3H32B

Crystal structure of d-dimer from human fibrin complexed with gly-his-arg-pro-tyr-amide
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
308
structure length
308
Chain Sequence
LYIDETVNSNIPTNLRVLRSILENLRSKIQKLESDVSAQMEYCRTPCTVSCNIPVVSGKECEEIIRKGGETSEMYLIQPDSSVKPYRVYCDMNTENGGWTVIQNRQDGSVDFGRKWDPYKQGFGNVATNTDGKNYCGLPGEYWLGNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGGFTVQNEANKYQISVNKYRGTAGNALMDGASQLMGENRTMTIHNGMFFSTYDRDNDGWLTSDPRKQCSKEDGGGWWYNRCHAANPNGRYYWGGQYTWDMAKHGTDDGVVWMNWKGSWYSMRKMSMKIRPFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Two families of synthetic peptides that enhance fibrin turbidity and delay fibrinolysis by different mechanisms.
pubmed doi rcsb
molecule tags Blood clotting
molecule keywords Fibrinogen alpha chain
total genus 74
structure length 308
sequence length 308
chains with identical sequence E
ec nomenclature
pdb deposition date 2009-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
B PF08702 Fib_alpha Fibrinogen alpha/beta chain family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3h32B01
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 3h32B02
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 3h32B03
1RE3A 2XNXA 2J0YA 3BVHA 3GHGC 4JZCA 4NYTA 1LTJC 1M1JB 2OYHB 1RE4B 2FIBA 2GY7A 2HLOB 3E1IC 3BVHC 1RE3C 1Z3UA 1M1JC 2OYHC 2H43B 4ZFGA 2J60A 1FZAC 3BVHB 2J64A 2HPCA 2J0HA 1FZEB 4M7FA 2OYIB 2J3UA 1FZEA 1FZBA 2J3GA 2J61A 3HUSC 2H43A 2HPCC 1FZGC 2A45H 2WNPF 2Q9IA 2HLOA 1FZDA 2D39A 1LTJA 1FZGA 2XNXB 1RE3B 1LT9A 2A45I 1W2EA 3H32B 1RF1B 2Z4EA 1FZCA 2JHHC 1RF1C 1LWUB 1T3UA 1FICA 2Z4EC 2J3OA 1FZFB 1LT9B 1FZCB 2Z4EB 2FFDC 1LT9C 1JY2O 3GHGA 2J0GA 4R9TA 2Q9IB 1RF0C 1FIDA 2J3FA 2Q9IC 4M7HA 1LTJB 2HLOC 4R9JA 1RF0A 1FZBB 2JHKF 2H43C 1JY3O 1N86A 2OYIA 2HODC 2HODA 3HUSB 2OYIC 1FZFC 1FZCC 1N86B 1RE4A 1M1JA 2OYHA 2HPCB 2JHIF 2J2PA 2J5ZA 2FFDA 2JHLF 3GHGB 2A45G 1N73A 1FIBA 1LWUC 2J3FD 1FZFA 2HODB 3HUSA 1FZAB 1LWUA 2J1GA 1RF0B 3H32A 4EPUA 1JY2P 1JC9A 1N86C 1JY2N 1RE4C 1FZGB 3FIBA 3E1IB 3E1IA 1JY3P 1JY3N 3H32C 1FZEC 2XNXC 1FZBC 4JYOX 2J61B 1RF1A 2JHMF 1N73B 1Z3SA 1FZAA 2FFDB 1N73C
chains in the Genus database with same CATH superfamily
1GL2C 1S5LE 3H1LJ 3NFQA 1LTJC 3N7NA 1Q82Q 2WT7A 3SFDC 3L75D 3WUUA 2HPCA 4W7ZA 3BASA 1MFTA 4IOIH 2O3JA 3H1HG 3L70E 3W68A 1HWTC 3GMAA 1J2JB 2JDIH 2D39A 1FU1A 1W2EA 2W6JH 3H32B 2WSCH 4Y99C 1PFIA 2WMMA 3HE5B 3HRNA 3L70G 3S9OA 3MIWA 1JY3O 3D6YA 2Z5HA 1BGYJ 1VQ6P 1A02F 1QVFO 1EDIA 2CPSA 2QJPC 2QVAA 3R4YA 4H13D 1NTZK 1NTZG 1BSHA 3I5CA 1HUCA 2Q3IA 3CLQA 5APSA 4EPUA 3VP8A 1GW4A 3F5HA 3SSUA 4C7NB 3CMAP 1FZGB 2WITA 3FIBA 5AW4B 1PP9J 1NU1E 3C9IA 3TYYA 3P32A 3HE4B 2XNXC 1K8AQ 2KB7P 3H1JE 5KJ7A 2NRGA 1JTHA 5APTA 1N2DC 2KI7B 3S1KA 3A0BH 4I6MC 2HLOB 1YJ9P 1SQVD 3VN0A 4JQ0D 3G9RA 1PGOA 3L74G 2A45H 1PGPA 3O6QA 2QJKB 1D7MA 4W80A 5M1BA 1OW6A 3P7KA 3GLMA 3V2QA 1YJNP 3OW2O 3V4WA 1SP4A 3CWBJ 2IX7C 5KKZC 3TF5A 3MP7B 2KZIA 4R9TA 1SQQE 2ZXEB 1LT1A 3O6QB 2N1TC 2C0XA 1SLQA 1UIXA 3A7OA 1VPCA 1NTMJ 2WPQA 1IJDB 3OJAB 2WT7B 4GIFA 1BE3J 5H2FH 3L74J 1E5WA 2WSEJ 2KIKA 2WSCJ 3IFMA 3H1ID 2O1JA 2KS1A 4PD4I 2V7QH 5KLVD 1WT6A 1IFMA 1JM0A 1KQSO 1M90Q 2P58A 3KQGA 1H88A 3BVHC 1M1JC 2OYHC 3Q3DA 2H88C 1QGKB 3P8MC 2I8DA 1SQXJ 1W2BO 2J61A 2E74D 2E75B 3AEBC 1FZGC 5APWA 2B88A 4L75A 4U3FD 3CC7P 2FXOA 4IFFA 1NAYA 5GTIE 3MTUE 4DOJA 1URQB 2FXMA 1SQPE 3A0BE 1KILC 2H89C 1BCCE 5AVQB 1HJBA 2Q5UA 4OGQD 1RF0A 1Y9BA 3WMM0 1L4AB 3CCLP 2IBZE 2B87A 3JCUH 2QM8A 1GL2B 1JO5A 1ZRTE 3M0AA 5AVVB 1YQ4C 1GD2E 1M57D 2JHLF 2K37A 2W27A 2IBZI 2N9YB 3AEAC 3T97A 1IK7A 4HH2A 4I7ZB 4H44D 2FYUJ 4BRYA 3AEFC 5BU8B 2E43A 3CCVP 4LLHA 1KN7A 2QJYC 2W6AA 3H1IG 2J61B 2M0BA 1PZQA 1JNMA 1K73Q 2R5BA 1L0LJ 1RE3A 2KUBA 3B8EB 5GTHH 5TJHA 1HGVA 3JSVC 1PP9G 2Q7CA 4HYTB 2GUVA 2QE7H 2JEEA 1X0TA 3M9HA 2YIUC 1NYHA 1AVYA 2Y0CA 1S4XA 1FZBA 4RO0A 2C9LY 1RHZB 3V2PA 2JP3A 4WVZA 3D70A 4NPEA 4XFJA 5AW0B 4KJMA 3S4RA 3L75G 3IR9A 1FE6A 2V7QJ 4BRYB 1HF9A 1RF1B 2L91A 1MKMA 1NU1G 1LWUB 3L35A 1FDOA 4L73A 5KLVK 3ABVC 4ASWA 2Z4EB 2L5GB 2WSEH 2R5DA 1YIJP 2H43C 2GM4A 2OYIA 3VOPA 1NTKE 1CI6B 2HODA 2HYNA 5APUA 3TGUD 4U3FE 1BE3G 1T6AA 1FZCC 4DZOA 3CD6P 1NO4A 2H7HA 2IYPA 4ZNCA 1KB9E 1SQBE 4PJ0H 2O01J 4HJGH 1FZFA 2FYUG 2V4HA 2AXTH 1FC2C 4D6TD 1NKNA 1DEBA 1FJPA 2H8PD 4OWFA 4GODA 1ZXGA 3B5NC 2KXPB 4PV1B 1SQQG 3LIEA 5CBOA 2K88A 1JCDA 4KT0J 1Z3SA 3M06A 4GT1A 1J1EB 2LXBA 3RK2C 2YXQB 2KP8A 3B5NB 3H1JD 1LP1A 