;  1AQT A;  3G4S P;  3LW5 J;  1SVF A;  1SQP E;  1FIC A;  3CLQ A;  3L75 E;  1KZU B;  3GF7 A;  4WY4 D;  1NTM D;  2NPS A;  2N9Y B;  3CXH E;  4NPE A;  4K35 A;  3FX0 A;  1S9K D;  2IBZ D;  4UB8 H;  1SS1 A;  1GZL A;  1SQB D;  2QRX A;  1Y8A A;  5AW8 B;  3AEE C;  1KB9 E;  2V7Q H;  4D6T J;  1MV8 A;  1PZQ A;  1BCC J;  4HB1 A;  1LWU B;  1JC9 A;  4H0L B;  2FYU D;  2JWA A;  2QJK C;  4Y28 J;  2MKV A;  2C9L Y;  1GDT A;  3L73 J;  4HKZ H;  1VQ5 P;  3MUD C;  3O6Q B;  2ZT9 B;  1K04 A;  5AVZ B;  2WPR A;  3B8E B;  3BCC D;  4JF7 A;  4GOF A;  1EZV I;  2WTY A;  2Z4E C;  2WIT A;  1SP4 A;  2D2C D;  1RH5 B;  5AVW B;  1HGZ A;  1J1E C;  1TU3 F;  3BAT A;  4OH8 B;  1U7J A;  1S5L H;  2E5T A;  1Z56 A;  4I7Z C;  1N73 C;  1USD A;  3H1I J;  4JBZ A;  1DD3 A;  1R5S A;  3WUU A;  3CCS P;  3HE4 A;  1VQL P;  4IFF A;  3D71 A;  3PH0 A;  3FWN A;  3PJS K;  3A0B H;  2BEQ D;  5CCG A;  1BSN A;  1FZC C;  2P1J A;  4DJG A;  4M7F A;  2XU6 A;  2KUB A;  1FC2 C;  1FZG A;  1LTB C;  1YQ4 C;  2KIK A;  2W6B A;  2K9J A;  5AW5 B;  1NWQ A;  1NVO A;  3GHG A;  1ZLL A;  4JYC A;  1MKM A;  3B5N D;  2AXT E;  1LTJ C;  3V2N A;  1P84 I;  2YKP A;  1H88 A;  3L37 A;  1L0N K;  1RE3 A;  2Q3E A;  3CWB D;  5AW9 B;  1LT1 A;  4WB4 A;  4WY4 C;  5KAI H;  3NFQ A;  1N8R Q;  2Q9I C;  3FGA D;  3JCU E;  1CI6 A;  4L73 A;  5BU5 A;  2M3E A;  2I8D A;  2YKQ A;  1KD1 Q;  3L74 D;  2R5B A;  3EWK A;  1GTW A;  4BWN A;  1LT9 B;  2IBZ I;  4RO0 A;  4ASV A;  2WSE H;  1OFC X;  1URQ C;  4IFD K;  5AW1 B;  2H43 B;  1QL2 A;  3GG2 A;  4KT0 J;  2OYH B;  3RBX A;  2QJP C;  2E75 C;  4PD4 D;  4CPG A;  3BVH A;  1SQP D;  2JP3 A;  1M56 D;  1JUN A;  1RE4 C;  2D2C C;  3L75 D;  1LTS C;  2D39 A;  1FZE B;  3D70 A;  2OYI B;  3CXH D;  3AEA C;  3L4F A;  3R2P A;  5B66 E;  4JZC A;  3PTZ A;  2XND H;  1RF0 B;  2QM7 A;  1KB9 D;  3RK3 B;  1JOC A;  4UB6 E;  2B9B A;  4NPF X;  1BE3 G;  1EZV E;  2RMZ A;  4HH2 A;  4KJM A;  1VF5 C;  3TDK A;  3MUD A;  3ABV C;  5E79 E;  5KLV D;  1K8A Q;  1IZN B;  2PFX A;  5C39 A;  3CCU P;  2Z4E A;  1VQ7 P;  2E76 D;  1VQ8 P;  