2HPCB

Crystal structure of fragment d from human fibrinogen complexed with gly-pro-arg-pro-amide.
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
307
structure length
307
Chain Sequence
LYIDETVNSNIPTNLRVLRSILENLRSKIQKLESDVSAQMEYCRTPCTVSCNIPVVSGKECEEIIRKGGETSEMYLIQPDSSVKPYRVYCDMNTENGGWTVIQNRQDGSVDFGRKWDPYKQGFGNVATNTDGKNYCGLPGEYWLGNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGGFTVQNEANKYQISVNKYRGTAGNALMDGASQLMGENRTMTIHNGMFFSTYDRDNDGWLTSDPRKQCSKEDGGGWWYNRCHAANPNGRYYWGGQYTWDMAKHGTDDGVVWMNWKGSWYSMRKMSMKIRPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Blood clotting
molecule keywords Fibrinogen alpha chain
total genus 66
structure length 307
sequence length 307
chains with identical sequence E, H, K
ec nomenclature
pdb deposition date 2006-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2hpcB01
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 2hpcB02
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 2hpcB03
3H32C 1FZCC 1RF0B 2J61B 3BVHB 3HUSC 4JYOX 2OYIC 1RF1A 2FIBA 3GHGB 2A45G 2J3FD 2J60A 2OYHB 1M1JC 1N86B 2J3FA 3E1IB 4R9TA 1FZGA 2Q9IC 2Z4EB 2J2PA 1FZAB 2HODB 4ZFGA 2HLOA 2A45H 1LT9B 1LTJC 1RE4C 4NYTA 1FZEB 1FZBC 1JY3O 2HPCC 3H32A 4M7HA 2J3OA 1JC9A 4JZCA 1RE3A 3HUSB 2H43C 1LTJA 1RE4A 1FZFA 2J0YA 1JY3N 1FZDA 1FZCA 2XNXC 4R9JA 1FZGC 2FFDB 1N73C 1FZAA 2HODA 2A45I 1M1JA 2XNXA 2HLOC 2JHMF 1RF1C 1RE3B 1LWUB 2H43A 2Q9IA 3GHGA 3HUSA 2OYHA 1FZFB 3H32B 2J3GA 3BVHC 2J3UA 1W2EA 3GHGC 2OYIA 1FZBA 1N86C 2J5ZA 1Z3SA 2J1GA 1LWUA 2FFDA 2OYHC 1JY3P 1RF0A 2J0HA 2J61A 3E1IC 2XNXB 1JY2P 2FFDC 3FIBA 1N73B 2Z4EC 1FZEC 1FZAC 1FZBB 2HODC 2JHLF 1LTJB 1LT9C 1RE4B 1RF0C 1FZCB 2HPCA 2JHKF 2OYIB 1LT9A 1FICA 2JHIF 1M1JB 1FZEA 1JY2N 2J64A 2H43B 2Q9IB 2J0GA 3E1IA 3BVHA 1N73A 2GY7A 1T3UA 1FZGB 1RF1B 4EPUA 2Z4EA 2D39A 1N86A 1FIDA 1FZFC 2HLOB 1JY2O 1Z3UA 2WNPF 4M7FA 2HPCB 1RE3C 1FIBA 1LWUC 2JHHC
chains in the Genus database with same CATH superfamily
1GTWA 4IL6E 3KZIE 3M9HA 1HBWA 3GHGB 3CMAP 2J3FD 3SSUA 1MKMA 4IFMA 1SQVK 3E7KA 3CX5D 2KZJA 2NPSC 1NU1K 2AXCA 1K9MQ 3W68A 3D70A 2V7QH 5TISE 2JJLA 3D6YA 1RE3A 3P8CE 2KNCA 3WUTA 2KXPB 1AFOA 1KV4A 1FS0E 3CXHE 1XTGB 1SQXK 1AVYA 2BCCG 2OYHA 1VF5C 1SQQD 2BCCE 1YITP 2D2CD 3OA7A 1EDJA 1Z3SA 2FYNB 2Q7CA 3L74D 1VQNP 2W27A 2N9BA 3V4WA 3AEGC 2D2CB 1KYOI 1BCCD 1UIIA 2JHKF 1J2JB 2FYUE 2J64A 3MUDA 2H43B 2B9BA 1S5LX 1WT6A 2M5AA 1IZNB 2JDIH 3MTUE 4JQ0D 1IJDB 3TGUJ 4M7FA 3H25A 2A06E 1CW5A 1QVFO 3PHLA 2ZVOB 5KAIE 2CK3H 2FIBA 4IL6H 2WSSH 2IZ1A 1MZ9A 2N1TB 2V4HA 5KLVD 1ZR2A 3SFDC 1KILC 3CX5I 4PD4D 1YJ9P 1NTMG 2OTLP 3L71G 3MZWB 1LTJA 1FZFA 1IC2A 1T2KC 3LW5J 4QMAA 1N73C 3M91A 4ZKUA 1IFIA 2XNXA 1YBKA 1OXZA 3QWOC 1KFMA 2KZIA 1AQ5A 1ZW0A 1SQQK 3GHGC 2OYIA 2Z5HA 3AE1C 3U1AA 2J0HA 3AE4C 4UB8E 1L4AD 1EDIA 2BASA 1Q82Q 1JY2P 2FFDC 1BSHA 3H6PA 1NU1J 1PIXA 1BSNA 3O6QB 3IF4A 1U7JA 1SFCA 5AW8B 1E79H 3L74J 1TU3F 4JPZB 2Q9IB 3Q3DA 2Q1KA 3L4FA 1NU1G 3RK2D 3CD6P 2K9JA 2N9YB 4R4LA 4ZKPA 1VQ9P 1NHLA 2ZYAA 1Z3UA 3CWBG 3B4SA 4W7YA 2WTYA 1JM0A 3M0DC 1N8RQ 3VMAA 1QGKB 1NTZE 3L70G 2VRSA 1RH5B 2R32A 5B66E 2NPSA 2WT7B 3G9RA 2AXTH 1NU1D 3MD0A 3CC4P 1LTJC 1P84I 5GTHE 1PGJA 2P1JA 1KZUB 3M0DA 4YXWH 3CMEP 1M90Q 2J0YA 1RQUA 4R9JA 1SQVE 3JCUE 2FKWB 5BVZA 1VQKP 5KLVJ 3L72G 1FAVA 1SQXD 1LJ2A 1S4XA 1NTKJ 4WY4B 4DZOA 2H43A 3A0BH 5KAIH 3H1IG 1GD2E 3FWLA 3CCVP 2Y0DA 4UB6E 2Y9ZA 2J58A 2KSEA 2B88A 3ITKA 2O01H 1QX8A 5CJ0A 1FOSE 4IFDK 3II6A 2XNDH 1FZBB 1VPCA 2NPSB 1NU1E 3MHVA 5KLIC 1Q81Q 4Z1MH 4GODA 3HRNA 2E74C 2KP8A 5TJHA 1PFIA 1UIXA 1N86A 4HYTB 3V5BA 5CCGD 2WNPF 5APVA 3TK1A 2HPCB 3AE6C 3HTKA 1JMMA 4XFJA 2IBZD 3E1IB 1GL2B 5AVQB 5APQA 2WSEJ 1X8YA 2Z5IA 1ZV8A 1URQD 1H0TB 1M57D 2P67A 1EDKA 5AVTB 2JEEA 3E1RA 1GU4A 4H0LD 1VQ4P 1SQBG 1L4AB 3AE8C 5KAFE 1LTTC 1SQVJ 1ZRTE 2QE7H 3H1LD 1PGPA 1NTMD 1G2CA 3HE4A 1IFPA 3EQ2A 4HH2A 1RE3B 5KLVG 4LC1A 3GF7A 5BU5A 1FZFB 2WSCJ 3NTNA 4GKGA 5KJ7D 2P10A 1JUNA 1L0NK 3C9IA 1KB9I 1VQPP 3FIBA 2JR8A 3PTZA 3GW6A 1SFCC 4W7ZA 2Q3IA 4PV1B 3RK3E 1VF5B 2Q6QA 2CPBA 1FZEA 1KORA 1NGMB 2FY8A 3Q2YA 3A3YB 1FZGB 3L36A 4HB1A 2XZRA 3H1KD 4PV1D 1USDA 3V2RA 3CL3D 1EC5A 1HH0A 3HUSC 2QSIA 2W6AA 1GZLA 2IBZG 3G4SP 1NTKK 2RKLA 3KXDA 3AE5C 2PP6A 5CCHD 4WBAA 5KLVK 4PD4I 5CBNA 4ZFGA 3L70D 1DEBA 3KZIH 4OGQD 2H8PD 1QVGO 2J3OA 5BU8B 2WPQA 2I1KA 3HTKB 3VYIA 1KYOH 2M5AB 1KB9D 2B89A 4ASVA 4ZNCA 3FXDA 3KPEA 3RL0C 4GIFA 2WSEH 3BVHC 5E79E 1PP9E 3SWYA 1ZN5A 3G71P 