3CPWO 3H1KG 3QWOC 2N1TD 3TSIA 1U7MA 3JC22 2W8ZA 4IL6E 5AW7B 2IPPA 3HD7A 1M7LA 2QG4A 2Z5IA 2JHHC 1OFCX 1RF1C 1S9KD 2M5AA 2JR8A 3AE8C 3L70J 4RESB 3H1KE 1FIDA 2E75D 3RGUA 4R9JA 5KJ7C 4H13B 3L73E 2JHKF 4R4MA 2AEMA 2D2CC 2B89A 1CSBA 1NTZE 3VMZA 2J5ZA 1JTHB 1CI6A 2HODB 1FZAB 4LC1A 1M1KQ 2HG5D 3HE4A 2XV5A 3I55P 1WMKA 2W6BA 2OARA 3AE4C 2YMYA 3AE9C 2E42A 3RK3B 5GTIH 4UB6H 1SQBK 2XU6A 2YMKA 1N73C 3H1LE 2O01N 4WBAA 3FGAD 3E1IC 2G8YA 3TDKA 5CCGD 1K05A 1BDCA 3GW6A 1NU1J 5B5EE 1LJ2A 2PP6A 2QEXP 1PV3A 5TISH 2Q9IA 2ZJSE 1IO4A 3BRVB 3H1KD 1AQ5A 1RE3B 4N78D 1SQVG 1AV1A 3MD0A 1HBWA 1LTAC 3AEEC 1Q2NA 2RMZA 3H25A 2MKVA 3CWBG 3C1LA 4L74A 2AEJA 3RK2B 1JY2O 3EFFK 5CCGA 5BU5A 2J3FA 4IFDK 1SQBG 1HH0A 1YYCA 1P84D 4GOEA 2OYIC 3M0DA 5CMZA 5DJTB 1GL2D 1GDTA 1LNQA 1VQMP 3TGUE 1QVGO 3D6ZA 2HR3A 2I1JA 1L0LK 2NPSD 2ZVNB 1BE3E 1FZBC 1R5SA 1SQXE 3L74E 4OGQB 3QH9A 5AVTB 1M56D 1RE4B 3CI9A 1P84H 2H43B 1AFOA 3RK3E 1URQD 2J0HA 1SQXK 1QL2A 1SQPJ 1FOSE 3CX5I 1NH4A 1NJIQ 1UIIA 1JMBA 2AEFA 2HPCC 4H0LC 1X79B 2HLOA 3KPEA 4QMAA 3AECC 1LTJA 2GUSA 1EDJA 3B5ND 1KB9H 2SPZA 3HE5A 1HGZA 1LTIC 1OIPA 1FZCA 1NTKK 1IK9A 1SQPK 1K9MQ 4YTPC 4EDFA 3WU2E 1FICA 1FZFB 2WPSA 4N78E 3CMEP 2AXTE 2P7JA 1JUNA 3UIAA 3EWKA 3VYIA 1U57A 5B5EH 3H1HJ 1N7SA 5GTHE 1NTME 1KYOH 1YTZT 4AYCA 1KV4A 3L72D 3L71G 4Y28J 1BCCJ 3L73G 3C8VA 1RQVA 3Q2YA 1T3JA 3MUDC 4JYBA 3KDPB 2FYNC 4EYYQ 1NTMD 3M9QA 1JCCA 2P67A 1QLED 4U7JA 2FBWC 3E1IB 1NTMG 1MFZA 2QA4P 1Q81Q 1U7JA 1PP9D 4ASVA 4D6TG 3Q5PA 4I2LC 1J1EC 2FYUE 3GHGC 2GA1A 4NYTA 2FIBA 2GY7A 1MZ9A 1SQVJ 1GK4A 1ZMEC 5L8RJ 3W67A 1L0LD 2B87B 1N7LA 1LTGC 5B66E 2WTYA 1OVRA 1EDKA 2KSEA 4PJ0E 2C9NY 5AVZB 2LXCB 2W90A 1SQPD 2FKWB 2K9JA 1BCCG 4U3FJ 5CJ0A 2Z4EA 2IDBA 1T3UA 1URQA 1JEKA 2KK7A 2WQYC 2Q1KA 1BGYD 5AVXB 3GHGA 2YO3A 1Q86Q 1ZV8A 1IFDA 2OGUA 5KLVG 1KTMA 3CXHE 4AQRD 4JF7A 2XNDH 3MGNA 3NTNA 3KYQA 1ZLLA 1QEXA 1KB9I 2KYVA 5CCGC 1OXZA 3MZWB 2FFDA 1H0TB 2E5TA 5APYA 2J3FD 2YKQA 1H8AA 3MUDA 1GTWA 2OTJP 3HTKA 2KNCB 5TISE 3E1IA 1R5LA 2BCCG 2QSIA 1RF1A 2P2UA 2ZAEB 2JHMF 1L0LE 3CX5D 3USSA 2J0YA 3HD7C 1SQQK 1X22A 3G3ZA 1KILE 1SQXD 2R3CA 2OYIB 3I56P 3KXDA 4BXLA 2J3UA 2BCCE 3EQ2A 2HFED 3V2RA 3L75E 3H1KJ 5BVZA 3RK3D 1EDLA 2M3BA 3FXDA 1FZDA 2YO2A 3PLNA 3U1CA 3L73J 2XNXB 4H44C 2A45I 2R32A 4PD4D 1LGHB 2C0WA 1X8YA 5CCHD 3A5TA 2N1TA 1YI2P 2J3OA 3PJSK 2J0GA 2WPVB 1K04A 3A3YB 4K35A 3SWKA 1G2CB 1N8RQ 4WY4B 1E79H 3PTZA 2WZ7A 2E76B 2IZ0A 2KOGA 1VDFA 3V6IA 3RL0D 3U59A 1L0NG 1GMJA 1VQOP 3TGUJ 3TNUB 1HJ0A 3CCSP 3L72E 5AW8B 3IAOA 2WSFH 1X9VA 1DIPA 3IF4A 3H32A 3Q5SA 3VP9A 2IFNA 2Q3EA 3H1JG 1JOCA 1VQ8P 3KHUA 4PV1D 4OVNF 2WSFJ 3AE2C 1GU5A 1GL2A 2PRRA 4EOTA 2NPSB 1KYOD 1VL2A 4ZFGA 3BVHB 1QX8A 2K1AA 2IBZD 4EIJA 1GZLA 5AVSB 4TLFA 3CC4P 2KLVA 5H2FE 2R3SA 4O9BA 1S5LX 1OX3A 1KFNA 3G71P 1N7SD 1KQGB 3B71A 2N9BA 3IN6A 1KILB 4PD4E 4DCKA 1WRGA 3HD7B 2PGDA 3FXEA 2Q9IC 5KAFH 2YNYA 2D2CB 1AQTA 3HUSB 3L70D 1ZW0A 4WY4A 3H1HE 1GK6A 3L74D 1N86B 1PIXA 1PGQA 1NTZJ 2QJPB 4IFMA 5AW1B 2QIWA 3AEGC 3P8CD 3GHGB 2FYNB 3PP5A 3G6EP 2J1GA 3CCRP 1G1JA 5CHXA 4XA4A 4I7ZC 1EZVI 2LR2A 5KJ7D 2R44A 3KZIH 3H1IE 1USDA 4JBZA 3GF7A 3SWYA 1HVVA 1RH5B 3H1LG 3LW5J 3LIDA 4UB8E 2WVRA 5KLVE 3RK3C 3AE5C 4JYCA 4JZCA 1NVOA 4H44B 1SQVE 3BCCE 1Z3UA 3H1LD 3AE6C 3VMXA 4A7PA 5CCHC 1ZR2A 2QM7A 1FZEB 3PRJA 1XTCC 1YJWP 1RY3A 4Z1MH 1EZVD 2H43A 2JO1A 2CK3H 2ZT9D 1EXIA 3M9BA 1FJKA 2M5AB 1NU1D 3AE7C 4WB4A 1Y47A 2YKPA 3NXSA 3BCCG 4TT3H 3VMAA 2FFDC 1AA0A 2E76D 2Q9IB 1M8OB 4NPFX 4WWIA 2HLOC 2J59M 1P84I 1VQNP 3B5NA 1EXJA 3V5BA 3VMYA 2ZYDA 4D6TJ 2J2PA 2FYUD 4NPDA 1SQVK 1SS1A 1NTZD 1QL1A 1ZOYC 1ZRTD 1VQ7P 3HUSA 2Q6QA 3BRTB 2P10A 3CC2P 4PD4H 1JY2P 1ZR4A 1BE3D 4ZKUA 3RK2D 5KAFE 1SFCA 2KZJA 1KC8Q 2ZFCA 3HTKB 1VF5C 3V2NA 4XE5B 5C39A 2JWAA 2FFDB 2AXCA 3OAKA 2J64A 1OW8A 3SWFA 4M3LA 4GDOA 4DJGA 5KLIB 1NHLA 2Y9YA 1L4AC 3CX5E 5AVRB 4HKZH 1NGMB 2E75C 5E79E 4KHXA 2WWWA 4GKGA 1LT9A 2FYZA 4K3AA 1LTSC 1AVOA 1VQLP 3Q5RA 3R2PA 4YXWH 2PFXA 2KNCA 2QJKC 1NTKG 5APVA 2ZT9C 1LTJB 1Y8AA 4MN4C 1IFIA 1T8ZA 1NTMK 1GU4A 5AW2B 2KSJA 1AJYA 1N7SB 2WSSH 3A2AA 3TNUA 1NTKD 4OH8B 3CCMP 3F89A 3N4XA 1NKZB 3BATA 1URQC 5CBNA 1SQQD 4W7YA 3L72J 1N7SC 5CJ4A 2YIUB 1N86C 1JY2N 3VTPC 1L2PA 1KZUB 3L71J 4JYOX 1VQ9P 2BCCJ 3L75J 1T2KD 1CZQA 3H1JJ 4L76A 2B9BA 3L71D 2DW3A 3L72G 5KKZB 2JWDA 1FZAC 4PV1C 2RH0A 2ITAA 3M0DC 5AW9B 5DJUB 3A0HE 3AEDC 5KLIC 2ZYAA 2J3GA 1KQLA 1CW5A 3HUSC 2WNPF 2M8RA 2IZ1A 2J58A 1FZGA 3K5BA 5AW6B 2YKOA 3CCJP 1BGYE 3L4FA 2POHA 1IZNB 