4W7Z A;  3CC2 P;  2PAJ A;  2IYO A;  3QH9 A;  1GW4 A;  3TNU B;  5B5E H;  1GMJ A;  3IAO A;  1LGH B;  3L71 J;  1X9V A;  3TYY A;  4I6M C;  5AW3 B;  1FE6 A;  1NTZ K;  3OAK A;  2H7H A;  5APU A;  1LP1 A;  4PJ0 H;  1HJB A;  3V2Q A;  2C0W A;  5L8R J;  1BGY D;  1NTZ E;  3OW2 O;  1FIB A;  1FZC A;  1VL2 A;  4XE5 B;  4WWI A;  3H32 A;  3Q5P A;  4W7Y A;  1KQS O;  1DH3 A;  3AE9 C;  1MFZ A;  3Q3D A;  4IOI H;  1LTJ A;  1SQQ E;  1NTM K;  2OTL P;  2QM8 A;  1E79 H;  2QJY B;  2JJL A;  3RK2 B;  1IFN A;  2Q1K A;  4QMA A;  2KSE A;  3T97 A;  4WY4 A;  1IFD A;  3RL0 D;  1SQB K;  3GLM A;  3F89 A;  4EOT A;  3Q5R A;  1L2P A;  5GTH H;  1SLQ A;  1S9K E;  2IBZ E;  2HOD C;  1SFC D;  1EZV G;  2NPS C;  2FYU K;  2XKM A;  3H1L G;  4PD4 I;  2N1T D;  1SQB E;  5EFW B;  2WPV B;  1H0T B;  3Q5S A;  4AUW A;  3V4W A;  1KFN A;  4Y99 B;  2FYU E;  2ZXE B;  5BU8 B;  3CXH I;  2QE7 H;  5M1B A;  5BVZ A;  1N86 B;  4O9B A;  3BAS A;  3CME P;  1KB9 I;  1JY2 P;  2Z5H A;  2E76 C;  3H1H G;  3M91 A;  1IFI A;  3S9O A;  1GL2 B;  2YKO A;  3V2R A;  5K5G B;  2R3S A;  2A45 I;  5AVY B;  2WSS H;  4C7R A;  2RN0 A;  2KNC B;  2FY8 A;  3JSV C;  1HH0 A;  2QIW A;  4DZO A;  1NTZ G;  1FOS E;  3AE8 C;  4OGQ B;  3W68 A;  2YNY A;  5TJH A;  2BCC J;  4R4L A;  1VQ9 P;  3H1I E;  5KAF E;  3AE3 C;  4WBA A;  3L70 E;  3HD7 B;  2ZVN B;  1YJW P;  1J1D C;  1H8A A;  1SQV K;  1J2J B;  3AE4 C;  5CCG C;  3E1I B;  1IK7 A;  1NO4 A;  1FZG C;  1SQQ G;  1WMK A;  2FYN C;  1SQV E;  2PP6 A;  2Y0E A;  1NTK J;  3B5N A;  3TSI A;  1G1I A;  3CCJ P;  1FZA B;  4U3F J;  1LJ2 A;  1SQX D;  3GHG C;  1KN7 A;  1NTM G;  1M90 Q;  2QEX P;  2CPS A;  2IPP A;  2IBZ G;  2W27 A;  3VMX A;  3CWB E;  1ZN5 A;  3USS A;  3MHV A;  2C0X A;  4ZKU A;  1OZH A;  3RK3 E;  2CPB A;  4YXW H;  1SQB G;  1ZR2 A;  3HTK A;  1OVV A;  2OYO A;  3PRJ A;  3AE7 C;  3IR9 A;  4H0L D;  1JY3 O;  1NTZ D;  2FYU G;  2V7Q J;  5B66 H;  3KZI E;  3CX5 H;  1R5L A;  3LID A;  1NU1 J;  3U59 A;  2ZT9 D;  3L74 E;  1IO4 A;  1NAY A;  1WT6 A;  1FDM A;  1N2D C;  2BAS A;  5AVU B;  3BCC G;  1BSH