3CXHD 5GTIE 4A7PA 4GOFA 1MV8A 5AW7B 1EZVI 1G1JA 3HE4B 1EDLA 4XE5B 3L75J 3CLQA 4NPDA 3VP8A 3RL0g 5AW0B 2WMMA 3H1IJ 2W6JH 1CSBA 4HKZH 1PPJG 2PFXA 1FDOA 2J0GA 2FYUK 3NFQA 1URQB 4EPUA 3MGNA 3I5CA 3D71A 2IYPA 2D39A 3IR9A 1LWUC 1FE6A 4YXDC 1ZOYC 1SLQA 5DJUB 3H1JJ 3MP7B 2WZ7A 1L2PA 2BCCD 3S1KA 1N86B 3L73D 2I1JA 3BRTB 2Q9IC 3RL0B 1OW6A 2KLVA 1M7LA 1SFCB 1S2EA 1J1DC 1G2CB 4H13D 3H32A 5CHXA 1S9KD 1L0NE 2KUBA 3L71E 2FYUD 1HGZA 1FJPA 4AUWA 1RF1C 1USEA 1LP1A 4JBZA 1YTZI 2ZYGA 3R2PA 3SFEC 5CCGC 3F89A 2A06D 3FX0A 4KHXA 1L0LG 3WU2H 4IFFA 3RK3B 2J1GA 2IBZI 1RF0A 2J61A 2KSJA 1SQVG 3GF3A 3L75E 2C0WA 3U1CA 4NPFX 1FZAC 1VQLP 1DD4A 4KT0J 1A02J 4Y28J 2J59M 3L75G 4U3FE 4YTPC 5KAFH 2KIKA 2WSCH 1AQTA 1MFZA 2HR3A 4WVZA 2OGUA 1JY2O 2QJKB 2QM7A 3H1JE 2FYNC 1HWTC 4U7JA 5CCHA 2RH0A 2ZYDA 3JSVC 2OYHB 2IX7C 1BGYJ 3PH0A 1PP9G 1GW3A 4L74A 4OWFA 4N3YB 1N7SB 1DH3A 3Q5RA 1S3JA 2B87B 1SQXG 2ZT9C 2HPCC 3VOPA 2FYZA 4AYCA 1P84D 2KS1B 5L8RJ 1FDMA 4N78E 2H43C 1LTBC 4U3FD 1NTMK 1FZDA 4KJMA 2JWAA 5AW4B 5M1BA 5EFWB 1KQSO 2YXRB 3L72E 3GHGA 1DD3A 3L35A 1ZR4A 4M3LA 3BRVB 2M8RA 4JYCA 2J5ZA 1NVOA 5KKZC 1JY3P 1PL5A 1IFMA 1Q90D 2WPSA 1X22A 2W6BA 3AEAC 4O9BA 2JHLF 1RE4B 2WT7A 1XTCC 1FZCB 4IOIH 4RJTA 2C9NY 3FWNA 1H8AA 1N7SA 4R4MA 2POHA 3M0AA 2YKQA 1KD1Q 3PRJA 1HUCA 2W90A 1NTMJ 2ZT9B 3QH9A 2E75C 1X9VA 3G6EP 3BVHB 3CCLP 4GOEA 5AW3B 1M1JC 1OVRA 3B71A 1EXIA 1BGYE 1J1EC 4ASWA 3CWBE 4CPGA 2Q5UA 3MUDC 1NTZG 2GUVA 2GUSA 3L74G 1WMKA 2YXQB 2R3SA 1PGQA 1JY3O 3TDKA 1K04A 5DJTB 1QLED 2YKPA 2YMKA 3IAOA 3HUSB 1RE4A 1P84H 5AVWB 3I55P 1VQ5P 2R44A 1FZAA 4OVNF 2PAJA 2QJKC 3TF5A 2Q9IA 3IN6A 1W2EA 1KILA 4N6JA 2E74B 1ZRTD 2KYVA 3I56P 5CJ4A 3CX5H 1Q86Q 2DW3A 3H1ID 4ZMDA 1D7MA 3HE5A 1FZEC 3AEEC 2HODC 3L70J 1OIPA 3H1KG 3A5TA 1M1JB 2FYUJ 3FGAD 4Y99C 3VMXA 1MUUA 3PLNA 1KQLA 1VDFA 2IZ0A 4L75A 1KTMA 3WMM0 1VQ6P 3V2NA 2GM4A 3IFMA 1NTME 1SQPJ 1NH4A 3VTPC 1AA0A 1FIBA 1FJKA 2JHHC 1E5WA 1L0NG 2LXCB 1EZVG 3RK2C 5KKZB 3CCMP 4PJ0H 3CXHI 4WWIA 1SQPG 4RKUJ 2Z4EB 2WWWA 3TGUD 2A45H 1RE4C 1BE3J 3P7KA 2QEXP 1YQ3C 3CCJP 1FBMA 4OGQC 3HD7D 2JO1A 2C0XA 1WRGA 1LT1A 2QJPB 1BE3G 1YYCA 1SFCD 4PD4H 1CI6B 1KYOE 2J3GA 2WSFJ 2KS1A 4I6MC 3L73G 4PJ0E 4Y99B 1NO4A 4I2LC 3V2PA 1IFJA 2ITAA 1BE3D 1EXJA 2WITA 4H44C 2OTJP 1PGOA 1AJYA 1N7SC 3L70E 3TNUA 2LXBA 2R5DA 2AEFA 5AVXB 2QIWA 1L4AC 3AE9C 3L74E 2JP3A 2K9YA 2K1AA 3RBZA 1NAFA 5APXA 3BVHA 2WVRA 2QA4P 1KB9E 4JF7A 2ZVNB 2IYOA 5GTIH 2XU6A 5AW1B 1OFCX 1SQPE 1Q2NA 1S1CX 4H0LC 1JMBA 2FXMA 3H32C 1LTAC 1R5LA 5AW5B 2K9JB 1PP9D 4EIJA 2NPSD 3HD7A 5AVZB 3S4RA 2P58A 1BE3E 1ZLLA 2E76C 2SPZA 1FZBC 2ZXEB 2RN0A 2E74D 2L5GB 2KK7A 4YPCA 1YQ4C 1NKZB 1NJIQ 1ZMEC 4EYYQ 1JY3N 1BDCA 1FZGC 2LR2A 1N7SD 5KLVE 3NXSA 1T3JA 3OW2O 2HODA 3O8ZA 4PD4E 5B66H 2JHMF 2FXPA 1NTKE 3OAKA 3HUSA 1PZQA 1L0ND 2BCCJ 2E75B 1BDDA 2GA1A 3L71D 1AVOA 1W2BO 3RGUA 2ZAEB 4DT0A 1JOCA 2YO3A 1NYHA 2NRGA 3E1IC 2M0BA 1VQOP 1J1EB 3JC22 1LGHB 1Z56A 3WUUA 1KMIZ 3A2AA 4H0LB 1NKNA 3V6IA 2HPCA 1T8ZA 3CCQP 2C9LY 1JTHB 3RL0D 2O1JA 3E1IA 2O1KA 3T97A 1S9KE 5AVRB 3LW5H 2Z4EA 3A0HE 2HLOB 1Y8AA 3VMZA 2G8YA 1RE3C 1NTKD 1FZCC 2M3EA 1L0LK 2RMZA 2A45G 3BATA 3NMDA 5H2FH 4R9TA 1FZGA 1OMIA 4NPEA 5E79H 2AXTE 1SQVD 1OVVA 2D2CC 3ZDMA 1FZEB 3H1JD 4BWNA 3B5ND 1ZXGA 4PV1C 1GK4A 2V7QJ 5AVYB 1GK6A 4IL6X 1SQBD 5B5EE 1A02F 2FFDB 1FU1A 3CCRP 5K5GB 3H1JG 1OWAA 2P7JA 3GMAA 1LWUB 2YO2A 1P84E 3D6ZA 4N78D 3N4XA 1LNQA 4BRYB 3N7NA 3B8EB 5CCHC 5CBOA 1GMJA 1H0TA 2FFDA 4GT1A 2XNXB 3L72D 2Z4EC 1KILB 1K05A 1SQQG 3T97B 3KHUA 1K73Q 4BRYA 1EZVD 2WPRA 3A0HH 4OGQB 2E5TA 1VQ7P 2QVAA 1YHQP 1N73A 2QJPC 2OTKE 2IBZE 3M06A 5AVVB 1T2KD 1OX3A 4TT3H 2HYNA 3A0BE 2QRXA 1KQFB 1CZQA 3CCSP 1NTZJ 3H1HD 4TLFA 1Y9BA 1HF9A 2ZJSE 1GW4A 5AVSB 1LT9B 1S5LE 2Y9YA 1JC9A 3BCCG 1S72P 1RY3A 2N1TA 1RHZB 2XNXC 1M8OB 4BXLA 1HTLC 1KC8Q 3L37A 2HLOC 1L0LD 2AEJA 5KLIB 2FBWC 2H89C 1NTZK 4WB4A 2R3CA 1PP9J 2YIUB 1S5LH 4LLHA 3TGUG 1SVFA 2Q3EA 1DIPA 3H1HE 1SS1A 2O01N 4H13C 1BGYD 4RO0A 3CWBD 2K88A 5APTA 4H44D 3AECC 1LT9A 1YJNP 1PPJD 3H1IE 2O01J 2NZ2A 4D6TG 3CXHH 2B87A 3R4YA 2J5UA 1G1IA 1KN7A 5APWA 2YNYA 2MJZA 3CX5E 4H44B 3BASA 1PV3A 3O6QA 5APSA 2QM8A 1T6AA 1KB9H 3CPWO 2HFED 2N1TD 5KTBA 4XA4A 4MN4C 4EOTA 1NTKG 2KLUA 1M56D 4NYTA 1JNMA 2H88C 5APYA 2BEQD 3WU2E 1MFTA 1DX7A 3W67A 1X79B 4I7ZC 1SQQE 3KDPB 1JCCA 1FC2C 4GDOA 4DJGA 2A45I 1M1JA 3P8MC 5C39A 2E43A 2QJYB 3PJSK 3K5BA 3PP5A 3RBXA 5CMZA 1H88A 2ZFCA 1BCCE 1L4AA 2ZXXA 1GL2C 2A06G 3H1HJ 1LP1B 