2QJYB 3CWBE 1USEA 4WY4D 3RL0g 1FOSF 2Z4EC 1S72P 1VQKP 4H0LB 5KAIE 1LT9C 1SFCB 3V4QA 2E74B 3G4SP 1FZBB 3U1AA 2ZT9B 3FX0A 4IL6X 1DX7A 2HODC 1KB9D 3ITKA 1NU1K 1L0NJ 5E79H 2OTLP 3H1HD 1Z56A 1M1JA 2OYHA 1S3JA 2NPSA 1PP9E 1YBKA 3GF3A 2A06G 1FBMA 1KFMA 4JPZB 1BCCD 1S2EA 4IL6H 1LWUC 5K5GB 4N6JA 5EFWB 1OWAA 1RF0B 1PPJE 2ZYGA 3PHLA 2BASA 4B86A 5AW5B 1JY3N 1SQXG 3O8ZA 3E7KA 1HTLC 2K9JB 1KILD 2Y9ZA 1VQ5P 3BVHA 3II6A 1Q90D 1RE3C 2J60A 1BSNA 2K3RA 1L4AA 1YHQP 5APQA 1BDDA 1FZEA 3CCUP 1J1DC 1G2CA 2XKMA 2JKVA 4ZKPA 3LW5H 1IFPA 3BCCD 4C7NA 3L36A 2OQQA 4EI2A 1XTGB 2I1KA 1IFJA 1IC2A 2N1TB 1S5LH 2ZVOB 3KZIE 2KS1B 4UB6E 1OVVA 1RF0C 1PPJG 1ZP0C 4UB8H 5AVUB 3HD7D 2RKLA 3ZDMA 3T97B 2E76C 5CCHA 2YXRB 1RE4A 1P84E 1G1IA 2HPCB 2JHIF 3TK1A 1SQQJ 2A45G 5AVWB 1EC5A 1L4AD 4Y99B 3CCQP 5KLVJ 1L0ND 1L0NK 3CXHI 2W83C 2JJLA 2QRXA 1DH3A 2E5YA 1RE4C 5AVYB 2BCCD 1YQ3C 3NMDA 1H89A 2IYOA 3WUVA 2UWJE 1PPJD 2K9YA 1LTBC 2OTKE 2FY8A 1FZAA 1W5CE 4DT0A 1VF5D 1DD3A 2A06D 4U3FG 3RL0B 1A02J 2XDJA 4M7FA 1KYOE 2M3EA 1PL5A 1J1DB 2VRSA 2Y0EA 4BWNA 2MJZA 5APXA 1RQUA 2G3AA 3AE3C 1OZHA 4H13C 3GG2A 3D71A 3WUTA 3BCCJ 2Y0DA 4I1LA 1PGJA 1IFNA 1NOHA 2XZRA 4ZMDA 1SVFA 2NZ2A 1GW3A 1H0TA 4M7HA 3RBZA 1FAVA 2BEQD 1T2KC 1NTKJ 1JB0J 1SQBD 4N3YB 3PH0A 3L37A 4RJTA 1FZFC 2IBZG 1SFCD 3CCEP 1VQ4P 1MUUA 1KQFB 1EQ7A 1SQBJ 3B4SA 1LTTC 5B66H 3CX5H 1R8EA 4GOFA 4WY4C 1LWUA 3RL0C 5KTBA 2P1JA 1YITP 3CL3D 1NWQA 3WU2H 1Q7YQ 1KD1Q 1DD4A 1JY3P 3H1IJ 4D6TE 4LGDE 2CPBA 1TU3F 3H32C 4CPGA 2D2CD 2J5UA 3SFEC 4C7RA 3EFGA 3H6PA 4R4LA 4C46A 2BEZF 3FWLA 1FS0E 2O01H 2XNXA 3JCUE 2E74C 1M1JB 2OYHB 3P8CE 1S1CX 5KAIH 3CXHH 2ZXXA 1SFCC 3TGUG 1SQPG 1VF5B 3L73D 3FWNA 4AUWA 1OVUA 1FDMA 1EZVG 2LKMA 3MHVA 1NAFA 1YTZI 3M91A 1VQPP 2FXPA 1S9KE 1OMIA 1ZN5A 4OGQC 2O1KA 3E1RA 3CWBD 3RBXA 1LT9B 1FZCB 5AW3B 4H0LD 1JMMA 4YXDC 4RKUJ 1OW7A 1N86A 2PAJA 4YPCA 1KYOI 1EZVE 1LP1B 3CXHD 2WPRA 1BGYG 1L0NE 3Q1MA 3L71E 2NPSC 1DEEG 3A0HH 1FDIA 1N73A 1KILA 1FIBA 2IFMA 2KLUA 1MV8A 1JC9A 3AE1C 2OYOA 4HB1A 1KMIZ 3OA7A 1L0LG 2FYUK 1FZEC 2RN0A 2A06E 1N73B 1KORA
chains in the Genus database with same CATH topology
2J0YA 1GL2C 3HD7C 3NFQA 4GT1A 1SQQK 1LTJC 3N7NA 1J1EB 3G3ZA 3RK2C 2KP8A 3B5NB 2WT7A 1FZAC 2HPCA 4W7ZA 3BASA 3M0DC 5AW9B 2R3CA 2OYIB 2J3UA 2N1TD 2J3GA 3EQ2A 3TSIA 1HWTC 2HFED 1KQLA 3V2RA 1CW5A 3HUSC 5BVZA 3RK3D 2M3BA 2WNPF 2M8RA 1J2JB 1FZDA 2YO2A 3U1CA 2D39A 2J58A 1FZGA 2XNXB 5AW7B 5AW6B 2IPPA 3HD7A 2A45I 1M7LA 2R32A 1FU1A 2YKOA 1LGHB 1W2EA 2C0WA 3L4FA 2POHA 1X8YA 3H32B 2Z5IA 5CCHD 3A5TA 2JHHC 1RF1C 2WSCH 4WY4D 2N1TA 4Y99C 1S9KD 1FOSF 2Z4EC 2J3OA 1PFIA 1LT9C 3HE5B 1SFCB 4RESB 2J0GA 3V4QA 1FIDA 3HRNA 4R9JA 5KJ7C 1FZBB 3U1AA 2JHKF 3A3YB 3MIWA 1JY3O 1DX7A 2HODC 2Z5HA 1G2CB 4WY4B 1A02F 1NU1K 2WZ7A 1Z56A 2KOGA 1M1JA 1VDFA 2OYHA 3RL0D 3U59A 1CSBA 2CPSA 2NPSA 3VMZA 2J5ZA 1FBMA 1KFMA 1NTZK 3TNUB 1LWUC 3I5CA 1JTHB 1CI6A 2HODB 4N6JA 5AW8B 1FZAB 1OWAA 2WSFH 1X9VA 4LC1A 1HUCA 2Q3IA 3CLQA 1RF0B 3H32A 5APSA 4EPUA 2HG5D 3HE4A 2XV5A 1GW4A 3VP8A 4C7NB 2BASA 3VP9A 2W6BA 1FZGB 2WITA 3FIBA 2OARA 4B86A 2IFNA 5AW5B 5AW4B 1JY3N 2YMYA 1JOCA 3O8ZA 3C9IA 3TYYA 3P32A 3HE4B 2XNXC 1HTLC 2E42A 3RK3B 2KB7P 5KJ7A 1SQBK 2XU6A 1N73C 1KILD 1GU5A 1JTHA 5APTA 1N2DC 3BVHA 4I6MC 4WBAA 2HLOB 3II6A 3E1IC 1GL2A 1RE3C 4EOTA 2NPSB 4ZFGA 2J60A 3BVHB 3VN0A 5CCGD 1L4AA 5APQA 1FZEA 4EIJA 1J1DC 1G2CA 1GZLA 2PP6A 2XKMA 5AVSB 2A45H 4ZKPA 2Q9IA 4W80A 2KLVA 1IO4A 3BRVB 3LW5H 1AQ5A 3P7KA 1RE3B 4O9BA 4N78D 3L36A 4C7NA 3MD0A 3V2QA 1HBWA 3V4WA 1LTAC 1SP4A 1XTGB 2I1KA 1IFJA 1KFNA 2IX7C 1IC2A 2N1TB 1N7SD 2N9BA 3RK2B 1KILB 1JY2O 5CCGA 4R9TA 1WRGA 1RF0C 5BU5A 3HD7B 2J3FA 4IFDK 2ZXEB 2Q9IC 2YNYA 1HH0A 5AVUB 3HD7D 3HUSB 1YYCA 4WY4A 2N1TC 2C0XA 1SLQA 2OYIC 1GK6A 3M0DA 3A7OA 1VPCA 5CCHA 5CMZA 1N86B 1RE4A 2WPQA 1IJDB 3OJAB 1G1IA 2HPCB 2JHIF 1GL2D 1GDTA 2WT7B 4GIFA 4IFMA 5AW1B 3TK1A 3P8CD 3GHGB 2A45G 5AVWB 1L4AD 4Y99B 3PP5A 1L0NK 1E5WA 2I1JA 2J1GA 1G1JA 5CHXA 4XA4A 3IFMA 2JJLA 2O1JA 1DH3A 1RE4C 5KJ7D 5AVYB 1L0LK 1WT6A 2NPSD 3SWYA 3NMDA 1IFMA 1H89A 1FZBC 1HVVA 3LIDA 1LTBC 3RK3C 1FZAA 4JYCA 5AVTB 4JZCA 1RE4B 3KQGA 3CI9A 1H88A 3BVHC 1Z3UA 1M1JC 2OYHC 1AFOA 2H43B 1ZR2A 3VMXA 5CCHC 2QM7A 1URQD 2J0HA 1FZEB 3RL0B 1A02J 1SQXK 1XTCC 2XDJA 1QL2A 1RY3A 4M7FA 3P8MC 1FOSE 2J61A 1NH4A 2H43A 1J1DB 2HPCC 1FZGC 2VRSA 1X79B 2MJZA 5APXA 2HLOA 3KPEA 5APWA 1LTJA 2GUSA 1FJKA 3M9BA 3B5ND 3HE5A 4IFFA 4WB4A 2YKPA 1HGZA 1LTIC 1FZCA 1NTKK 1IK9A 1SQPK 3MTUE 4DOJA 4I1LA 3NXSA 