A;  1SQP K;  1VQM P;  1PP9 J;  3P8C E;  2WT7 B;  1MUU A;  2QJK B;  2OAR A;  4PD4 E;  1SQQ D;  2M5A B;  1UIX A;  1PGP A;  5GTI E;  2IFM A;  3P7K A;  3BVH C;  2KP8 A;  1T2K D;  3MP7 B;  1KYO D;  2HOD A;  3WUT A;  2IFN A;  2NZ2 A;  4YTP C;  1H89 A;  2B87 A;  2FBW C;  3HRN A;  1JTH A;  3A0H E;  1S2E A;  3SFE C;  4A7P A;  1NKZ B;  5KLV K;  3H1I G;  3L72 J;  2GY7 A;  1L4A B;  2HLO A;  2KB7 P;  4I2L C;  3SWF A;  3L70 G;  1FZB A;  1E5W A;  4D6T D;  2R44 A;  2Q7C A;  2PRR A;  1M7L A;  4LGD E;  1X0T A;  5KLV E;  3ITK A;  1N73 B;  4HYT B;  1YQ3 C;  3W67 A;  1PV3 A;  2L5G B;  2W83 C;  1SQV G;  1P84 H;  5KJ7 D;  1AQ5 A;  4W80 A;  4ZFG A;  4C7N B;  2JWD A;  1N7S B;  1IC2 A;  4L74 A;  2W6J H;  5APS A;  1NJI Q;  4ZNC A;  2GA1 A;  3HE5 B;  3CWB G;  2J5Z A;  4AQR D;  4PV1 B;  1W2B O;  1EDJ A;  2KYV A;  1KOR A;  1YYC A;  2WMM A;  2J3G A;  1G2C B;  2POH A;  1L0L K;  3CCL P;  1QVF O;  5AVT B;  1JEK A;  1BGY E;  4N78 E;  3CC7 P;  5APY A;  3L74 G;  4H0L C;  3H1I D;  3AED C;  1VQK P;  2R32 A;  1L0L E;  3I5C A;  2ZAE B;  3V5B A;  1HUC A;  4NPD A;  2K9Y A;  2C9N Y;  2W6A A;  3L70 D;  4JPZ B;  2M3B A;  2JHL F;  2ZT9 C;  4MN4 C;  3KXD A;  2Q9I B;  1LNQ A;  2FFD A;  3H32 C;  2WSE J;  5CBO A;  3P32 A;  2XV5 A;  2G3A A;  1A02 F;  2YO2 A;  1SQP G;  3UIA A;  1SQV D;  2SPZ A;  3L75 G;  2J61 B;  5TIS H;  2XZR A;  3IFM A;  1PIX A;  3AEG C;  3P8M C;  4GOD A;  1U7M A;  1S3J A;  1URQ B;  2Y0D A;  3VOP A;  2RKL A;  1M1J B;  1QGK B;  3H1K J;  2QJP B;  3RK3 D;  2KS1 A;  2E75 B;  3C9I A;  1SFC A;  2YMY A;  3CCE P;  3NXS A;  2N1T A;  1S1C X;  3KQG A;  2GM4 A;  1RE4 B;  4H13 B;  2Z5I A;  1OMI A;  5AVX B;  4AYC A;  5KLV G;  3D6Y A;  1YIT P;  1KYO I;  4RJT A;  1YI2 P;  4H44 B;  2A45 G;  5KAF H;  2AEF A;  2ZJS E;  1AJY A;  1NHL A;  1VQP P;  1VF5 B;  1YHQ P;  1HF9 A;  2A06 E;  3VYI A;  4OVN F;  3P8C D;  4IL6 H;  1Q90 D;  1HBW A;  1Z3S A;  2WVR A;  1RF1 A;  1ZR4 A;  4C46 A;  2IYP A;  1S5L X;  3SWY A;  3WU2 H;  2J0H A;  1OIP A;  2OTK E;  3GW6 A;  3Q1M A;  1BGY G;  4R9T A;  