2J3FD

L-ficolin complexed to n-acetyl-d-galactosamine
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
217
structure length
217
Chain Sequence
PCLTGPRTCKDLLDRGHFLSGWHTIYLPDCRPLTVLCDMDTDGGGWTVFQRRVDGSVDFYRDWATYKQGFGSRLGEFWLGNDNIHALTAQGTSELRTDLVDFEDNYQFAKYRSFKVADEAEKYNLVLGAFVEGSAGDSLTFHNNQSFSTKDQDNDLNNGNCAVMFQGAWWYKNCHTSNLNGRYLRGTHGSFANGINWKSGKGYNYSYKVSEMKVRPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FICOLIN-2
publication title Structural Insights Into the Innate Immune Recognition Specificities of L- and H-Ficolins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Sugar binding protein
total genus 58
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2006-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 2j3fD01
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 2j3fD02
2J5ZA 2J0GA 3HUSB 1LT9B 1Z3UA 2OYIC 2J1GA 2J3FD 3H32B 1M1JC 1FZCC 1RE4C 1FZGC 1LWUB 3E1IC 2HODC 4NYTA 2HLOB 2Z4EB 4R9TA 2HPCC 1RF1B 1RE4B 1RF0C 3E1IB 1FZFC 2D39A 2H43C 1FZEB 1N73B 2HPCB 2OYHC 2J3FA 1RE3C 1FZFB 1LT9C 2H43B 2FFDC 1N86C 4EPUA 4ZFGA 3BVHC 4M7HA 2OYIB 1FZAC 2J3OA 1M1JB 2J3UA 1FZCB 1FIDA 1FZBC 2Q9IC 2FIBA 4JYOX 3GHGC 1FZGB 1FZAB 2HODB 3FIBA 2WNPF 2Q9IB 4M7FA 1RF0B 1Z3SA 2XNXC 2JHLF 2JHHC 2J0HA 4JZCA 2OYHB 1FICA 2J64A 3HUSC 1RE3B 1LTJC 4R9JA 2J60A 2FFDB 1N86B 2J2PA 3BVHB 1LTJB 3H32C 1LWUC 1FZBB 2J61A 2HLOC 2Z4EC 2J3GA 1RF1C 2JHMF 2GY7A 1JC9A 2J0YA 2JHKF 2JHIF 1FZEC 2XNXB 1N73C 2J61B 1FIBA 1FZDA
chains in the Genus database with same CATH superfamily
2J5ZA 2J0GA 3HUSB 1LT9B 1Z3UA 2OYIC 2J1GA 2J3FD 3H32B 1M1JC 1FZCC 1RE4C 1FZGC 1LWUB 3E1IC 2HODC 4NYTA 2HLOB 2Z4EB 4R9TA 2HPCC 1RF1B 1RE4B 1RF0C 3E1IB 1FZFC 2D39A 2H43C 1FZEB 1N73B 2HPCB 2OYHC 2J3FA 1RE3C 1FZFB 1LT9C 2H43B 2FFDC 1N86C 4EPUA 4ZFGA 3BVHC 4M7HA 2OYIB 1FZAC 2J3OA 1M1JB 2J3UA 1FZCB 1FIDA 1FZBC 2Q9IC 2FIBA 4JYOX 3GHGC 1FZGB 1FZAB 2HODB 3FIBA 2WNPF 2Q9IB 4M7FA 1RF0B 1Z3SA 2XNXC 2JHLF 2JHHC 2J0HA 4JZCA 2OYHB 1FICA 2J64A 3HUSC 1RE3B 1LTJC 4R9JA 2J60A 2FFDB 1N86B 2J2PA 3BVHB 1LTJB 3H32C 1LWUC 1FZBB 2J61A 3GHGB 2HLOC 2Z4EC 2J3GA 1RF1C 2JHMF 2GY7A 1JC9A 2J0YA 2JHKF 2JHIF 1FZEC 2XNXB 1N73C 2J61B 1FIBA 1FZDA
chains in the Genus database with same CATH topology
2J5ZA 2J0GA 3HUSB 1LT9B 1Z3UA 2OYIC 2J1GA 2J3FD 3H32B 1M1JC 1FZCC 1RE4C 1FZGC 1LWUB 3E1IC 2HODC 4NYTA 2HLOB 2Z4EB 4R9TA 2HPCC 1RF1B 1RE4B 1RF0C 3E1IB 1FZFC 2D39A 2H43C 1FZEB 1N73B 2HPCB 2OYHC 2J3FA 1RE3C 1FZFB 1LT9C 2H43B 2FFDC 1N86C 4EPUA 4ZFGA 3BVHC 4M7HA 2OYIB 1FZAC 2J3OA 1M1JB 2J3UA 1FZCB 1FIDA 1FZBC 2Q9IC 2FIBA 4JYOX 3GHGC 1FZGB 1FZAB 2HODB 3FIBA 2WNPF 2Q9IB 4M7FA 1RF0B 1Z3SA 2XNXC 2JHLF 2JHHC 2J0HA 4JZCA 2OYHB 1FICA 2J64A 3HUSC 1RE3B 1LTJC 4R9JA 2J60A 2FFDB 1N86B 2J2PA 3BVHB 1LTJB 3H32C 1LWUC 1FZBB 2J61A 2HLOC 2Z4EC 2J3GA 1RF1C 2JHMF 2GY7A 1JC9A 2J0YA 2JHKF 2JHIF 1FZEC 2XNXB 1N73C 2J61B 1FIBA 1FZDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J5Z A;  2J0G A;  3HUS B;  1LT9 B;  1Z3U A;  2OYI C;  2J1G