1IFNA 1FICA 1URQB 2FXMA 1NOHA 1FZFB 2WPSA 2XZRA 1KILC 4N78E 5AVQB 1SVFA 2FFDC 2P7JA 1JUNA 1GW3A 1HJBA 2Q9IB 3UIAA 4M7HA 2HLOC 2Q5UA 1RF0A 1FAVA 1T2KC 2J59M 3VYIA 3WMM0 1L4AB 1N7SA 4N3YB 2QM8A 3L37A 3B5NA 1FZFC 1YTZT 1GL2B 1SFCD 4AYCA 1JO5A 3V5BA 3M0AA 1MUUA 5AVVB 3VMYA 2J2PA 1SQVK 1GD2E 2JHLF 1EQ7A 1QL1A 1LTTC 1T3JA 2W27A 4JYBA 3KDPB 3T97A 3HUSA 3M9QA 1JCCA 4WY4C 1LWUA 3BRTB 3RL0C 4HH2A 5KTBA 2P1JA 2P67A 3CL3D 1NWQA 1JY2P 1ZR4A 4ZKUA 3RK2D 1SFCA 5BU8B 3E1IB 2E43A 1JY3P 4LLHA 4LGDE 2ZFCA 3HTKB 2CPBA 3H32C 1MFZA 3V2NA 2W6AA 4XE5B 2J61B 4C7RA 3EFGA 3H6PA 1JNMA 4C46A 2R5BA 2FFDB 1RE3A 2O01H 2XNXA 3B8EB 4I2LC 1J1EC 3GHGC 4NYTA 1M1JB 2OYHB 3P8CE 2FIBA 3OAKA 1HGVA 1MZ9A 2GY7A 1GK4A 4HYTB 2Q7CA 1SFCC 2GUVA 2J64A 2JEEA 3SWFA 4M3LA 3M9HA 1N7LA 1FZBA 1LTGC 2WTYA 1NHLA 5AVRB 1L4AC 4AUWA 2C9LY 3V2PA 2LKMA 1FDMA 2C9NY 4KHXA 2WWWA 4GKGA 1NAFA 5AW0B 1LT9A 2FYZA 1YTZI 5AVZB 3M91A 3IR9A 2FKWB 1S9KE 1ZN5A 1RF1B 1LTSC 5CJ0A 2Z4EA 2O1KA 1LWUB 1T3UA 3L35A 1URQA 5KLVK 3R2PA 1LT9B 1FZCB 2Z4EB 2L5GB 2WSEH 5AW3B 5AVXB 3GHGA 2YO3A 1ZV8A 5APVA 1LTJB 1JMMA 1IFIA 2R5DA 1IFDA 1T8ZA 1NTMK 2H43C 2GM4A 1N86A 1GU4A 2PAJA 2KSJA 5AW2B 3VOPA 2OYIA 4AQRD 4JF7A 1CI6B 2HODA 2HYNA 3MGNA 5APUA 1N7SB 3A2AA 3NTNA 3TNUA 3KYQA 1ZLLA 2WPRA 1FZCC 4DZOA 4OH8B 1NO4A 2H7HA 2KYVA 5CCGC 2NPSC 1OXZA 3N4XA 2FFDA 1N73A 1NKZB 1KILA 1FIBA 3BATA 5APYA 1URQC 2IFMA 2J3FD 2YKQA 4W7YA 1FZFA 1H8AA 1MV8A 3MUDA 1N7SC 5CJ4A 1NKNA 1DEBA 1GTWA 1N86C 1JC9A 1FJPA 2H8PD 1JY2N 3HTKA 3VTPC 3E1IA 3OA7A 3B5NC 1KZUB 2FYUK 3LIEA 1FZEC 4JYOX 1JCDA 1RF1A 2P2UA 2JHMF 1N73B 1T2KD 1CZQA 1Z3SA 3M06A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RE3 A;  2XNX A;  2J0Y A;  3BVH A;  3GHG C;  4JZC A;  4NYT A;  1LTJ C;  1M1J B;  2OYH B;  1RE4 B;  2FIB A;  2GY7 A;  2HLO B;  3E1I C;  3BVH C;  1RE3 C;  1Z3U A;  1M1J C;  2OYH C;  2H43 B;  4ZFG A;  2J60 A;  1FZA C;  3BVH B;  2J64 A;  2HPC A;  2J0H A;  1FZE B;  4M7F A;  2OYI B;  2J3U A;  1FZE A;  1FZB A;  2J3G A;  2J61 A;  3HUS C;  2H43 A;  2HPC C;  1FZG C;  2A45 H;  2WNP F;  2Q9I A;  2HLO A;  1FZD A;  2D39 A;  1LTJ A;  1FZG A;  2XNX B;  1RE3 B;  1LT9 A;  2A45 I;  1W2E A;  3H32 B;  1RF1 B;  2Z4E A;  1FZC A;  2JHH C;  1RF1 C;  1LWU B;  1T3U A;  1FIC A;  2Z4E C;  2J3O A;  1FZF B;  1LT9 B;  1FZC B;  2Z4E B;  2FFD C;  1LT9 C;  1JY2 O;  3GHG A;  2J0G A;  4R9T A;  2Q9I B;  1RF0 C;  1FID A;  2J3F A;  2Q9I C;  4M7H A;  1LTJ B;  2HLO C;  4R9J A;  1RF0 A;  1FZB B;  2JHK F;  2H43 C;  1JY3 O;  1N86 A;  2OYI A;  2HOD C;  2HOD A;  3HUS B;  2OYI C;  1FZF C;  1FZC C;  1N86 B;  1RE4 A;  1M1J A;  2OYH A;  2HPC B;  2JHI F;  2J2P A;  2J5Z A;  2FFD A;  2JHL F;  3GHG B;  2A45 G;  1N73 A;  1FIB A;  1LWU C;  2J3F D;  1FZF A;  2HOD B;  3HUS A;  1FZA B;  1LWU A;  2J1G A;  1RF0 B;  3H32 A;  4EPU A;  1JY2 P;  1JC9 A;  1N86 C;  1JY2 N;  1RE4 C;  1FZG B;  3FIB A;  3E1I B;  3E1I A;  1JY3 P;  1JY3 N;  3H32 C;  1FZE C;  2XNX C;  1FZB C;  4JYO X;  2J61 B;  1RF1 A;  2JHM F;  1N73 B;  1Z3S A;  1FZA A;  2FFD B;  1N73 C; 
#chains in the Genus database with same CATH topology
 1GL2 C;  1S5L E;  3H1L J;  3NFQ A;  1LTJ C;  3N7N A;  1Q82 Q;  2WT7 A;  3SFD C;  3L75 D;  3WUU A;  2HPC A;  4W7Z A;  3BAS A;  1MFT A;  4IOI H;  2O3J A;  3H1H G;  3L70 E;  3W68 A;  1HWT C;  3GMA A;  1J2J B;  2JDI H;  2D39 A;  1FU1 A;  1W2E A;  2W6J H;  3H32 B;  2WSC H;  4Y99 C;  1PFI A;  2WMM A;  3HE5 B;  3HRN A;  3L70 G;  3S9O A;  3MIW A;  1JY3 O;  3D6Y A;  2Z5H A;  1BGY J;  1VQ6 P;  1A02 F;  1QVF O;  1EDI A;  2CPS A;  2QJP C;  2QVA A;  3R4Y A;  4H13 D;  1NTZ K;  1NTZ G;  1BSH A;  3I5C A;  1HUC A;  2Q3I A;  3CLQ A;  5APS A;  4EPU A;  3VP8 A;  1GW4 A;  3F5H A;  3SSU A;  4C7N B;  3CMA P;  1FZG B;  2WIT A;  3FIB A;  5AW4 B;  1PP9 J;  1NU1 E;  3C9I A;  3TYY A;  3P32 A;  3HE4 B;  2XNX C;  1K8A Q;  2KB7 P;  3H1J E;  5KJ7 A;  2NRG A;  1JTH A;  5APT A;  1N2D C;  2KI7 B;  3S1K A;  3A0B H;  4I6M C;  2HLO B;  1YJ9 P;  1SQV D;  3VN0 A;  4JQ0 D;  3G9R A;  1PGO A;  3L74 G;  2A45 H;  1PGP A;  3O6Q A;  2QJK B;  1D7M A;  4W80 A;  5M1B A;  1OW6 A;  3P7K A;  3GLM A;  3V2Q A;  1YJN P;  3OW2 O;  3V4W A;  1SP4 A;  3CWB J;  2IX7 C;  5KKZ C;  3TF5 A;  3MP7 B;  2KZI A;  4R9T A;  1SQQ E;  2ZXE B;  1LT1 A;  3O6Q B;  2N1T C;  2C0X A;  1SLQ A;  1UIX A;  3A7O A;  1VPC A;  1NTM J;  2WPQ A;  1IJD B;  3OJA B;  2WT7 B;  4GIF A;  1BE3 J;  5H2F H;  3L74 J;  1E5W A;  2WSE J;  2KIK A;  2WSC J;  3IFM