3ZDM A;  1L0L G;  4DT0 A;  1OW6 A;  2ITA A;  3HUS B;  2KZI A;  2UWJ E;  3H1J E;  1IK9 A;  3PLN A;  3KZI H;  2J3U A;  1T3U A;  4OWF A;  3V4Q A;  2FIB A;  2R5D A;  2HPC A;  2KZJ A;  1M8O B;  3VMZ A;  1AA0 A;  4R4M A;  2W8Z A;  4M3L A;  2WQY C;  2H43 C;  2E74 B;  3B71 A;  5APQ A;  2OYH C;  4L75 A;  1SQX K;  3M9H A;  3O8Z A;  1IFJ A;  3RK2 D;  4BRY B;  1JCD A;  1EQ7 A;  2XNX B;  4ASW A;  1KIL B;  1FJK A;  1K05 A;  1SQX E;  4PD4 H;  1FZE C;  2V4H A;  3G71 P;  3B5N C;  2WSC H;  2CK3 H;  2OYI C;  1FZF B;  3L71 D;  1GK6 A;  1W5C E;  4JQ0 D;  4GDO A;  1FS0 E;  1USE A;  2ZYA A;  3M9B A;  1LWU A;  1RF0 C;  4N6J A;  3CXH H;  3RK3 C;  2ZYD A;  1X22 A;  1JNM A;  1Q7Y Q;  4N78 D;  3N7N A;  2ZXX A;  4UB8 E;  3NMD A;  2J5U A;  3A0H H;  1KB9 H;  1L0L D;  3O6Q A;  2O3J A;  1FZD A;  3MD0 A;  2NPS B;  1BE3 J;  1ZXG A;  1NU1 E;  1PGJ A;  4JYB A;  2HYN A;  4K3A A;  1D7M A;  1JY3 N;  2KK7 A;  1SQQ K;  1OWA A;  2RH0 A;  3S4R A;  1RQV A;  4M7H A;  1GL2 D;  3OA7 A;  2A45 H;  1GU5 A;  1HWT C;  5AVQ B;  1JB0 J;  1PP9 E;  3II6 A;  1LTA C;  1AVO A;  5APT A;  2HR3 A;  1KYO E;  1T8Z A;  2YO3 A;  1X8Y A;  4OGQ D;  3TGU J;  1M57 D;  1G1J A;  2YIU B;  2K37 A;  5KKZ C;  3VP8 A;  2WNP F;  1S5L E;  5CHX A;  2E43 A;  2BEZ F;  3H1J G;  4XFJ A;  3G6E P;  3HD7 D;  3U1A A;  1JY2 O;  1L0N J;  2MJZ A;  4D6T E;  3L72 E;  2J2P A;  2HLO C;  4LLH A;  1BCC E;  2QA4 P;  1T6A A;  2GUS A;  1QLE D;  1FZB C;  1KQL A;  1HTL C;  3L73 E;  2LR2 A;  2WZ7 A;  1FOS F;  5KJ7 A;  2A06 D;  3V6I A;  3HE4 B;  3L36 A;  1SQX G;  2JEE A;  2QJY C;  2B89 A;  1JCC A;  2VRS A;  2WSF H;  2LXB A;  2J0G A;  5AW4 B;  2AXT H;  4ZMD A;  3CI9 A;  2I1J A;  1FZG B;  1PFI A;  1EDL A;  1Q82 Q;  2Y9Z A;  3I56 P;  3CCV P;  1KQF B;  2J60 A;  1DEE G;  1VPC A;  2LKM A;  2FXP A;  2K9J B;  3GHG B;  2JHH C;  2P67 A;  2G8Y A;  3F5H A;  4Y99 C;  3AEB C;  1LT9 A;  3JCU H;  2H8P D;  3VTP C;  3H1J D;  2J59 M;  2KLU A;  3H1L J;  3A2A A;  2IX7 C;  1RE3 B;  2BCC D;  2H43 A;  1N86 C;  1FDO A;  2OYH A;  3A7O A;  1HVV A;  