2OYHC 5H2FE 5KJ7A 1W5CE 1KYOD 1HGVA 3VP9A 3AE7C 1N73B 1U7MA 1R5SA 1LTJB 2G3AA 3USSA 4B86A 1YTZT 3RK2B 1NAYA 2JHIF 1KQGB 2AEMA 3V4QA 3EFGA 4WY4A 3B5NC 1SQXJ 3RK3C 4L73A 3HE5B 3L73E 2IFNA 1FZFC 2L91A 2PGDA 2YIUC 3BCCJ 3CI9A 2QG4A 4LGDE 1RF0B 2J61B 2KOGA 1CI6A 2FXOA 4JYOX 1BGYG 3Q1MA 2OYIC 3AE2C 2J3FA 2BEZF 3KQGA 4H13B 3B5NA 2J2PA 2HODB 1VF5D 5AVUB 1SP4A 4D6TD 2PRRA 3CCUP 4M7HA 4JYBA 3SWKA 1QL2A 3EWKA 1Q7YQ 1SQQJ 4WY4D 4OH8B 2I8DA 3GG2A 3TYYA 5KJ7C 3VMYA 1GU5A 1IO4A 1BCCG 3CC2P 1OVUA 3BCCD 3V2QA 1NTZD 3L75D 2J3UA 1SQPD 1BCCJ 2WPVB 1LTSC 1LWUA 3M9QA 1URQC 4C7RA 1LT9C 1RF0C 1URQA 4D6TE 2OYIB 1SQBK 3GLMA 2YKOA 2MKVA 1VQ8P 2W83C 4AQRD 1SQXE 1R8EA 1T3UA 5TISH 3L73J 3P32A 2E76B 3H1HG 3HD7C 3BCCE 3VN0A 1HJ0A 2OARA 2WQYC 3KYQA 1HJBA 5AW2B 1RF1A 3SWFA 2KNCB 1FDIA 3CWBJ 3WUVA 2W8ZA 3ABVC 1AV1A 3AE3C 1NOHA 3TSIA 2UWJE 2Y0CA 1Y47A 3LIEA 4RESB 1X0TA 1L0NJ 2E42A 2IDBA 5APUA 4DCKA 3L71J 3H1KJ 1FOSF 3G3ZA 2M3BA 2YMYA 2XDJA 4W80A 4C46A 2WSFH 5AW6B 5CCGA 3H32B 1M1KQ 1SQBE 4C7NA 1GL2A 1NWQA 1DEEG 1SQPK 1EQ7A 1N86C 3LIDA 3MIWA 3TNUB 3S9OA 1YJWP 1RQVA 1QEXA 1L0LJ 3A7OA 2N1TC 2K37A 2P2UA 3HD7B 3Q5PA 2O3JA 3H1LG 4U3FJ 4D6TJ 3F5HA 4UB8H 3AEDC 3UIAA 1U57A 3H1LE 4I7ZB 1JY2N 4K3AA 2LKMA 1KILE 1YI2P 1GDTA 2GY7A 4K35A 1RF1B 4HJGH 1OW7A 4DOJA 1FIDA 1KFNA 1VL2A 4EDFA 3AEBC 3C1LA 2QJYC 1JTHA 2XKMA 2JKVA 2ZT9D 2R5BA 2J60A 1JCDA 1N7LA 3Q5SA 1N2DC 2H7HA 3CCEP 1IK7A 4WY4C 3EFFK 1FZAB 2HLOA 2IFMA 2OQQA 3RK3D 1ZP0C 4UB6H 1H89A 2IPPA 1YIJP 4JZCA 1OZHA 1IK9A 1EZVE 1FZCA 3C8VA 3B5NB 3H1KE 1KILD 1OW8A 3L72J 2XV5A 2KI7B 2OYOA 1SQBJ 1IFNA 3OJAB 3U59A 1FZBA 2KB7P 3CC7P 1LTIC 2K3RA 5GTHH 1QL1A 2CPSA 5AW9B 1K8AQ 1L0LE 2E76D 1VQMP 3FXEA 1JO5A 1JEKA 4C7NB 1IFDA 2E5YA 3P8CD 1J1DB 1JB0J 4L76A 1FICA 2Y0EA 3M9BA 4EI2A 3H1LJ 4U3FG 2JWDA 1HVVA 4I1LA 2HG5D 2E75D 3JCUH 1GL2D 3TGUE 2FYUG 1LTGC 3AEFC 5B5EH 1PPJE
chains in the Genus database with same CATH topology
1GTWA 1HH0A 2QM8A 3HUSC 2W6AA 3RK2C 1GZLA 3M9HA 1HBWA 3GHGB 1NTKK 2J3FD 2HFED 2N1TD 5KTBA 4XA4A 4IFMA 1SQVK 2PP6A 3V2RA 5CCHD 4WBAA 5KLVK 4EOTA 2Z4EB 2WWWA 4ZFGA 2A45H 2NPSC 1NU1K 1RE4C 4NYTA 1DEBA 1JNMA 5APYA 3P7KA 2H8PD 1DX7A 2J3OA 5BU8B 2JJLA 2WPQA 2I1KA 1FBMA 1X79B 3HTKB 1RE3A 3P8CE 3VYIA 3HD7D 3KDPB 1JCCA 2C0XA 1AFOA 1WRGA 1YYCA 1SFCD 3KPEA 2A45I 1M1JA 3P8MC 3RL0C 1XTGB 1CI6B 1SQXK 4GIFA 2E43A 2OYHA 2J3GA 2WSEH 3PP5A 3BVHC 5CMZA 3SWYA 1ZN5A 3OA7A 4I6MC 1H88A 2ZFCA 4Y99B 1L4AA 1NO4A 1Z3SA 1GL2C 4I2LC 1MV8A 5AW7B 3V2PA 2OYHC 2Q7CA 1IFJA 5KJ7A 1G1JA 3HE4B 2W27A 1HGVA 4XE5B 3VP9A 1N73B 2WITA 2N9BA 3CLQA 3V4WA 3VP8A 1LTJB 1N7SC 5AW0B 3TNUA 4B86A 1YTZT 2JHKF 2R5DA 3RK2B 5AVXB 1J2JB 2JHIF 1L4AC 3V4QA 1CSBA 2J64A 3EFGA 4WY4A 3MUDA 3B5NC 2H43B 2J0GA 1NAFA 5APXA 3BVHA 3RK3C 2FYUK 3NFQA 1URQB 4JF7A 3HE5B 3MGNA 3I5CA 4EPUA 1WT6A 2D39A 2IFNA 3MTUE 1FZFC 2XU6A 5AW1B 1IJDB 4M7FA 3IR9A 1LWUC 1CW5A 3CI9A 2FXMA 3H32C 4LGDE 1RF0B 2J61B 2KOGA 1SLQA 1CI6A 4JYOX 1LTAC 5AW5B 2OYIC 2WZ7A 2FIBA 4EIJA 1N86B 2NPSD 2J3FA 3HD7A 2I1JA 5AVZB 3KQGA 3BRTB 2Q9IC 3RL0B 2KLVA 3B5NA 2J2PA 1M7LA 1MZ9A 2HODB 1SFCB 2N1TB 5AVUB 1SP4A 1ZR2A 1ZLLA 1J1DC 1KILC 2ZXEB 1FZBC 1G2CB 3H32A 2L5GB 4M7HA 4JYBA 5CHXA 1S9KD 1QL2A 1NKZB 1LTJA 1FZFA 1IC2A 4WY4D 1JY3N 4OH8B 1T2KC 3TYYA 1FZGC 5KJ7C 3VMYA 1GU5A 1N7SD 1N73C 3NXSA 1T3JA 2HODA 1IO4A 3M91A 3O8ZA 1HGZA 4ZKUA 1IFIA 1FJPA 2XNXA 1OXZA 4AUWA 2JHMF 1RF1C 3V2QA 1KFMA 3OAKA 3HUSA 1YTZI 2J3UA 3R2PA 1AQ5A 5CCGC 1SQQK 3GHGC 2OYIA 2Z5HA 4KHXA 1LTSC 1JOCA 4IFFA 3RK3B 2J1GA 1LWUA 3M9QA 3U1AA 2YO3A 1URQC 2J0HA 1RF0A 2J61A 3E1IC 1L4AD 2KSJA 2BASA 1J1EB 1JY2P 2FFDC 1LGHB 4C7RA 3U1CA 2C0WA 1Z56A 1FZAC 3H6PA 3A2AA 1LT9C 1A02J 2J59M 1NKNA 1RF0C 1URQA 2HPCA 1T8ZA 2OYIB 1SQBK 1SFCA 2YKOA 5AW8B 2C9LY 1JTHB 4AQRD 3RL0D 2WSCH 2Q9IB 2O1JA 3E1IA 2O1KA 3T97A 1S9KE 3L4FA 3RK2D 1MFZA 1T3UA 5AVRB 3LW5H 2Z4EA 4ZKPA 3P32A 1NHLA 2HLOB 1JY2O 1Z3UA 3VMZA 4W7YA 2WTYA 2QM7A 1RE3C 3M0DC 3HD7C 3VN0A 1FZCC 1L0LK 2OARA 3KYQA 1HJBA 5AW2B 2VRSA 5CCHA 1HWTC 2R32A 1RF1A 2A45G 3BATA 3NMDA 3SWFA 2OYHB 2NPSA 2IX7C 2WT7B 4R9TA 1FZGA 1GW3A 4N3YB 3MD0A 1LTJC 1N7SB 1DH3A 1FZEB 1NOHA 3TSIA 2HPCC 3VOPA 2FYZA 3B5ND 2P1JA 3LIEA 4RESB 4AYCA 1KZUB 1FDMA 3M0DA 1GK4A 5AVYB 1GK6A 4N78E 2H43C 1LTBC 2E42A 1NTMK 5APUA 2J0YA 1FZDA 1A02F 4R9JA 2FKWB 5BVZA 2FFDB 1FU1A 5AW4B 1FOSF 1FAVA 3G3ZA 1OWAA 2M3BA 4WY4B 2YMYA 2P7JA 2XDJA 1LWUB 4W80A 4C46A 4DZOA 2WSFH 3GHGA 5AW6B 2YO2A 2H43A 5CCGA 