A;  3H1I D;  2O1J A;  2KS1 A;  4PD4 I;  2V7Q H;  5KLV D;  1WT6 A;  1IFM A;  1JM0 A;  1KQS O;  1M90 Q;  2P58 A;  3KQG A;  1H88 A;  3BVH C;  1M1J C;  2OYH C;  3Q3D A;  2H88 C;  1QGK B;  3P8M C;  2I8D A;  1SQX J;  1W2B O;  2J61 A;  2E74 D;  2E75 B;  3AEB C;  1FZG C;  5APW A;  2B88 A;  4L75 A;  4U3F D;  3CC7 P;  2FXO A;  4IFF A;  1NAY A;  5GTI E;  3MTU E;  4DOJ A;  1URQ B;  2FXM A;  1SQP E;  3A0B E;  1KIL C;  2H89 C;  1BCC E;  5AVQ B;  1HJB A;  2Q5U A;  4OGQ D;  1RF0 A;  1Y9B A;  3WMM 0;  1L4A B;  3CCL P;  2IBZ E;  2B87 A;  3JCU H;  2QM8 A;  1GL2 B;  1JO5 A;  1ZRT E;  3M0A A;  5AVV B;  1YQ4 C;  1GD2 E;  1M57 D;  2JHL F;  2K37 A;  2W27 A;  2IBZ I;  2N9Y B;  3AEA C;  3T97 A;  1IK7 A;  4HH2 A;  4I7Z B;  4H44 D;  2FYU J;  4BRY A;  3AEF C;  5BU8 B;  2E43 A;  3CCV P;  4LLH A;  1KN7 A;  2QJY C;  2W6A A;  3H1I G;  2J61 B;  2M0B A;  1PZQ A;  1JNM A;  1K73 Q;  2R5B A;  1L0L J;  1RE3 A;  2KUB A;  3B8E B;  5GTH H;  5TJH A;  1HGV A;  3JSV C;  1PP9 G;  2Q7C A;  4HYT B;  2GUV A;  2QE7 H;  2JEE A;  1X0T A;  3M9H A;  2YIU C;  1NYH A;  1AVY A;  2Y0C A;  1S4X A;  1FZB A;  4RO0 A;  2C9L Y;  1RHZ B;  3V2P A;  2JP3 A;  4WVZ A;  3D70 A;  4NPE A;  4XFJ A;  5AW0 B;  4KJM A;  3S4R A;  3L75 G;  3IR9 A;  1FE6 A;  2V7Q J;  4BRY B;  1HF9 A;  1RF1 B;  2L91 A;  1MKM A;  1NU1 G;  1LWU B;  3L35 A;  1FDO A;  4L73 A;  5KLV K;  3ABV C;  4ASW A;  2Z4E B;  2L5G B;  2WSE H;  2R5D A;  1YIJ P;  2H43 C;  2GM4 A;  2OYI A;  3VOP A;  1NTK E;  1CI6 B;  2HOD A;  2HYN A;  5APU A;  3TGU D;  4U3F E;  1BE3 G;  1T6A A;  1FZC C;  4DZO A;  3CD6 P;  1NO4 A;  2H7H A;  2IYP A;  4ZNC A;  1KB9 E;  1SQB E;  4PJ0 H;  2O01 J;  4HJG H;  1FZF A;  2FYU G;  2V4H A;  2AXT H;  1FC2 C;  4D6T D;  1NKN A;  1DEB A;  1FJP A;  2H8P D;  4OWF A;  4GOD A;  1ZXG A;  3B5N C;  2KXP B;  4PV1 B;  1SQQ G;  3LIE A;  5CBO A;  2K88 A;  1JCD A;  4KT0 J;  1Z3S A;  3M06 A;  4GT1 A;  1J1E B;  2LXB A;  3RK2 C;  2YXQ B;  2KP8 A;  3B5N B;  3H1J D;  1LP1 A;  3CPW O;  3H1K G;  3QWO C;  2N1T D;  3TSI A;  1U7M A;  3JC2 2;  2W8Z A;  4IL6 E;  5AW7 B;  2IPP A;  3HD7 A;  1M7L A;  2QG4 A;  2Z5I A;  2JHH C;  1OFC X;  1RF1 C;  1S9K D;  2M5A A;  2JR8 A;  3AE8 C;  3L70 J;  4RES B;  3H1K E;  1FID A;  2E75 D;  3RGU A;  4R9J A;  5KJ7 C;  4H13 B;  3L73 E;  2JHK F;  4R4M A;  2AEM A;  2D2C C;  2B89 A;  1CSB A;  1NTZ E;  3VMZ A;  2J5Z A;  1JTH B;  1CI6 A;  2HOD B;  1FZA B;  4LC1 A;  1M1K Q;  2HG5 D;  3HE4 A;  2XV5 A;  3I55 P;  1WMK A;  2W6B A;  2OAR A;  3AE4 C;  2YMY A;  3AE9 C;  2E42 A;  3RK3 B;  5GTI H;  4UB6 H;  1SQB K;  2XU6 A;  2YMK A;  1N73 C;  3H1L E;  2O01 N;  4WBA A;  3FGA D;  3E1I C;  2G8Y A;  3TDK A;  5CCG D;  1K05 A;  1BDC A;  3GW6 A;  1NU1 J;  5B5E E;  1LJ2 A;  2PP6 A;  2QEX P;  1PV3 A;  5TIS H;  2Q9I A;  2ZJS E;  1IO4 A;  3BRV B;  3H1K D;  1AQ5 A;  1RE3 B;  4N78 D;  1SQV G;  1AV1 A;  3MD0 A;  1HBW A;  1LTA C;  3AEE C;  1Q2N A;  2RMZ A;  3H25 A;  2MKV A;  3CWB G;  3C1L A;  4L74 A;  2AEJ A;  3RK2 B;  1JY2 O;  3EFF K;  5CCG A;  5BU5 A;  2J3F A;  4IFD K;  1SQB G;  1HH0 A;  1YYC A;  1P84 D;  4GOE A;  2OYI C;  3M0D A;  5CMZ A;  5DJT B;  1GL2 D;  1GDT A;  1LNQ A;  1VQM P;  3TGU E;  1QVG O;  3D6Z A;  2HR3 A;  2I1J A;  1L0L K;  2NPS D;  2ZVN B;  1BE3 E;  1FZB C;  1R5S A;  1SQX E;  3L74 E;  4OGQ B;  3QH9 A;  5AVT B;  1M56 D;  1RE4 B;  3CI9 A;  1P84 H;  2H43 B;  1AFO A;  3RK3 E;  1URQ D;  2J0H A;  1SQX K;  1QL2 A;  1SQP J;  1FOS E;  3CX5 I;  1NH4 A;  1NJI Q;  1UII A;  1JMB A;  2AEF A;  2HPC C;  4H0L C;  1X79 B;  2HLO A;  3KPE A;  4QMA A;  3AEC C;  1LTJ A;  2GUS A;  1EDJ A;  3B5N D;  1KB9 H;  2SPZ A;  3HE5 A;  1HGZ A;  1LTI C;  1OIP A;  1FZC A;  1NTK K;  1IK9 A;  1SQP K;  1K9M Q;  4YTP C;  4EDF A;  3WU2 E;  1FIC A;  1FZF B;  2WPS A;  4N78 E;  3CME P;  2AXT E;  2P7J A;  1JUN A;  3UIA A;  3EWK A;  3VYI A;  1U57 A;  5B5E H;  3H1H J;  1N7S A;  5GTH E;  1NTM E;  1KYO H;  1YTZ T;  4AYC A;  1KV4 A;  3L72 D;  3L71 G;  4Y28 J;  1BCC J;  3L73 G;  3C8V A;  1RQV A;  3Q2Y A;  1T3J A;  3MUD C;  4JYB A;  3KDP B;  2FYN C;  4EYY Q;  1NTM D;  3M9Q A;  1JCC A;  2P67 A;  1QLE D;  4U7J A;  2FBW C;  3E1I B;  1NTM G;  1MFZ A;  2QA4 P;  1Q81 Q;  1U7J A;  1PP9 D;  4ASV A;  4D6T G;  3Q5P A;  4I2L C;  1J1E C;  2FYU E;  3GHG C;  2GA1 A;  4NYT A;  2FIB A;  2GY7 A;  1MZ9 A;  1SQV J;  1GK4 A;  1ZME C;  5L8R J;  3W67 A;  1L0L D;  2B87 B;  1N7L A;  1LTG C;  5B66 E;  2WTY A;  1OVR A;  1EDK A;  2KSE A;  