1QL1 A;  3EFG A;  1AFO A;  1KFM A;  2FFD C;  1CI6 B;  2O01 H;  5AW2 B;  5AVR B;  1PP9 G;  1FZE A;  2Q5U A;  1GL2 C;  3BRV B;  2JR8 A;  2OYI A;  1JM0 A;  3RBZ A;  2N9B A;  3RGU A;  2DW3 A;  1RY3 A;  4YPC A;  1M1K Q;  3EQ2 A;  5KLI C;  5AVV B;  1RF0 A;  4U3F D;  5H2F E;  2OQQ A;  3H1H J;  3AE1 C;  3RL0 C;  2JDI H;  1ZW0 A;  1L4A D;  3H1K E;  4OGQ C;  1MFT A;  1XTC C;  2Q6Q A;  1SFC C;  4EYY Q;  3BVH B;  5AVS B;  2N1T C;  1BDC A;  4D6T G;  3TF5 A;  4DCK A;  1BCC G;  4UB6 H;  1KV4 A;  1NTZ J;  4NYT A;  3G3Z A;  3HD7 C;  3R4Y A;  3L73 G;  1NU1 D;  1VQ4 P;  5E79 H;  5CCH D;  2Y0C A;  2P58 A;  3TNU A;  3E1I C;  3CPW O;  1CW5 A;  1N7S D;  1YTZ T;  1KIL E;  4Z1M H;  2P10 A;  1S72 P;  1FAV A;  1PP9 D;  1IJD B;  4PV1 D;  4EPU A;  1VQ6 P;  2YXR B;  4EI2 A;  2JKV A;  1RF1 C;  1JY3 P;  2O1K A;  2Z4E B;  2QSI A;  2FYZ A;  3BRT B;  1NTM J;  3KDP B;  3MIW A;  2ZFC A;  2L91 A;  1KMI Z;  4ZKP A;  1J1E B;  4PJ0 E;  1NYH A;  1SQB J;  4B86 A;  3M9Q A;  2M0B A;  3L72 D;  1NAF A;  4I7Z B;  1BCC D;  3KPE A;  1JMM A;  2FYU J;  1GD2 E;  2IDB A;  1LP1 B;  2JHM F;  5CBN A;  2HPC C;  3L73 D;  1YJN P;  3H6P A;  2FKW B;  2AEJ A;  1FZC B;  1GW3 A;  3BCC J;  1URQ D;  5APV A;  3CX5 I;  3CL3 D;  3H32 B;  1Z3U A;  2J3F D;  2E75 D;  1DEB A;  1T3J A;  3EFF K;  4DOJ A;  3L71 E;  2O01 N;  1Y47 A;  3H1K G;  3LW5 H;  4GOE A;  1H0T A;  1KYO H;  4H13 D;  3N4X A;  4U7J A;  4XA4 A;  5GTH E;  1FU1 A;  1LTJ B;  1L4A C;  1Y9B A;  1LWU C;  3D6Z A;  4H44 D;  3CC4 P;  4TLF A;  4HJG H;  1N86 A;  3KYQ A;  3T97 B;  1RQU A;  4WY4 B;  1NKN A;  3G9R A;  1VF5 D;  1PL5 A;  3AEF C;  2QVA A;  3L70 J;  1BE3 E;  5CCH C;  5DJT B;  1UII A;  1GL2 A;  1EDK A;  1EDI A;  1EC5 A;  4R9J A;  3KHU A;  1N7S C;  1Q81 Q;  1NGM B;  1SQV J;  3AE6 C;  4N3Y B;  2KNC A;  1QEX A;  1Q86 Q;  2H88 C;  2KOG A;  4PV1 C;  1ZV8 A;  1T2K C;  4YXD C;  1ZRT E;  2R3C A;  1PPJ E;  1HGV A;  3H1K D;  3CWB J;  3M0A A;  2D2C B;  3TGU E;  3HD7 A;  1GU4 A;  3M06 A;  3B4S A;  2KXP B;  1PGO A;  1L0N E;  3E1I A;  2E74 D;  1CZQ A;  3L74 J;  2IZ0 A;  1JO5 A;  1JY2 N;  1KIL D;  1FZA A;  5KJ7 C;  3SWK A;  2J64 A;  4GIF A;  3Q2Y A;  2I1K A;  2Y9Y A; 