3H32B 3L35A 4N78D 4M3LA 3N4XA 4C7NA 1ZR4A 1GL2A 3BRVB 2M8RA 4JYCA 1NWQA 3N7NA 1GD2E 3B8EB 5CCHC 1SQPK 1EQ7A 1N86C 3LIDA 2J5ZA 3MIWA 3TNUB 2J58A 2FFDA 1JY3P 1IFMA 2WPSA 4GT1A 2XNXB 2W6BA 3A7OA 2N1TC 4O9BA 2O01H 2Z4EC 5CJ0A 1FOSE 4IFDK 3II6A 1KILB 2P2UA 1FZBB 2JHLF 1VPCA 2NPSB 3HD7B 1RE4B 2WT7A 1XTCC 1FZCB 2C9NY 1H8AA 1N7SA 2WPRA 3UIAA 2POHA 3HRNA 1JY2N 2LKMA 3M0AA 2KP8A 1GDTA 1PFIA 2YKQA 1N73A 3M06A 2GY7A 1RF1B 5AVVB 1HUCA 4DOJA 1N86A 4HYTB 3V5BA 1T2KD 5CCGD 1FIDA 2WNPF 5APVA 3TK1A 1KFNA 2HYNA 2HPCB 1X9VA 1CZQA 3BVHB 1JTHA 2XKMA 3HTKA 1JMMA 2J60A 2R5BA 5AW3B 1JCDA 1M1JC 1N7LA 3E1IB 1J1EC 1GL2B 1N2DC 2H7HA 5AVQB 5APQA 1GW4A 5AVSB 2Q5UA 1X8YA 4WY4C 1FZAB 2Z5IA 2HLOA 1LT9B 2IFMA 1ZV8A 2GUVA 1URQD 2GUSA 3RK3D 2P67A 1E5WA 1JY3O 1H89A 2IPPA 1JC9A 5AVTB 4JZCA 2YKPA 2JEEA 1GU4A 3HUSB 1RE4A 1RY3A 1L4AB 1IK9A 2N1TA 5AVWB 1FZCA 2XNXC 1LTTC 1HTLC 3B5NB 3L37A 1FZAA 1G2CA 1KILD 3HE4A 2HLOC 2PAJA 3EQ2A 4HH2A 1RE3B 4LC1A 2Q9IA 2XV5A 5BU5A 1FZFB 1NTZK 4WB4A 1IFNA 3NTNA 2R3CA 3OJAB 3U59A 1W2EA 4GKGA 1FZBA 1KILA 5KJ7D 4LLHA 2KB7P 4N6JA 1LTIC 2KYVA 1JUNA 1L0NK 1SVFA 1QL1A 5CJ4A 3C9IA 2CPSA 5AW9B 3FIBA 3HE5A 1FZEC 1JO5A 2HODC 1SFCC 4W7ZA 2Q3IA 5APTA 4C7NB 1IFDA 3P8CD 1J1DB 3A5TA 1LT9A 1FICA 2CPBA 1M1JB 3M9BA 1FZEA 4Y99C 3VMXA 1MUUA 1HVVA 3A3YB 1KQLA 1VDFA 4I1LA 3WMM0 3V2NA 2HG5D 1FZGB 3L36A 1G1IA 1GL2D 2XZRA 5APWA 2GM4A 3IFMA 2YNYA 2MJZA 3BASA 1NH4A 3VTPC 1LTGC 1FIBA 1FJKA 5APSA 2JHHC 3CL3D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H32 C;  1FZC C;  1RF0 B;  2J61 B;  3BVH B;  3HUS C;  4JYO X;  2OYI C;  1RF1 A;  2FIB A;  3GHG B;  2A45 G;  2J3F D;  2J60 A;  2OYH B;  1M1J C;  1N86 B;  2J3F A;  3E1I B;  4R9T A;  1FZG A;  2Q9I C;  2Z4E B;  2J2P A;  1FZA B;  2HOD B;  4ZFG A;  2HLO A;  2A45 H;  1LT9 B;  1LTJ C;  1RE4 C;  4NYT A;  1FZE B;  1FZB C;  1JY3 O;  2HPC C;  3H32 A;  4M7H A;  2J3O A;  1JC9 A;  4JZC A;  1RE3 A;  3HUS B;  2H43 C;  1LTJ A;  1RE4 A;  1FZF A;  2J0Y A;  1JY3 N;  1FZD A;  1FZC A;  2XNX C;  4R9J A;  1FZG C;  2FFD B;  1N73 C;  1FZA A;  2HOD A;  2A45 I;  1M1J A;  2XNX A;  2HLO C;  2JHM F;  1RF1 C;  1RE3 B;  1LWU B;  2H43 A;  2Q9I A;  3GHG A;  3HUS A;  2OYH A;  1FZF B;  3H32 B;  2J3G A;  3BVH C;  2J3U A;  1W2E A;  3GHG C;  2OYI A;  1FZB A;  1N86 C;  2J5Z A;  1Z3S A;  2J1G A;  1LWU A;  2FFD A;  2OYH C;  1JY3 P;  1RF0 A;  2J0H A;  2J61 A;  3E1I C;  2XNX B;  1JY2 P;  2FFD C;  3FIB A;  1N73 B;  2Z4E C;  1FZE C;  1FZA C;  1FZB B;  2HOD C;  2JHL F;  1LTJ B;  1LT9 C;  1RE4 B;  1RF0 C;  1FZC B;  2HPC A;  2JHK F;  2OYI B;  1LT9 A;  1FIC A;  2JHI F;  1M1J B;  1FZE A;  1JY2 N;  2J64 A;  2H43 B;  2Q9I B;  2J0G A;  3E1I A;  3BVH A;  1N73 A;  2GY7 A;  1T3U A;  1FZG B;  1RF1 B;  4EPU A;  2Z4E A;  2D39 A;  1N86 A;  1FID A;  1FZF C;  2HLO B;  1JY2 O;  1Z3U A;  2WNP F;  4M7F A;  2HPC B;  1RE3 C;  1FIB A;  1LWU C;  2JHH C; 
#chains in the Genus database with same CATH topology
 1GTW A;  4IL6 E;  3KZI E;  3M9H A;  1HBW A;  3GHG B;  3CMA P;  2J3F D;  3SSU A;  1MKM A;  4IFM A;  1SQV K;  3E7K A;  3CX5 D;  2KZJ A;  2NPS C;  1NU1 K;  2AXC A;  1K9M Q;  3W68 A;  3D70 A;  2V7Q H;  5TIS E;  2JJL A;  3D6Y A;  1RE3 A;  3P8C E;  2KNC A;  3WUT A;  2KXP B;  1AFO A;  1KV4 A;  1FS0 E;  3CXH E;  1XTG B;  1SQX K;  1AVY A;  2BCC G;  2OYH A;  1VF5 C;  1SQQ D;  2BCC E;  1YIT P;  2D2C D;  3OA7 A;  1EDJ A;  1Z3S A;  2FYN B;  2Q7C A;  3L74 D;  1VQN P;  2W27 A;  2N9B A;  3V4W A;  3AEG C;  2D2C B;  1KYO I;  1BCC D;  1UII A;  2JHK F;  1J2J B;  2FYU E;  2J64 A;  3MUD A;  2H43 B;  2B9B A;  1S5L X;  1WT6 A;  2M5A A;  1IZN B;  2JDI H;  3MTU E;  4JQ0 D;  1IJD B;  3TGU J;  4M7F A;  3H25 A;  2A06 E;  1CW5 A;  1QVF O;  3PHL A;  2ZVO B;  5KAI E;  2CK3 H;  2FIB A;  4IL6 H;  2WSS H;  2IZ1 A;  1MZ9 A;  2N1T B;  2V4H A;  5KLV D;  1ZR2 A;  3SFD C;  1KIL C;  3CX5 I;  4PD4 D;  1YJ9 P;  1NTM G;  2OTL P;  3L71 G;  3MZW B;  1LTJ A;  1FZF A;  1IC2 A;  1T2K C;  3LW5 J;  4QMA A;  1N73 C;  3M91 A;  4ZKU A;  1IFI A;  2XNX A;  1YBK A;  1OXZ A;  3QWO C;  1KFM A;  2KZI A;  1AQ5 A;  1ZW0 A;  1SQQ K;  3GHG C;  2OYI A;  2Z5H A;  3AE1 C;  3U1A A;  2J0H A;  3AE4 C;  4UB8 E;  1L4A D;  1EDI A;  2BAS A;  1Q82 Q;  1JY2 P;  2FFD C;  1BSH A;  3H6P A;  1NU1 J;  1PIX A;  1BSN A;  3O6Q B;  3IF4 A;  1U7J A;  1SFC A;  5AW8 B;  1E79 H;  3L74 J;  1TU3 F;  4JPZ B;  2Q9I B;  3Q3D A;  2Q1K A;  3L4F A;  1NU1 G;  3RK2 D;  3CD6 