4PJ0 E;  2C9N Y;  5AVZ B;  2LXC B;  2W90 A;  1SQP D;  2FKW B;  2K9J A;  1BCC G;  4U3F J;  5CJ0 A;  2Z4E A;  2IDB A;  1T3U A;  1URQ A;  1JEK A;  2KK7 A;  2WQY C;  2Q1K A;  1BGY D;  5AVX B;  3GHG A;  2YO3 A;  1Q86 Q;  1ZV8 A;  1IFD A;  2OGU A;  5KLV G;  1KTM A;  3CXH E;  4AQR D;  4JF7 A;  2XND H;  3MGN A;  3NTN A;  3KYQ A;  1ZLL A;  1QEX A;  1KB9 I;  2KYV A;  5CCG C;  1OXZ A;  3MZW B;  2FFD A;  1H0T B;  2E5T A;  5APY A;  2J3F D;  2YKQ A;  1H8A A;  3MUD A;  1GTW A;  2OTJ P;  3HTK A;  2KNC B;  5TIS E;  3E1I A;  1R5L A;  2BCC G;  2QSI A;  1RF1 A;  2P2U A;  2ZAE B;  2JHM F;  1L0L E;  3CX5 D;  3USS A;  2J0Y A;  3HD7 C;  1SQQ K;  1X22 A;  3G3Z A;  1KIL E;  1SQX D;  2R3C A;  2OYI B;  3I56 P;  3KXD A;  4BXL A;  2J3U A;  2BCC E;  3EQ2 A;  2HFE D;  3V2R A;  3L75 E;  3H1K J;  5BVZ A;  3RK3 D;  1EDL A;  2M3B A;  3FXD A;  1FZD A;  2YO2 A;  3PLN A;  3U1C A;  3L73 J;  2XNX B;  4H44 C;  2A45 I;  2R32 A;  4PD4 D;  1LGH B;  2C0W A;  1X8Y A;  5CCH D;  3A5T A;  2N1T A;  1YI2 P;  2J3O A;  3PJS K;  2J0G A;  2WPV B;  1K04 A;  3A3Y B;  4K35 A;  3SWK A;  1G2C B;  1N8R Q;  4WY4 B;  1E79 H;  3PTZ A;  2WZ7 A;  2E76 B;  2IZ0 A;  2KOG A;  1VDF A;  3V6I A;  3RL0 D;  3U59 A;  1L0N G;  1GMJ A;  1VQO P;  3TGU J;  3TNU B;  1HJ0 A;  3CCS P;  3L72 E;  5AW8 B;  3IAO A;  2WSF H;  1X9V A;  1DIP A;  3IF4 A;  3H32 A;  3Q5S A;  3VP9 A;  2IFN A;  2Q3E A;  3H1J G;  1JOC A;  1VQ8 P;  3KHU A;  4PV1 D;  4OVN F;  2WSF J;  3AE2 C;  1GU5 A;  1GL2 A;  2PRR A;  4EOT A;  2NPS B;  1KYO D;  1VL2 A;  4ZFG A;  3BVH B;  1QX8 A;  2K1A A;  2IBZ D;  4EIJ A;  1GZL A;  5AVS B;  4TLF A;  3CC4 P;  2KLV A;  5H2F E;  2R3S A;  4O9B A;  1S5L X;  1OX3 A;  1KFN A;  3G71 P;  1N7S D;  1KQG B;  3B71 A;  2N9B A;  3IN6 A;  1KIL B;  4PD4 E;  4DCK A;  1WRG A;  3HD7 B;  2PGD A;  3FXE A;  2Q9I C;  5KAF H;  2YNY A;  2D2C B;  1AQT A;  3HUS B;  3L70 D;  1ZW0 A;  4WY4 A;  3H1H E;  1GK6 A;  3L74 D;  1N86 B;  1PIX A;  1PGQ A;  1NTZ J;  2QJP B;  4IFM A;  5AW1 B;  2QIW A;  3AEG C;  3P8C D;  3GHG B;  2FYN B;  3PP5 A;  3G6E P;  2J1G A;  3CCR P;  1G1J A;  5CHX A;  4XA4 A;  4I7Z C;  1EZV I;  2LR2 A;  5KJ7 D;  2R44 A;  3KZI H;  3H1I E;  1USD A;  4JBZ A;  3GF7 A;  3SWY A;  1HVV A;  1RH5 B;  3H1L G;  3LW5 J;  3LID A;  4UB8 E;  2WVR A;  5KLV E;  3RK3 C;  3AE5 C;  4JYC A;  4JZC A;  1NVO A;  4H44 B;  1SQV E;  3BCC E;  1Z3U A;  3H1L D;  3AE6 C;  3VMX A;  4A7P A;  5CCH C;  1ZR2 A;  2QM7 A;  1FZE B;  3PRJ A;  1XTC C;  1YJW P;  1RY3 A;  4Z1M H;  1EZV D;  2H43 A;  2JO1 A;  2CK3 H;  2ZT9 D;  1EXI A;  3M9B A;  1FJK A;  2M5A B;  1NU1 D;  3AE7 C;  4WB4 A;  1Y47 A;  2YKP A;  3NXS A;  3BCC G;  4TT3 H;  3VMA A;  2FFD C;  1AA0 A;  2E76 D;  2Q9I B;  1M8O B;  4NPF X;  4WWI A;  2HLO C;  2J59 M;  1P84 I;  1VQN P;  3B5N A;  1EXJ A;  3V5B A;  3VMY A;  2ZYD A;  4D6T J;  2J2P A;  2FYU D;  4NPD A;  1SQV K;  1SS1 A;  1NTZ D;  1QL1 A;  1ZOY C;  1ZRT D;  1VQ7 P;  3HUS A;  2Q6Q A;  3BRT B;  2P10 A;  3CC2 P;  4PD4 H;  1JY2 P;  1ZR4 A;  1BE3 D;  4ZKU A;  3RK2 D;  5KAF E;  1SFC A;  2KZJ A;  1KC8 Q;  2ZFC A;  3HTK B;  1VF5 C;  3V2N A;  4XE5 B;  5C39 A;  2JWA A;  2FFD B;  2AXC A;  3OAK A;  2J64 A;  1OW8 A;  3SWF A;  4M3L A;  4GDO A;  4DJG A;  5KLI B;  1NHL A;  2Y9Y A;  1L4A C;  3CX5 E;  5AVR B;  4HKZ H;  1NGM B;  2E75 C;  5E79 E;  4KHX A;  2WWW A;  4GKG A;  1LT9 A;  2FYZ A;  4K3A A;  1LTS C;  1AVO A;  1VQL P;  3Q5R A;  3R2P A;  4YXW H;  2PFX A;  2KNC A;  2QJK C;  1NTK G;  5APV A;  2ZT9 C;  1LTJ B;  1Y8A A;  4MN4 C;  1IFI A;  1T8Z A;  1NTM K;  1GU4 A;  5AW2 B;  2KSJ A;  1AJY A;  1N7S B;  2WSS H;  3A2A A;  3TNU A;  1NTK D;  4OH8 B;  3CCM P;  3F89 A;  3N4X A;  1NKZ B;  3BAT A;  1URQ C;  5CBN A;  1SQQ D;  4W7Y A;  3L72 J;  1N7S C;  5CJ4 A;  2YIU B;  1N86 C;  1JY2 N;  3VTP C;  1L2P A;  1KZU B;  3L71 J;  4JYO X;  1VQ9 P;  2BCC J;  3L75 J;  1T2K D;  1CZQ A;  3H1J J;  4L76 A;  2B9B A;  3L71 D;  2DW3 A;  3L72 G;  5KKZ B;  2JWD A;  1FZA C;  4PV1 C;  2RH0 A;  2ITA A;  3M0D C;  5AW9 B;  5DJU B;  3A0H E;  3AED C;  5KLI C;  2ZYA A;  2J3G A;  1KQL A;  1CW5 A;  3HUS C;  2WNP F;  2M8R A;  2IZ1 A;  2J58 A;  1FZG A;  3K5B A;  5AW6 B;  2YKO A;  3CCJ P;  1BGY E;  3L4F A;  2POH A;  1IZN B;  2QJY B;  3CWB E;  1USE A;  4WY4 D;  3RL0 g;  1FOS F;  2Z4E C;  1S72 P;  1VQK P;  4H0L B;  5KAI E;  1LT9 C;  1SFC B;  3V4Q A;  2E74 B;  3G4S P;  1FZB B;  3U1A A;  2ZT9 B;  3FX0 A;  4IL6 X;  1DX7 A;  2HOD C;  1KB9 D;  3ITK