#chains in the Genus database with same CATH homology
 2WTY A;  2PP6 A;  1M1J C;  3II6 A;  1DX7 A;  2Z4E C;  2WIT A;  1LTA C;  3B5N A;  1SP4 A;  3TSI A;  2J3O A;  1G1I A;  5APT A;  1FZA B;  3GHG C;  5AVW B;  1T8Z A;  2YO3 A;  1X8Y A;  2CPS A;  1HGZ A;  2IPP A;  2W27 A;  3VMX A;  1J1E C;  1ZN5 A;  1G1J A;  3BAT A;  2C0X A;  4KHX A;  4ZKU A;  2CPB A;  4OH8 B;  1ZR2 A;  1YTZ I;  3HTK A;  3VP8 A;  2WNP F;  3B5N B;  3IR9 A;  1Z56 A;  5CHX A;  3VMY A;  2E43 A;  1N7L A;  2NPS D;  1JY3 O;  1N73 C;  3HD7 D;  2WPS A;  3U1A A;  1JY2 O;  2MJZ A;  1X79 B;  1LT9 C;  3HE4 A;  2J2P A;  2HLO C;  3OJA B;  4LLH A;  4IFF A;  1CSB A;  2GUS A;  3LID A;  3U59 A;  2WT7 A;  1FZB C;  1IO4 A;  3HTK B;  1KQL A;  1WT6 A;  3A5T A;  5CJ0 A;  1FDM A;  1N2D C;  1HTL C;  5CCG A;  1FZC C;  2BAS A;  2P1J A;  4M7F A;  5AVU B;  1FOS F;  2WZ7 A;  2XU6 A;  5KJ7 A;  4JYO X;  1SQP K;  1NTK K;  1FZG A;  3HE4 B;  1LTI C;  3L36 A;  1LTB C;  2HG5 D;  3P8C E;  2WT7 B;  1MUU A;  2JEE A;  2OAR A;  1JCC A;  2W6B A;  5AW5 B;  2VRS A;  2WSF H;  3VN0 A;  2JHK F;  1NWQ A;  5AW6 B;  3GHG A;  1ZLL A;  1FJP A;  2GUV A;  2KSJ A;  4JYC A;  2IFM A;  3P7K A;  2J0G A;  5AW4 B;  3BVH C;  2KP8 A;  3B5N D;  1T2K D;  3CI9 A;  2I1J A;  1FZG B;  1LTJ C;  1L4A A;  2HOD A;  3V2P A;  1PFI A;  3V2N A;  2YKP A;  1H88 A;  3L37 A;  2IFN A;  5APW A;  2J0Y A;  1H89 A;  1L0N K;  1RE3 A;  2XDJ A;  5AW9 B;  2J60 A;  1VPC A;  2LKM A;  3HRN A;  1JTH A;  3GHG B;  4WB4 A;  2JHH C;  4WY4 C;  2P67 A;  3HUS C;  1NU1 K;  1N73 A;  4Y99 C;  1NKZ B;  4I1L A;  5KLV K;  3NFQ A;  2GY7 A;  1LT9 A;  1FBM A;  2H8P D;  3VTP C;  2Q9I C;  1L4A B;  2J59 M;  2HLO A;  2HOD B;  1CI6 A;  2KB7 P;  4I2L C;  3SWF A;  3A2A A;  5BU5 A;  1FZB A;  2IX7 C;  1E5W A;  5CCH A;  1RE3 B;  2Q7C A;  2H43 A;  1M7L A;  4LGD E;  1N86 C;  1JTH B;  3M0D C;  2YKQ A;  2OYH A;  4C7N A;  3A7O A;  1N7S A;  1N73 B;  1HVV A;  4HYT B;  