P;  2K9J A;  2N9Y B;  4R4L A;  4ZKP A;  1VQ9 P;  1NHL A;  2ZYA A;  1Z3U A;  3CWB G;  3B4S A;  4W7Y A;  2WTY A;  1JM0 A;  3M0D C;  1N8R Q;  3VMA A;  1QGK B;  1NTZ E;  3L70 G;  2VRS A;  1RH5 B;  2R32 A;  5B66 E;  2NPS A;  2WT7 B;  3G9R A;  2AXT H;  1NU1 D;  3MD0 A;  3CC4 P;  1LTJ C;  1P84 I;  5GTH E;  1PGJ A;  2P1J A;  1KZU B;  3M0D A;  4YXW H;  3CME P;  1M90 Q;  2J0Y A;  1RQU A;  4R9J A;  1SQV E;  3JCU E;  2FKW B;  5BVZ A;  1VQK P;  5KLV J;  3L72 G;  1FAV A;  1SQX D;  1LJ2 A;  1S4X A;  1NTK J;  4WY4 B;  4DZO A;  2H43 A;  3A0B H;  5KAI H;  3H1I G;  1GD2 E;  3FWL A;  3CCV P;  2Y0D A;  4UB6 E;  2Y9Z A;  2J58 A;  2KSE A;  2B88 A;  3ITK A;  2O01 H;  1QX8 A;  5CJ0 A;  1FOS E;  4IFD K;  3II6 A;  2XND H;  1FZB B;  1VPC A;  2NPS B;  1NU1 E;  3MHV A;  5KLI C;  1Q81 Q;  4Z1M H;  4GOD A;  3HRN A;  2E74 C;  2KP8 A;  5TJH A;  1PFI A;  1UIX A;  1N86 A;  4HYT B;  3V5B A;  5CCG D;  2WNP F;  5APV A;  3TK1 A;  2HPC B;  3AE6 C;  3HTK A;  1JMM A;  4XFJ A;  2IBZ D;  3E1I B;  1GL2 B;  5AVQ B;  5APQ A;  2WSE J;  1X8Y A;  2Z5I A;  1ZV8 A;  1URQ D;  1H0T B;  1M57 D;  2P67 A;  1EDK A;  5AVT B;  2JEE A;  3E1R A;  1GU4 A;  4H0L D;  1VQ4 P;  1SQB G;  1L4A B;  3AE8 C;  5KAF E;  1LTT C;  1SQV J;  1ZRT E;  2QE7 H;  3H1L D;  1PGP A;  1NTM D;  1G2C A;  3HE4 A;  1IFP A;  3EQ2 A;  4HH2 A;  1RE3 B;  5KLV G;  4LC1 A;  3GF7 A;  5BU5 A;  1FZF B;  2WSC J;  3NTN A;  4GKG A;  5KJ7 D;  2P10 A;  1JUN A;  1L0N K;  3C9I A;  1KB9 I;  1VQP P;  3FIB A;  2JR8 A;  3PTZ A;  3GW6 A;  1SFC C;  4W7Z A;  2Q3I A;  4PV1 B;  3RK3 E;  1VF5 B;  2Q6Q A;  2CPB A;  1FZE A;  1KOR A;  1NGM B;  2FY8 A;  3Q2Y A;  3A3Y B;  1FZG B;  3L36 A;  4HB1 A;  2XZR A;  3H1K D;  4PV1 D;  1USD A;  3V2R A;  3CL3 D;  1EC5 A;  1HH0 A;  3HUS C;  2QSI A;  2W6A A;  1GZL A;  2IBZ G;  3G4S P;  1NTK K;  2RKL A;  3KXD A;  3AE5 C;  2PP6 A;  5CCH D;  4WBA A;  5KLV K;  4PD4 I;  5CBN A;  4ZFG A;  3L70 D;  1DEB A;  3KZI H;  4OGQ D;  2H8P D;  1QVG O;  2J3O A;  5BU8 B;  2WPQ A;  2I1K A;  3HTK B;  3VYI A;  1KYO H;  2M5A B;  1KB9 D;  2B89 A;  4ASV A;  4ZNC A;  3FXD A;  3KPE A;  3RL0 C;  4GIF A;  2WSE H;  3BVH C;  5E79 E;  1PP9 E;  3SWY A;  1ZN5 A;  3G71 P;  3CXH D;  5GTI E;  4A7P A;  4GOF A;  1MV8 A;  5AW7 B;  1EZV I;  1G1J A;  3HE4 B;  1EDL A;  4XE5 B;  3L75 J;  3CLQ A;  4NPD A;  3VP8 A;  3RL0 g;  5AW0 B;  2WMM A;  3H1I J;  2W6J H;  1CSB A;  4HKZ H;  1PPJ G;  2PFX A;  1FDO A;  2J0G A;  2FYU K;  3NFQ A;  1URQ B;  4EPU A;  3MGN A;  3I5C A;  3D71 A;  2IYP A;  2D39 A;  3IR9 A;  1LWU C;  1FE6 A;  4YXD C;  1ZOY C;  1SLQ A;  5DJU B;  3H1J J;  3MP7 B;  2WZ7 A;  1L2P A;  2BCC D;  3S1K A;  1N86 B;  3L73 D;  2I1J A;  3BRT B;  2Q9I C;  3RL0 B;  1OW6 A;  2KLV A;  1M7L A;  1SFC B;  1S2E A;  1J1D C;  1G2C B;  4H13 D;  3H32 A;  5CHX A;  1S9K D;  1L0N E;  2KUB A;  3L71 E;  2FYU D;  1HGZ A;  1FJP A;  4AUW A;  1RF1 C;  1USE A;  1LP1 A;  4JBZ A;  1YTZ I;  2ZYG A;  3R2P A;  3SFE C;  5CCG C;  3F89 A;  2A06 D;  3FX0 A;  4KHX A;  1L0L G;  3WU2 H;  4IFF A;  3RK3 B;  2J1G A;  2IBZ I;  1RF0 A;  2J61 A;  2KSJ A;  1SQV G;  3GF3 A;  3L75 E;  2C0W A;  3U1C A;  4NPF X;  1FZA C;  1VQL P;  1DD4 A;  4KT0 J;  1A02 J;  4Y28 J;  2J59 M;  3L75 G;  4U3F E;  4YTP C;  5KAF H;  2KIK A;  2WSC H;  1AQT A;  1MFZ A;  2HR3 A;  4WVZ A;  2OGU A;  1JY2 O;  2QJK B;  2QM7 A;  3H1J E;  2FYN C;  1HWT C;  4U7J A;  5CCH A;  2RH0 A;  2ZYD A;  3JSV C;  2OYH B;  2IX7 C;  1BGY J;  3PH0 A;  1PP9 G;  1GW3 A;  4L74 A;  4OWF A;  4N3Y B;  1N7S B;  1DH3 A;  3Q5R A;  1S3J A;  2B87 B;  1SQX G;  2ZT9 C;  2HPC C;  3VOP A;  2FYZ A;  4AYC A;  1P84 D;  2KS1 B;  5L8R J;  1FDM A;  4N78 E;  2H43 C;  1LTB C;  4U3F D;  1NTM K;  1FZD A;  4KJM A;  2JWA A;  5AW4 B;  5M1B A;  5EFW B;  1KQS O;  2YXR B;  3L72 E;  3GHG A;  1DD3 A;  3L35 A;  1ZR4 A;  4M3L A;  3BRV B;  2M8R A;  4JYC A;  2J5Z A;  1NVO A;  5KKZ C;  1JY3 P;  1PL5 A;  1IFM A;  1Q90 D;  2WPS A;  1X22 A;  2W6B A;  3AEA C;  4O9B A;  2JHL F;  1RE4 B;  2WT7 A;  1XTC C;  1FZC B;  4IOI H;  4RJT A;  2C9N Y;  3FWN A;  1H8A A;  1N7S A;  4R4M A;  2POH A;  3M0A A;  2YKQ A;  1KD1 Q;  3PRJ A;  1HUC A;  2W90 A;  1NTM J;  2ZT9 B;  3QH9 A;  2E75 C;  1X9V A;  3G6E P;  3BVH B;  3CCL P;  4GOE A;  5AW3 B;  1M1J C;  1OVR A;  3B71 A;  1EXI A;  1BGY E;  1J1E C;  4ASW A;  3CWB E;  4CPG A;  2Q5U A;  3MUD C;  1NTZ G;  2GUV A;  2GUS A;  3L74 G;  1WMK A;  2YXQ B;  2R3S A;  1PGQ A;  