A;  1NU1 K;  1L0N J;  5E79 H;  2OTL P;  3H1H D;  1Z56 A;  1M1J A;  2OYH A;  1S3J A;  2NPS A;  1PP9 E;  1YBK A;  3GF3 A;  2A06 G;  1FBM A;  1KFM A;  4JPZ B;  1BCC D;  1S2E A;  4IL6 H;  1LWU C;  5K5G B;  4N6J A;  5EFW B;  1OWA A;  1RF0 B;  1PPJ E;  2ZYG A;  3PHL A;  2BAS A;  4B86 A;  5AW5 B;  1JY3 N;  1SQX G;  3O8Z A;  3E7K A;  1HTL C;  2K9J B;  1KIL D;  2Y9Z A;  1VQ5 P;  3BVH A;  3II6 A;  1Q90 D;  1RE3 C;  2J60 A;  1BSN A;  2K3R A;  1L4A A;  1YHQ P;  5APQ A;  1BDD A;  1FZE A;  3CCU P;  1J1D C;  1G2C A;  2XKM A;  2JKV A;  4ZKP A;  3LW5 H;  1IFP A;  3BCC D;  4C7N A;  3L36 A;  2OQQ A;  4EI2 A;  1XTG B;  2I1K A;  1IFJ A;  1IC2 A;  2N1T B;  1S5L H;  2ZVO B;  3KZI E;  2KS1 B;  4UB6 E;  1OVV A;  1RF0 C;  1PPJ G;  1ZP0 C;  4UB8 H;  5AVU B;  3HD7 D;  2RKL A;  3ZDM A;  3T97 B;  2E76 C;  5CCH A;  2YXR B;  1RE4 A;  1P84 E;  1G1I A;  2HPC B;  2JHI F;  3TK1 A;  1SQQ J;  2A45 G;  5AVW B;  1EC5 A;  1L4A D;  4Y99 B;  3CCQ P;  5KLV J;  1L0N D;  1L0N K;  3CXH I;  2W83 C;  2JJL A;  2QRX A;  1DH3 A;  2E5Y A;  1RE4 C;  5AVY B;  2BCC D;  1YQ3 C;  3NMD A;  1H89 A;  2IYO A;  3WUV A;  2UWJ E;  1PPJ D;  2K9Y A;  1LTB C;  2OTK E;  2FY8 A;  1FZA A;  1W5C E;  4DT0 A;  1VF5 D;  1DD3 A;  2A06 D;  4U3F G;  3RL0 B;  1A02 J;  2XDJ A;  4M7F A;  1KYO E;  2M3E A;  1PL5 A;  1J1D B;  2VRS A;  2Y0E A;  4BWN A;  2MJZ A;  5APX A;  1RQU A;  2G3A A;  3AE3 C;  1OZH A;  4H13 C;  3GG2 A;  3D71 A;  3WUT A;  3BCC J;  2Y0D A;  4I1L A;  1PGJ A;  1IFN A;  1NOH A;  2XZR A;  4ZMD A;  1SVF A;  2NZ2 A;  1GW3 A;  1H0T A;  4M7H A;  3RBZ A;  1FAV A;  2BEQ D;  1T2K C;  1NTK J;  1JB0 J;  1SQB D;  4N3Y B;  3PH0 A;  3L37 A;  4RJT A;  1FZF C;  2IBZ G;  1SFC D;  3CCE P;  1VQ4 P;  1MUU A;  1KQF B;  1EQ7 A;  1SQB J;  3B4S A;  1LTT C;  5B66 H;  3CX5 H;  1R8E A;  4GOF A;  4WY4 C;  1LWU A;  3RL0 C;  5KTB A;  2P1J A;  1YIT P;  3CL3 D;  1NWQ A;  3WU2 H;  1Q7Y Q;  1KD1 Q;  1DD4 A;  1JY3 P;  3H1I J;  4D6T E;  4LGD E;  2CPB A;  1TU3 F;  3H32 C;  4CPG A;  2D2C D;  2J5U A;  3SFE C;  4C7R A;  3EFG A;  3H6P A;  4R4L A;  4C46 A;  2BEZ F;  3FWL A;  1FS0 E;  2O01 H;  2XNX A;  3JCU E;  2E74 C;  1M1J B;  2OYH B;  3P8C E;  1S1C X;  5KAI H;  3CXH H;  2ZXX A;  1SFC C;  3TGU G;  1SQP G;  1VF5 B;  3L73 D;  3FWN A;  4AUW A;  1OVU A;  1FDM A;  1EZV G;  2LKM A;  3MHV A;  1NAF A;  1YTZ I;  3M91 A;  1VQP P;  2FXP A;  1S9K E;  1OMI A;  1ZN5 A;  4OGQ C;  2O1K A;  3E1R A;  3CWB D;  3RBX A;  1LT9 B;  1FZC B;  5AW3 B;  4H0L D;  1JMM A;  4YXD C;  4RKU J;  1OW7 A;  1N86 A;  2PAJ A;  4YPC A;  1KYO I;  1EZV E;  1LP1 B;  3CXH D;  2WPR A;  1BGY G;  1L0N E;  3Q1M A;  3L71 E;  2NPS C;  1DEE G;  3A0H H;  1FDI A;  1N73 A;  1KIL A;  1FIB A;  2IFM A;  2KLU A;  1MV8 A;  1JC9 A;  3AE1 C;  2OYO A;  4HB1 A;  1KMI Z;  3OA7 A;  1L0L G;  2FYU K;  1FZE C;  2RN0 A;  2A06 E;  1N73 B;  1KOR A; 
#chains in the Genus database with same CATH homology
 2J0Y A;  1GL2 C;  3HD7 C;  3NFQ A;  4GT1 A;  1SQQ K;  1LTJ C;  3N7N A;  1J1E B;  3G3Z A;  3RK2 C;  2KP8 A;  3B5N B;  2WT7 A;  1FZA C;  2HPC A;  4W7Z A;  3BAS A;  3M0D C;  5AW9 B;  2R3C A;  2OYI B;  2J3U A;  2N1T D;  2J3G A;  3EQ2 A;  3TSI A;  1HWT C;  2HFE D;  1KQL A;  3V2R A;  1CW5 A;  3HUS C;  5BVZ A;  3RK3 D;  2M3B A;  2WNP F;  2M8R A;  1J2J B;  1FZD A;  2YO2 A;  3U1C A;  2D39 A;  2J58 A;  1FZG A;  2XNX B;  5AW7 B;  5AW6 B;  2IPP A;  3HD7 A;  2A45 I;  1M7L A;  2R32 A;  1FU1 A;  2YKO A;  1LGH B;  1W2E A;  2C0W A;  3L4F A;  2POH A;  1X8Y A;  3H32 B;  2Z5I A;  5CCH D;  3A5T A;  2JHH C;  1RF1 C;  2WSC H;  4WY4 D;  2N1T A;  4Y99 C;  1S9K D;  1FOS F;  2Z4E C;  2J3O A;  1PFI A;  1LT9 C;  3HE5 B;  1SFC B;  4RES B;  2J0G A;  3V4Q A;  1FID A;  3HRN A;  4R9J A;  5KJ7 C;  1FZB B;  3U1A A;  2JHK F;  3A3Y B;  3MIW A;  1JY3 O;  1DX7 A;  2HOD C;  2Z5H A;  1G2C B;  4WY4 B;  1A02 F;  1NU1 K;  2WZ7 A;  1Z56 A;  2KOG A;  1M1J A;  1VDF A;  2OYH A;  3RL0 D;  3U59 A;  1CSB A;  2CPS A;  2NPS A;  3VMZ A;  2J5Z A;  1FBM A;  1KFM A;  1NTZ K;  3TNU B;  1LWU C;  3I5C A;  1JTH B;  1CI6 A;  2HOD B;  4N6J A;  5AW8 B;  1FZA B;  1OWA A;  2WSF H;  1X9V A;  4LC1 A;  1HUC A;  2Q3I A;  3CLQ A;  1RF0 B;  3H32 A;  5APS A;  4EPU A;  2HG5 D;  3HE4 A;  2XV5 A;  1GW4 A;  3VP8 A;  4C7N B;  2BAS A;  3VP9 A;  2W6B A;  1FZG B;  2WIT A;  3FIB A;  2OAR A;  4B86 A;  2IFN A;  5AW5 B;  5AW4 B;  1JY3 N;  2YMY A;  1JOC A;  3O8Z A;  3C9I A;  3TYY A;  3P32 A;  3HE4 B;  2XNX C;  1HTL C;  