1IFM A;  1QL1 A;  2R5B A;  3EFG A;  2L5G B;  2HFE D;  1GTW A;  1LT9 B;  5CCG D;  2XNX C;  1AFO A;  1KFM A;  3HE5 A;  2FFD C;  2HLO B;  1CI6 B;  1KIL C;  2O01 H;  2KLV A;  2WSE H;  5AW2 B;  5AVR B;  5KJ7 D;  1AQ5 A;  1FZB B;  1URQ C;  4IFD K;  1FZE A;  5AW1 B;  4W80 A;  2H43 B;  1QL2 A;  2Q5U A;  1GL2 C;  3BRV B;  2OYH B;  4ZFG A;  4C7N B;  2OYI A;  1N7S B;  1IC2 A;  1FZF C;  2N9B A;  1G2C A;  5APS A;  3BVH A;  3WMM 0;  1RY3 A;  3EQ2 A;  3HE5 B;  1JUN A;  5AVV B;  2J5Z A;  1RE4 C;  1RF0 A;  4AQR D;  1LTS C;  2D39 A;  1FZE B;  3RL0 C;  1L4A D;  2KYV A;  2OYI B;  1YYC A;  2J3G A;  3L4F A;  1G2C B;  1NOH A;  1XTC C;  2POH A;  1SFC C;  1L0L K;  3BVH B;  1A02 J;  5AVS B;  5AVT B;  2N1T C;  3R2P A;  1W2E A;  4JZC A;  2WPQ A;  4N78 E;  2Q9I A;  2JHI F;  1RF0 B;  2QM7 A;  5APY A;  3RK3 B;  1JOC A;  4NYT A;  1LTG C;  3G3Z A;  3HD7 C;  2J1G A;  1LTT C;  4HH2 A;  2R32 A;  3I5C A;  3V5B A;  2C9N Y;  1HUC A;  3A3Y B;  5CJ4 A;  2W6A A;  4LC1 A;  3MUD A;  3NTN A;  5CCH D;  2M3B A;  2J61 A;  2JHL F;  3VP9 A;  1NH4 A;  3TNU A;  3E1I C;  2Q9I B;  4GT1 A;  2FFD A;  1CW5 A;  1N7S D;  3H32 C;  1YTZ T;  3P32 A;  2XV5 A;  1URQ A;  1A02 F;  3RK2 C;  1M1J A;  2Z4E A;  2YO2 A;  1J1D B;  3UIA A;  1FAV A;  2J3F A;  1IJD B;  1GK4 A;  4W7Z A;  2J61 B;  4EPU A;  2PAJ A;  2XZR A;  5AW0 B;  3FIB A;  4IFM A;  1GW4 A;  3TNU B;  3IFM A;  2FFD B;  3P8M C;  1RF1 C;  1JY3 P;  1RE4 A;  1LGH B;  2O1K A;  1FID A;  1URQ B;  3VOP A;  1X9V A;  1M1J B;  2Z4E B;  3TYY A;  2FYZ A;  4I6M C;  3BRT B;  2E42 A;  5AW3 B;  2P2U A;  3RK3 D;  3KDP B;  3MIW A;  3C9I A;  5CMZ A;  1NTZ K;  3OAK A;  1SFC A;  2YMY A;  2H7H A;  3NXS A;  2N1T A;  2ZFC A;  5APU A;  1XTG B;  3KQG A;  4EIJ A;  4ZKP A;  1HJB A;  1J1E B;  2GM4 A;  1RE4 B;  3V2Q A;  2C0W A;  3RL0 B;  2Z5I A;  4B86 A;  3M9Q A;  5AVX B;  4AYC A;  1NAF A;  1FIB A;  1FZC A;  3KPE A;  1JMM A;  1SFC B;  1GD2 E;  3MGN A;  4XE5 B;  2N1T B;  2A45 G;  2JHM F;  2HPC C;  3H32 A;  4W7Y A;  3H6P A;  1NHL A;  1DH3 A;  1MZ9 A;  2FKW B;  