A;  2J3F D;  3H32 B;  1M1J C;  1FZC C;  1RE4 C;  1FZG C;  1LWU B;  3E1I C;  2HOD C;  4NYT A;  2HLO B;  2Z4E B;  4R9T A;  2HPC C;  1RF1 B;  1RE4 B;  1RF0 C;  3E1I B;  1FZF C;  2D39 A;  2H43 C;  1FZE B;  1N73 B;  2HPC B;  2OYH C;  2J3F A;  1RE3 C;  1FZF B;  1LT9 C;  2H43 B;  2FFD C;  1N86 C;  4EPU A;  4ZFG A;  3BVH C;  4M7H A;  2OYI B;  1FZA C;  2J3O A;  1M1J B;  2J3U A;  1FZC B;  1FID A;  1FZB C;  2Q9I C;  2FIB A;  4JYO X;  3GHG C;  1FZG B;  1FZA B;  2HOD B;  3FIB A;  2WNP F;  2Q9I B;  4M7F A;  1RF0 B;  1Z3S A;  2XNX C;  2JHL F;  2JHH C;  2J0H A;  4JZC A;  2OYH B;  1FIC A;  2J64 A;  3HUS C;  1RE3 B;  1LTJ C;  4R9J A;  2J60 A;  2FFD B;  1N86 B;  2J2P A;  3BVH B;  1LTJ B;  3H32 C;  1LWU C;  1FZB B;  2J61 A;  2HLO C;  2Z4E C;  2J3G A;  1RF1 C;  2JHM F;  2GY7 A;  1JC9 A;  2J0Y A;  2JHK F;  2JHI F;  1FZE C;  2XNX B;  1N73 C;  2J61 B;  1FIB A;  1FZD A; 
#chains in the Genus database with same CATH topology
 2J5Z A;  2J0G A;  3HUS B;  1LT9 B;  1Z3U A;  2OYI C;  2J1G A;  2J3F D;  3H32 B;  1M1J C;  1FZC C;  1RE4 C;  1FZG C;  1LWU B;  3E1I C;  2HOD C;  4NYT A;  2HLO B;  2Z4E B;  4R9T A;  2HPC C;  1RF1 B;  1RE4 B;  1RF0 C;  3E1I B;  1FZF C;  2D39 A;  2H43 C;  1FZE B;  1N73 B;  2HPC B;  2OYH C;  2J3F A;  1RE3 C;  1FZF B;  1LT9 C;  2H43 B;  2FFD C;  1N86 C;  4EPU A;  4ZFG A;  3BVH C;  4M7H A;  2OYI B;  1FZA C;  2J3O A;  1M1J B;  2J3U A;  1FZC B;  1FID A;  1FZB C;  2Q9I C;  2FIB A;  4JYO X;  3GHG C;  1FZG B;  1FZA B;  2HOD B;  3FIB A;  2WNP F;  2Q9I B;  4M7F A;  1RF0 B;  1Z3S A;  2XNX C;  2JHL F;  2JHH C;  2J0H A;  4JZC A;  2OYH B;  1FIC A;  2J64 A;  3HUS C;  1RE3 B;  1LTJ C;  4R9J A;  2J60 A;  2FFD B;  1N86 B;  2J2P A;  3BVH B;  1LTJ B;  3H32 C;  1LWU C;  1FZB B;  2J61 A;  3GHG B;  2HLO C;  2Z4E C;  2J3G A;  1RF1 C;  2JHM F;  2GY7 A;  1JC9 A;  2J0Y A;  2JHK F;  2JHI F;  1FZE C;  2XNX B;  1N73 C;  2J61 B;  1FIB A;  1FZD A; 
#chains in the Genus database with same CATH homology
 2J5Z A;  2J0G A;  3HUS B;  1LT9 B;  1Z3U A;  2OYI C;  2J1G A;  2J3F D;  3H32 B;  1M1J C;  1FZC C;  1RE4 C;  1FZG C;  1LWU B;  3E1I C;  2HOD C;  4NYT A;  2HLO B;  2Z4E B;  4R9T A;  2HPC C;  1RF1 B;  1RE4 B;  1RF0 C;  3E1I B;  1FZF C;  2D39 A;  2H43 C;  1FZE B;  1N73 B;  2HPC B;  2OYH C;  2J3F A;  1RE3 C;  1FZF B;  1LT9 C;  2H43 B;  2FFD C;  1N86 C;  4EPU A;  4ZFG A;  3BVH C;  4M7H A;  2OYI B;  1FZA C;  2J3O A;  1M1J B;  2J3U A;  1FZC B;  1FID A;  1FZB C;  2Q9I C;  2FIB A;  4JYO X;  3GHG C;  1FZG B;  1FZA B;  2HOD B;  3FIB A;  2WNP F;  2Q9I B;  4M7F A;  1RF0 B;  1Z3S A;  2XNX C;  2JHL F;  2JHH C;  2J0H A;  4JZC A;  2OYH B;  1FIC A;  2J64 A;  3HUS C;  1RE3 B;  1LTJ C;  4R9J A;  2J60 A;  2FFD B;  1N86 B;  2J2P A;  3BVH B;  1LTJ B;  3H32 C;  1LWU C;  1FZB B;  2J61 A;  2HLO C;  2Z4E C;  2J3G A;  1RF1 C;  2JHM F;  2GY7 A;  1JC9 A;  2J0Y A;  2JHK F;  2JHI F;  1FZE C;  2XNX B;  1N73 C;  2J61 B;  1FIB A;  1FZD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...