2E42 A;  3RK3 B;  2KB7 P;  5KJ7 A;  1SQB K;  2XU6 A;  1N73 C;  1KIL D;  1GU5 A;  1JTH A;  5APT A;  1N2D C;  3BVH A;  4I6M C;  4WBA A;  2HLO B;  3II6 A;  3E1I C;  1GL2 A;  1RE3 C;  4EOT A;  2NPS B;  4ZFG A;  2J60 A;  3BVH B;  3VN0 A;  5CCG D;  1L4A A;  5APQ A;  1FZE A;  4EIJ A;  1J1D C;  1G2C A;  1GZL A;  2PP6 A;  2XKM A;  5AVS B;  2A45 H;  4ZKP A;  2Q9I A;  4W80 A;  2KLV A;  1IO4 A;  3BRV B;  3LW5 H;  1AQ5 A;  3P7K A;  1RE3 B;  4O9B A;  4N78 D;  3L36 A;  4C7N A;  3MD0 A;  3V2Q A;  1HBW A;  3V4W A;  1LTA C;  1SP4 A;  1XTG B;  2I1K A;  1IFJ A;  1KFN A;  2IX7 C;  1IC2 A;  2N1T B;  1N7S D;  2N9B A;  3RK2 B;  1KIL B;  1JY2 O;  5CCG A;  4R9T A;  1WRG A;  1RF0 C;  5BU5 A;  3HD7 B;  2J3F A;  4IFD K;  2ZXE B;  2Q9I C;  2YNY A;  1HH0 A;  5AVU B;  3HD7 D;  3HUS B;  1YYC A;  4WY4 A;  2N1T C;  2C0X A;  1SLQ A;  2OYI C;  1GK6 A;  3M0D A;  3A7O A;  1VPC A;  5CCH A;  5CMZ A;  1N86 B;  1RE4 A;  2WPQ A;  1IJD B;  3OJA B;  1G1I A;  2HPC B;  2JHI F;  1GL2 D;  1GDT A;  2WT7 B;  4GIF A;  4IFM A;  5AW1 B;  3TK1 A;  3P8C D;  3GHG B;  2A45 G;  5AVW B;  1L4A D;  4Y99 B;  3PP5 A;  1L0N K;  1E5W A;  2I1J A;  2J1G A;  1G1J A;  5CHX A;  4XA4 A;  3IFM A;  2JJL A;  2O1J A;  1DH3 A;  1RE4 C;  5KJ7 D;  5AVY B;  1L0L K;  1WT6 A;  2NPS D;  3SWY A;  3NMD A;  1IFM A;  1H89 A;  1FZB C;  1HVV A;  3LID A;  1LTB C;  3RK3 C;  1FZA A;  4JYC A;  5AVT B;  4JZC A;  1RE4 B;  3KQG A;  3CI9 A;  1H88 A;  3BVH C;  1Z3U A;  1M1J C;  2OYH C;  1AFO A;  2H43 B;  1ZR2 A;  3VMX A;  5CCH C;  2QM7 A;  1URQ D;  2J0H A;  1FZE B;  3RL0 B;  1A02 J;  1SQX K;  1XTC C;  2XDJ A;  1QL2 A;  1RY3 A;  4M7F A;  3P8M C;  1FOS E;  2J61 A;  1NH4 A;  2H43 A;  1J1D B;  2HPC C;  1FZG C;  2VRS A;  1X79 B;  2MJZ A;  5APX A;  2HLO A;  3KPE A;  5APW A;  1LTJ A;  2GUS A;  1FJK A;  3M9B A;  3B5N D;  3HE5 A;  4IFF A;  4WB4 A;  2YKP A;  1HGZ A;  1LTI C;  1FZC A;  1NTK K;  1IK9 A;  1SQP K;  3MTU E;  4DOJ A;  4I1L A;  3NXS A;  1IFN A;  1FIC A;  1URQ B;  2FXM A;  1NOH A;  1FZF B;  2WPS A;  2XZR A;  1KIL C;  4N78 E;  5AVQ B;  1SVF A;  2FFD C;  2P7J A;  1JUN A;  1GW3 A;  1HJB A;  2Q9I B;  3UIA A;  4M7H A;  2HLO C;  2Q5U A;  1RF0 A;  1FAV A;  1T2K C;  2J59 M;  3VYI A;  3WMM 0;  1L4A B;  1N7S A;  4N3Y B;  2QM8 A;  3L37 A;  3B5N A;  1FZF C;  1YTZ T;  1GL2 B;  1SFC D;  4AYC A;  1JO5 A;  3V5B A;  3M0A A;  1MUU A;  5AVV B;  3VMY A;  2J2P A;  1SQV K;  1GD2 E;  2JHL F;  1EQ7 A;  1QL1 A;  1LTT C;  1T3J A;  2W27 A;  4JYB A;  3KDP B;  3T97 A;  3HUS A;  3M9Q A;  1JCC A;  4WY4 C;  1LWU A;  3BRT B;  3RL0 C;  4HH2 A;  5KTB A;  2P1J A;  2P67 A;  3CL3 D;  1NWQ A;  1JY2 P;  1ZR4 A;  4ZKU A;  3RK2 D;  1SFC A;  5BU8 B;  3E1I B;  2E43 A;  1JY3 P;  4LLH A;  4LGD E;  2ZFC A;  3HTK B;  2CPB A;  3H32 C;  1MFZ A;  3V2N A;  2W6A A;  4XE5 B;  2J61 B;  4C7R A;  3EFG A;  3H6P A;  1JNM A;  4C46 A;  2R5B A;  2FFD B;  1RE3 A;  2O01 H;  2XNX A;  3B8E B;  4I2L C;  1J1E C;  3GHG C;  4NYT A;  1M1J B;  2OYH B;  3P8C E;  2FIB A;  3OAK A;  1HGV A;  1MZ9 A;  2GY7 A;  1GK4 A;  4HYT B;  2Q7C A;  1SFC C;  2GUV A;  2J64 A;  2JEE A;  3SWF A;  4M3L A;  3M9H A;  1N7L A;  1FZB A;  1LTG C;  2WTY A;  1NHL A;  5AVR B;  1L4A C;  4AUW A;  2C9L Y;  3V2P A;  2LKM A;  1FDM A;  2C9N Y;  4KHX A;  2WWW A;  4GKG A;  1NAF A;  5AW0 B;  1LT9 A;  2FYZ A;  1YTZ I;  5AVZ B;  3M91 A;  3IR9 A;  2FKW B;  1S9K E;  1ZN5 A;  1RF1 B;  1LTS C;  5CJ0 A;  2Z4E A;  2O1K A;  1LWU B;  1T3U A;  3L35 A;  1URQ A;  5KLV K;  3R2P A;  1LT9 B;  1FZC B;  2Z4E B;  2L5G B;  2WSE H;  5AW3 B;  5AVX B;  3GHG A;  2YO3 A;  1ZV8 A;  5APV A;  1LTJ B;  1JMM A;  1IFI A;  2R5D A;  1IFD A;  1T8Z A;  1NTM K;  2H43 C;  2GM4 A;  1N86 A;  1GU4 A;  2PAJ A;  2KSJ A;  5AW2 B;  3VOP A;  2OYI A;  4AQR D;  4JF7 A;  1CI6 B;  2HOD A;  2HYN A;  3MGN A;  5APU A;  1N7S B;  3A2A A;  3NTN A;  3TNU A;  3KYQ A;  1ZLL A;  2WPR A;  1FZC C;  4DZO A;  4OH8 B;  1NO4 A;  2H7H A;  2KYV A;  5CCG C;  2NPS C;  1OXZ A;  3N4X A;  2FFD A;  1N73 A;  1NKZ B;  1KIL A;  1FIB A;  3BAT A;  5APY A;  1URQ C;  2IFM A;  2J3F D;  2YKQ A;  4W7Y A;  1FZF A;  1H8A A;  1MV8 A;  3MUD A;  1N7S C;  5CJ4 A;  1NKN A;  1DEB A;  1GTW A;  1N86 C;  1JC9 A;  1FJP A;  2H8P D;  1JY2 N;  3HTK A;  3VTP C;  3E1I A;  3OA7 A;  3B5N C;  1KZU B;  2FYU K;  3LIE A;  1FZE C;  4JYO X;  1JCD A;  1RF1 A;  2P2U A;  2JHM F;  1N73 B;  1T2K D;  1CZQ A;  1Z3S A;  3M06 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...