1MFZ A;  3VYI A;  1FZC B;  2O1J A;  3P8C D;  1GW3 A;  1URQ D;  5APV A;  2FXM A;  1VDF A;  1HBW A;  1Z3S A;  3CL3 D;  3H32 B;  3TK1 A;  1LTJ A;  1RF1 A;  1JO5 A;  1Z3U A;  2J3F D;  1DEB A;  1NTM K;  2QM8 A;  2Q3I A;  1T3J A;  2JJL A;  3RK2 B;  2J58 A;  4DOJ A;  1ZR4 A;  4GKG A;  3MTU E;  1IFN A;  5APX A;  4C46 A;  3LW5 H;  3T97 A;  2M8R A;  3L35 A;  4RES B;  4WY4 A;  1IFD A;  3HUS A;  3SWY A;  5KTB A;  3RL0 D;  1SQB K;  2J0H A;  3N4X A;  4XA4 A;  4EOT A;  2P7J A;  1SLQ A;  1S9K E;  4R9T A;  5AW7 B;  1FU1 A;  1LTJ B;  1RF1 B;  1L4A C;  2HOD C;  1LWU C;  1SFC D;  2NPS C;  2FYU K;  2XKM A;  2N1T D;  1RE3 C;  1N86 A;  3M0D A;  3KYQ A;  1WRG A;  4WY4 B;  3HUS B;  3LIE A;  4AUW A;  1NKN A;  1IK9 A;  3V4W A;  2J3U A;  1KFN A;  4Y99 B;  1T3U A;  3PP5 A;  2XNX A;  3V4Q A;  2FIB A;  2R5D A;  2HPC A;  2ZXE B;  3VMZ A;  1KIL A;  4M3L A;  5BU8 B;  5CCH C;  2H43 C;  5BVZ A;  1N86 B;  1GL2 A;  4O9B A;  3BAS A;  5APQ A;  2OYH C;  4R9J A;  2WWW A;  3U1C A;  1N7S C;  1FZF A;  1OXZ A;  1SQX K;  3M9H A;  3O8Z A;  1FZA C;  1IFJ A;  3RK2 D;  1JCD A;  1EQ7 A;  2XNX B;  2HPC B;  4N3Y B;  1KIL B;  1FJK A;  1JY2 P;  2Z5H A;  2KOG A;  3M91 A;  1FZE C;  1IFI A;  1GL2 B;  1SVF A;  2YKO A;  1ZV8 A;  2WSC H;  3B5N C;  3V2R A;  1T2K C;  1FIC A;  3CLQ A;  2OYI C;  1FZF B;  2R3C A;  1GK6 A;  1HGV A;  2A45 I;  5AVY B;  3M0A A;  4C7R A;  1KZU B;  3M9B A;  4WY4 D;  1LWU A;  1RF0 C;  4N6J A;  2NPS A;  3RK3 C;  1HH0 A;  4DZO A;  1JNM A;  3HD7 A;  1S9K D;  1FOS E;  4N78 D;  1GU4 A;  3M06 A;  3N7N A;  1GZL A;  3NMD A;  2YNY A;  5AW8 B;  1MV8 A;  1FZD A;  3E1I A;  1LWU B;  3MD0 A;  1CZQ A;  1JC9 A;  2NPS B;  4WBA A;  3HD7 B;  4JYB A;  2HYN A;  1JY3 N;  1SQQ K;  1J1D C;  1JY2 N;  1OWA A;  1H8A A;  1SQV K;  1J2J B;  1KIL D;  5CCG C;  1GDT A;  2C9L Y;  1FZA A;  5KJ7 C;  2J64 A;  4M7H A;  5AVZ B;  3E1I B;  1GL2 D;  3OA7 A;  2A45 H;  2WPR A;  1NO4 A;  4GIF A;  1FZG C;  2I1K A;  3B8E B;  1GU5 A;  1HWT C;  5AVQ B;  4JF7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...