1JY3 O;  3TDK A;  1K04 A;  5DJT B;  1QLE D;  2YKP A;  2YMK A;  3IAO A;  3HUS B;  1RE4 A;  1P84 H;  5AVW B;  3I55 P;  1VQ5 P;  2R44 A;  1FZA A;  4OVN F;  2PAJ A;  2QJK C;  3TF5 A;  2Q9I A;  3IN6 A;  1W2E A;  1KIL A;  4N6J A;  2E74 B;  1ZRT D;  2KYV A;  3I56 P;  5CJ4 A;  3CX5 H;  1Q86 Q;  2DW3 A;  3H1I D;  4ZMD A;  1D7M A;  3HE5 A;  1FZE C;  3AEE C;  2HOD C;  3L70 J;  1OIP A;  3H1K G;  3A5T A;  1M1J B;  2FYU J;  3FGA D;  4Y99 C;  3VMX A;  1MUU A;  3PLN A;  1KQL A;  1VDF A;  2IZ0 A;  4L75 A;  1KTM A;  3WMM 0;  1VQ6 P;  3V2N A;  2GM4 A;  3IFM A;  1NTM E;  1SQP J;  1NH4 A;  3VTP C;  1AA0 A;  1FIB A;  1FJK A;  2JHH C;  1E5W A;  1L0N G;  2LXC B;  1EZV G;  3RK2 C;  5KKZ B;  3CCM P;  4PJ0 H;  3CXH I;  4WWI A;  1SQP G;  4RKU J;  2Z4E B;  2WWW A;  3TGU D;  2A45 H;  1RE4 C;  1BE3 J;  3P7K A;  2QEX P;  1YQ3 C;  3CCJ P;  1FBM A;  4OGQ C;  3HD7 D;  2JO1 A;  2C0X A;  1WRG A;  1LT1 A;  2QJP B;  1BE3 G;  1YYC A;  1SFC D;  4PD4 H;  1CI6 B;  1KYO E;  2J3G A;  2WSF J;  2KS1 A;  4I6M C;  3L73 G;  4PJ0 E;  4Y99 B;  1NO4 A;  4I2L C;  3V2P A;  1IFJ A;  2ITA A;  1BE3 D;  1EXJ A;  2WIT A;  4H44 C;  2OTJ P;  1PGO A;  1AJY A;  1N7S C;  3L70 E;  3TNU A;  2LXB A;  2R5D A;  2AEF A;  5AVX B;  2QIW A;  1L4A C;  3AE9 C;  3L74 E;  2JP3 A;  2K9Y A;  2K1A A;  3RBZ A;  1NAF A;  5APX A;  3BVH A;  2WVR A;  2QA4 P;  1KB9 E;  4JF7 A;  2ZVN B;  2IYO A;  5GTI H;  2XU6 A;  5AW1 B;  1OFC X;  1SQP E;  1Q2N A;  1S1C X;  4H0L C;  1JMB A;  2FXM A;  3H32 C;  1LTA C;  1R5L A;  5AW5 B;  2K9J B;  1PP9 D;  4EIJ A;  2NPS D;  3HD7 A;  5AVZ B;  3S4R A;  2P58 A;  1BE3 E;  1ZLL A;  2E76 C;  2SPZ A;  1FZB C;  2ZXE B;  2RN0 A;  2E74 D;  2L5G B;  2KK7 A;  4YPC A;  1YQ4 C;  1NKZ B;  1NJI Q;  1ZME C;  4EYY Q;  1JY3 N;  1BDC A;  1FZG C;  2LR2 A;  1N7S D;  5KLV E;  3NXS A;  1T3J A;  3OW2 O;  2HOD A;  3O8Z A;  4PD4 E;  5B66 H;  2JHM F;  2FXP A;  1NTK E;  3OAK A;  3HUS A;  1PZQ A;  1L0N D;  2BCC J;  2E75 B;  1BDD A;  2GA1 A;  3L71 D;  1AVO A;  1W2B O;  3RGU A;  2ZAE B;  4DT0 A;  1JOC A;  2YO3 A;  1NYH A;  2NRG A;  3E1I C;  2M0B A;  1VQO P;  1J1E B;  3JC2 2;  1LGH B;  1Z56 A;  3WUU A;  1KMI Z;  3A2A A;  4H0L B;  1NKN A;  3V6I A;  2HPC A;  1T8Z A;  3CCQ P;  2C9L Y;  1JTH B;  3RL0 D;  2O1J A;  3E1I A;  2O1K A;  3T97 A;  1S9K E;  5AVR B;  3LW5 H;  2Z4E A;  3A0H E;  2HLO B;  1Y8A A;  3VMZ A;  2G8Y A;  1RE3 C;  1NTK D;  1FZC C;  2M3E A;  1L0L K;  2RMZ A;  2A45 G;  3BAT A;  3NMD A;  5H2F H;  4R9T A;  1FZG A;  1OMI A;  4NPE A;  5E79 H;  2AXT E;  1SQV D;  1OVV A;  2D2C C;  3ZDM A;  1FZE B;  3H1J D;  4BWN A;  3B5N D;  1ZXG A;  4PV1 C;  1GK4 A;  2V7Q J;  5AVY B;  1GK6 A;  4IL6 X;  1SQB D;  5B5E E;  1A02 F;  2FFD B;  1FU1 A;  3CCR P;  5K5G B;  3H1J G;  1OWA A;  2P7J A;  3GMA A;  1LWU B;  2YO2 A;  1P84 E;  3D6Z A;  4N78 D;  3N4X A;  1LNQ A;  4BRY B;  3N7N A;  3B8E B;  5CCH C;  5CBO A;  1GMJ A;  1H0T A;  2FFD A;  4GT1 A;  2XNX B;  3L72 D;  2Z4E C;  1KIL B;  1K05 A;  1SQQ G;  3T97 B;  3KHU A;  1K73 Q;  4BRY A;  1EZV D;  2WPR A;  3A0H H;  4OGQ B;  2E5T A;  1VQ7 P;  2QVA A;  1YHQ P;  1N73 A;  2QJP C;  2OTK E;  2IBZ E;  3M06 A;  5AVV B;  1T2K D;  1OX3 A;  4TT3 H;  2HYN A;  3A0B E;  2QRX A;  1KQF B;  1CZQ A;  3CCS P;  1NTZ J;  3H1H D;  4TLF A;  1Y9B A;  1HF9 A;  2ZJS E;  1GW4 A;  5AVS B;  1LT9 B;  1S5L E;  2Y9Y A;  1JC9 A;  3BCC G;  1S72 P;  1RY3 A;  2N1T A;  1RHZ B;  2XNX C;  1M8O B;  4BXL A;  1HTL C;  1KC8 Q;  3L37 A;  2HLO C;  1L0L D;  2AEJ A;  5KLI B;  2FBW C;  2H89 C;  1NTZ K;  4WB4 A;  2R3C A;  1PP9 J;  2YIU B;  1S5L H;  4LLH A;  3TGU G;  1SVF A;  2Q3E A;  1DIP A;  3H1H E;  1SS1 A;  2O01 N;  4H13 C;  1BGY D;  4RO0 A;  3CWB D;  2K88 A;  5APT A;  4H44 D;  3AEC C;  1LT9 A;  1YJN P;  1PPJ D;  3H1I E;  2O01 J;  2NZ2 A;  4D6T G;  3CXH H;  2B87 A;  3R4Y A;  2J5U A;  1G1I A;  1KN7 A;  5APW A;  2YNY A;  2MJZ A;  3CX5 E;  4H44 B;  3BAS A;  1PV3 A;  3O6Q A;  5APS A;  2QM8 A;  1T6A A;  1KB9 H;  3CPW O;  2HFE D;  2N1T D;  5KTB A;  4XA4 A;  4MN4 C;  4EOT A;  1NTK G;  2KLU A;  1M56 D;  4NYT A;  1JNM A;  2H88 C;  5APY A;  2BEQ D;  3WU2 E;  1MFT A;  1DX7 A;  3W67 A;  1X79 B;  4I7Z C;  1SQQ E;  3KDP B;  1JCC A;  1FC2 C;  4GDO A;  4DJG A;  2A45 I;  1M1J A;  3P8M C;  5C39 A;  2E43 A;  2QJY B;  3PJS K;  3K5B A;  3PP5 A;  3RBX A;  5CMZ A;  1H88 A;  2ZFC A;  1BCC E;  1L4A A;  2ZXX A;  1GL2 C;  2A06 G;  3H1H J;  1LP1 B;  2OYH C;  5H2F E;  5KJ7 A;  1W5C E;  1KYO D;  1HGV A;  3VP9 A;  3AE7 C;  1N73 B;  1U7M A;  1R5S A;  1LTJ B;  2G3A A;  3USS A;  4B86 A;  1YTZ T;  3RK2 B;  1NAY A;  2JHI F;  1KQG B;  2AEM A;  3V4Q A;  3EFG A;  4WY4 A;  3B5N C;  1SQX J;  3RK3 C;  4L73 A;  3HE5 B;  3L73 E;  2IFN A;  1FZF C;  2L91 A;  2PGD A;  2YIU C;  3BCC J;  3CI9 A;  2QG4 A;  4LGD E;  1RF0 B;  2J61 B;  2KOG A;  1CI6 A;  2FXO A;  4JYO X;  1BGY G;  3Q1M A;  2OYI C;  3AE2 C;  2J3F A;  2BEZ F;  3KQG A;  4H13 B;  3B5N A;  2J2P A;  2HOD B;  1VF5 D;  5AVU B;  1SP4 A;  4D6T D;  2PRR A;  3CCU P;  4M7H A;  4JYB A;  3SWK A;  1QL2 A;  3EWK A;  1Q7Y Q;  1SQQ J;  4WY4 D;  4OH8 B;  2I8D A;  3GG2 A;  3TYY A;  5KJ7 C;  3VMY A;  1GU5 A;  1IO4 A;  1BCC G;  3CC2 P;  1OVU A;  3BCC D;  3V2Q A;  1NTZ D;  3L75 D;  2J3U A;  1SQP D;  1BCC J;  2WPV B;  1LTS C;  1LWU A;  3M9Q A;  1URQ C;  4C7R A;  1LT9 C;  1RF0 C;  1URQ A;  4D6T E;  2OYI B;  1SQB K;  3GLM A;  2YKO A;  2MKV A;  1VQ8 P;  2W83 C;  4AQR D;  1SQX E;  1R8E A;  1T3U A;  5TIS H;  3L73 J;  3P32 A;  2E76 B;  3H1H G;  3HD7 C;  3BCC E;  3VN0 A;  1HJ0 A;  2OAR A;  2WQY C;  3KYQ A;  1HJB A;  5AW2 B;  1RF1 A;  3SWF A;  2KNC B;  1FDI A;  3CWB J;  3WUV A;  2W8Z A;  3ABV C;  1AV1 A;  3AE3 C;  1NOH A;  3TSI A;  2UWJ E;  2Y0C A;  1Y47 A;  3LIE A;  4RES B;  1X0T A;  1L0N J;  2E42 A;  2IDB A;  5APU A;  4DCK A;  3L71 J;  3H1K J;  1FOS F;  3G3Z A;  2M3B A;  2YMY A;  2XDJ A;  4W80 A;  4C46 A;  2WSF H;  5AW6 B;  5CCG A;  3H32 B;  1M1K Q;  1SQB E;  4C7N A;  1GL2 A;  1NWQ A;  1DEE G;  1SQP K;  1EQ7 A;  1N86 C;  3LID A;  3MIW A;  3TNU B;  3S9O A;  1YJW P;  1RQV A;  1QEX A;  1L0L J;  3A7O A;  2N1T C;  2K37 A;  2P2U A;  3HD7 B;  3Q5P A;  2O3J A;  3H1L G;  4U3F J;  4D6T J;  3F5H A;  4UB8 H;  3AED C;  3UIA A;  1U57 A;  3H1L E;  4I7Z B;  1JY2 N;  4K3A A;  2LKM A;  1KIL E;  1YI2 P;  1GDT A;  2GY7 A;  4K35 A;  1RF1 B;  4HJG H;  1OW7 A;  4DOJ A;  1FID A;  1KFN A;  1VL2 A;  4EDF A;  3AEB C;  3C1L A;  2QJY C;  1JTH A;  2XKM A;  2JKV A;  2ZT9 D;  2R5B A;  2J60 A;  1JCD A;  1N7L A;  3Q5S A;  1N2D C;  2H7H A;  3CCE P;  1IK7 A;  4WY4 C;  3EFF K;  1FZA B;  2HLO A;  2IFM A;  2OQQ A;  3RK3 D;  1ZP0 C;  4UB6 H;  1H89 A;  2IPP A;  1YIJ P;  4JZC A;  1OZH A;  1IK9 A;  1EZV E;  1FZC A;  3C8V A;  3B5N B;  3H1K E;  1KIL D;  1OW8 A;  3L72 J;  2XV5 A;  2KI7 B;  2OYO A;  1SQB J;  1IFN A;  3OJA B;  3U59 A;  1FZB A;  2KB7 P;  3CC7 P;  1LTI C;  2K3R A;  5GTH H;  1QL1 A;  2CPS A;  5AW9 B;  1K8A Q;  1L0L E;  2E76 D;  1VQM P;  3FXE A;  1JO5 A;  1JEK A;  4C7N B;  1IFD A;  2E5Y A;  3P8C D;  1J1D B;  1JB0 J;  4L76 A;  1FIC A;  2Y0E A;  3M9B A;  4EI2 A;  3H1L J;  4U3F G;  2JWD A;  1HVV A;  4I1L A;  2HG5 D;  2E75 D;  3JCU H;  1GL2 D;  3TGU E;  2FYU G;  1LTG C;  3AEF C;  5B5E H;  1PPJ E; 
#chains in the Genus database with same CATH homology
 1GTW A;  1HH0 A;  2QM8 A;  3HUS C;  2W6A A;  3RK2 C;  1GZL A;  3M9H A;  1HBW A;  3GHG B;  1NTK K;  2J3F D;  2HFE D;  2N1T D;  5KTB A;  4XA4 A;  4IFM A;  1SQV K;  2PP6 A;  3V2R A;  5CCH D;  4WBA A;  5KLV K;  4EOT A;  2Z4E B;  2WWW A;  4ZFG A;  2A45 H;  2NPS C;  1NU1 K;  1RE4 C;  4NYT A;  1DEB A;  1JNM A;  5APY A;  3P7K A;  2H8P D;  1DX7 A;  2J3O A;  5BU8 B;  2JJL A;  2WPQ A;  2I1K A;  1FBM A;  1X79 B;  3HTK B;  1RE3 A;  3P8C E;  3VYI A;  3HD7 D;  3KDP B;  1JCC A;  2C0X A;  1AFO A;  1WRG A;  1YYC A;  1SFC D;  3KPE A;  2A45 I;  1M1J A;  3P8M C;  3RL0 C;  1XTG B;  1CI6 B;  1SQX K;  4GIF A;  2E43 A;  2OYH A;  2J3G A;  2WSE H;  3PP5 A;  3BVH C;  5CMZ A;  3SWY A;  1ZN5 A;  3OA7 A;  4I6M C;  1H88 A;  2ZFC A;  4Y99 B;  1L4A A;  1NO4 A;  1Z3S A;  1GL2 C;  4I2L C;  1MV8 A;  5AW7 B;  3V2P A;  2OYH C;  2Q7C A;  1IFJ A;  5KJ7 A;  1G1J A;  3HE4 B;  2W27 A;  1HGV A;  4XE5 B;  3VP9 A;  1N73 B;  2WIT A;  2N9B A;  3CLQ A;  3V4W A;  3VP8 A;  1LTJ B;  1N7S C;  5AW0 B;  3TNU A;  4B86 A;  1YTZ T;  2JHK F;  2R5D A;  3RK2 B;  5AVX B;  1J2J B;  2JHI F;  1L4A C;  3V4Q A;  1CSB A;  2J64 A;  3EFG A;  4WY4 A;  3MUD A;  3B5N C;  2H43 B;  2J0G A;  1NAF A;  5APX A;  3BVH A;  3RK3 C;  2FYU K;  3NFQ A;  1URQ B;  4JF7 A;  3HE5 B;  3MGN A;  3I5C A;  4EPU A;  1WT6 A;  2D39 A;  2IFN A;  3MTU E;  1FZF C;  2XU6 A;  5AW1 B;  1IJD B;  4M7F A;  3IR9 A;  1LWU C;  1CW5 A;  3CI9 A;  2FXM A;  3H32 C;  4LGD E;  1RF0 B;  2J61 B;  2KOG A;  1SLQ A;  1CI6 A;  4JYO X;  1LTA C;  5AW5 B;  2OYI C;  2WZ7 A;  2FIB A;  4EIJ A;  1N86 B;  2NPS D;  2J3F A;  3HD7 A;  2I1J A;  5AVZ B;  3KQG A;  3BRT B;  2Q9I C;  3RL0 B;  2KLV A;  3B5N A;  2J2P A;  1M7L A;  1MZ9 A;  2HOD B;  1SFC B;  2N1T B;  5AVU B;  1SP4 A;  1ZR2 A;  1ZLL A;  1J1D C;  1KIL C;  2ZXE B;  1FZB C;  1G2C B;  3H32 A;  2L5G B;  4M7H A;  4JYB A;  5CHX A;  1S9K D;  1QL2 A;  1NKZ B;  1LTJ A;  1FZF A;  1IC2 A;  4WY4 D;  1JY3 N;  4OH8 B;  1T2K C;  3TYY A;  1FZG C;  5KJ7 C;  3VMY A;  1GU5 A;  1N7S D;  1N73 C;  3NXS A;  1T3J A;  2HOD A;  1IO4 A;  3M91 A;  3O8Z A;  1HGZ A;  4ZKU A;  1IFI A;  1FJP A;  2XNX A;  1OXZ A;  4AUW A;  2JHM F;  1RF1 C;  3V2Q A;  1KFM A;  3OAK A;  3HUS A;  1YTZ I;  2J3U A;  3R2P A;  1AQ5 A;  5CCG C;  1SQQ K;  3GHG C;  2OYI A;  2Z5H A;  4KHX A;  1LTS C;  1JOC A;  4IFF A;  3RK3 B;  2J1G A;  1LWU A;  3M9Q A;  3U1A A;  2YO3 A;  1URQ C;  2J0H A;  1RF0 A;  2J61 A;  3E1I C;  1L4A D;  2KSJ A;  2BAS A;  1J1E B;  1JY2 P;  2FFD C;  1LGH B;  4C7R A;  3U1C A;  2C0W A;  1Z56 A;  1FZA C;  3H6P A;  3A2A A;  1LT9 C;  1A02 J;  2J59 M;  1NKN A;  1RF0 C;  1URQ A;  2HPC A;  1T8Z A;  2OYI B;  1SQB K;  1SFC A;  2YKO A;  5AW8 B;  2C9L Y;  1JTH B;  4AQR D;  3RL0 D;  2WSC H;  2Q9I B;  2O1J A;  3E1I A;  2O1K A;  3T97 A;  1S9K E;  3L4F A;  3RK2 D;  1MFZ A;  1T3U A;  5AVR B;  3LW5 H;  2Z4E A;  4ZKP A;  3P32 A;  1NHL A;  2HLO B;  1JY2 O;  1Z3U A;  3VMZ A;  4W7Y A;  2WTY A;  2QM7 A;  1RE3 C;  3M0D C;  3HD7 C;  3VN0 A;  1FZC C;  1L0L K;  2OAR A;  3KYQ A;  1HJB A;  5AW2 B;  2VRS A;  5CCH A;  1HWT C;  2R32 A;  1RF1 A;  2A45 G;  3BAT A;  3NMD A;  3SWF A;  2OYH B;  2NPS A;  2IX7 C;  2WT7 B;  4R9T A;  1FZG A;  1GW3 A;  4N3Y B;  3MD0 A;  1LTJ C;  1N7S B;  1DH3 A;  1FZE B;  1NOH A;  3TSI A;  2HPC C;  3VOP A;  2FYZ A;  3B5N D;  2P1J A;  3LIE A;  4RES B;  4AYC A;  1KZU B;  1FDM A;  3M0D A;  1GK4 A;  5AVY B;  1GK6 A;  4N78 E;  2H43 C;  1LTB C;  2E42 A;  1NTM K;  5APU A;  2J0Y A;  1FZD A;  1A02 F;  4R9J A;  2FKW B;  5BVZ A;  2FFD B;  1FU1 A;  5AW4 B;  1FOS F;  1FAV A;  3G3Z A;  1OWA A;  2M3B A;  4WY4 B;  2YMY A;  2P7J A;  2XDJ A;  1LWU B;  4W80 A;  4C46 A;  4DZO A;  2WSF H;  3GHG A;  5AW6 B;  2YO2 A;  2H43 A;  5CCG A;  3H32 B;  3L35 A;  4N78 D;  4M3L A;  3N4X A;  4C7N A;  1ZR4 A;  1GL2 A;  3BRV B;  2M8R A;  4JYC A;  1NWQ A;  3N7N A;  1GD2 E;  3B8E B;  5CCH C;  1SQP K;  1EQ7 A;  1N86 C;  3LID A;  2J5Z A;  3MIW A;  3TNU B;  2J58 A;  2FFD A;  1JY3 P;  1IFM A;  2WPS A;  4GT1 A;  2XNX B;  2W6B A;  3A7O A;  2N1T C;  4O9B A;  2O01 H;  2Z4E C;  5CJ0 A;  1FOS E;  4IFD K;  3II6 A;  1KIL B;  2P2U A;  1FZB B;  2JHL F;  1VPC A;  2NPS B;  3HD7 B;  1RE4 B;  2WT7 A;  1XTC C;  1FZC B;  2C9N Y;  1H8A A;  1N7S A;  2WPR A;  3UIA A;  2POH A;  3HRN A;  1JY2 N;  2LKM A;  3M0A A;  2KP8 A;  1GDT A;  1PFI A;  2YKQ A;  1N73 A;  3M06 A;  2GY7 A;  1RF1 B;  5AVV B;  1HUC A;  4DOJ A;  1N86 A;  4HYT B;  3V5B A;  1T2K D;  5CCG D;  1FID A;  2WNP F;  5APV A;  3TK1 A;  1KFN A;  2HYN A;  2HPC B;  1X9V A;  1CZQ A;  3BVH B;  1JTH A;  2XKM A;  3HTK A;  1JMM A;  2J60 A;  2R5B A;  5AW3 B;  1JCD A;  1M1J C;  1N7L A;  3E1I B;  1J1E C;  1GL2 B;  1N2D C;  2H7H A;  5AVQ B;  5APQ A;  1GW4 A;  5AVS B;  2Q5U A;  1X8Y A;  4WY4 C;  1FZA B;  2Z5I A;  2HLO A;  1LT9 B;  2IFM A;  1ZV8 A;  2GUV A;  1URQ D;  2GUS A;  3RK3 D;  2P67 A;  1E5W A;  1JY3 O;  1H89 A;  2IPP A;  1JC9 A;  5AVT B;  4JZC A;  2YKP A;  2JEE A;  1GU4 A;  3HUS B;  1RE4 A;  1RY3 A;  1L4A B;  1IK9 A;  2N1T A;  5AVW B;  1FZC A;  2XNX C;  1LTT C;  1HTL C;  3B5N B;  3L37 A;  1FZA A;  1G2C A;  1KIL D;  3HE4 A;  2HLO C;  2PAJ A;  3EQ2 A;  4HH2 A;  1RE3 B;  4LC1 A;  2Q9I A;  2XV5 A;  5BU5 A;  1FZF B;  1NTZ K;  4WB4 A;  1IFN A;  3NTN A;  2R3C A;  3OJA B;  3U59 A;  1W2E A;  4GKG A;  1FZB A;  1KIL A;  5KJ7 D;  4LLH A;  2KB7 P;  4N6J A;  1LTI C;  2KYV A;  1JUN A;  1L0N K;  1SVF A;  1QL1 A;  5CJ4 A;  3C9I A;  2CPS A;  5AW9 B;  3FIB A;  3HE5 A;  1FZE C;  1JO5 A;  2HOD C;  1SFC C;  4W7Z A;  2Q3I A;  5APT A;  4C7N B;  1IFD A;  3P8C D;  1J1D B;  3A5T A;  1LT9 A;  1FIC A;  2CPB A;  1M1J B;  3M9B A;  1FZE A;  4Y99 C;  3VMX A;  1MUU A;  1HVV A;  3A3Y B;  1KQL A;  1VDF A;  4I1L A;  3WMM 0;  3V2N A;  2HG5 D;  1FZG B;  3L36 A;  1G1I A;  1GL2 D;  2XZR A;  5APW A;  2GM4 A;  3IFM A;  2YNY A;  2MJZ A;  3BAS A;  1NH4 A;  3VTP C;  1LTG C;  1FIB A;  1FJK A;  5APS A;  2JHH C;  3CL3 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...