3H32B

Crystal structure of d-dimer from human fibrin complexed with gly-his-arg-pro-tyr-amide
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
308
structure length
308
Chain Sequence
LYIDETVNSNIPTNLRVLRSILENLRSKIQKLESDVSAQMEYCRTPCTVSCNIPVVSGKECEEIIRKGGETSEMYLIQPDSSVKPYRVYCDMNTENGGWTVIQNRQDGSVDFGRKWDPYKQGFGNVATNTDGKNYCGLPGEYWLGNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGGFTVQNEANKYQISVNKYRGTAGNALMDGASQLMGENRTMTIHNGMFFSTYDRDNDGWLTSDPRKQCSKEDGGGWWYNRCHAANPNGRYYWGGQYTWDMAKHGTDDGVVWMNWKGSWYSMRKMSMKIRPFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibrinogen alpha chain
publication title Two families of synthetic peptides that enhance fibrin turbidity and delay fibrinolysis by different mechanisms.
pubmed doi rcsb
molecule tags Blood clotting
total genus 74
structure length 308
sequence length 308
chains with identical sequence E
ec nomenclature
pdb deposition date 2009-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
B PF08702 Fib_alpha Fibrinogen alpha/beta chain family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3h32B01
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 3h32B02
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 3h32B03
2J3UA 1FICA 1FZGB 1RE3B 1LTJC 1M1JA 2J3FA 1FZEA 1LT9A 2JHMF 2J5ZA 2OYIA 3HUSC 2JHIF 3E1IB 1FZBB 4ZFGA 1RF1A 1FZEC 2JHHC 1LT9C 2OYIC 2HLOB 1JY2P 1LWUA 1RF1C 2FFDB 2XNXA 3BVHB 2J61A 1RE4A 1JC9A 1RE4C 2OYHB 1W2EA 1JY3P 1LTJA 4NYTA 4JZCA 2J0HA 1FIDA 1RF0A 3HUSA 2H43B 2A45H 2JHKF 2HPCB 4M7HA 1RF0C 1M1JB 4M7FA 2FIBA 4EPUA 2Z4EC 2WNPF 2J64A 1N86B 2J2PA 1FZAB 1N73A 3BVHC 1FZFC 3GHGB 2A45G 2D39A 1N73C 2HODC 3H32B 1FZCB 1FZGA 2Q9IB 1RE3A 1FZGC 1RE3C 3E1IA 2J3FD 1FZBA 2J3GA 2GY7A 2Z4EA 3FIBA 1Z3SA 3E1IC 1FZBC 3HUSB 2FFDA 1FZEB 3BVHA 1FZFA 2JHLF 1LT9B 2HLOC 2OYIB 2A45I 2FFDC 1RF1B 2J1GA 2HODA 2OYHA 1Z3UA 1LWUB 2XNXB 2OYHC 4R9JA 2J61B 1RE4B 2H43A 1FZDA 2HPCA 2J60A 2H43C 1JY2O 2J3OA 1FIBA 1N86A 1LTJB 2HPCC 1FZAA 1M1JC 2HLOA 3GHGA 1RF0B 1N86C 2Z4EB 1JY2N 1FZAC 2J0GA 4R9TA 2J0YA 1T3UA 3GHGC 3H32A 1FZCA 2Q9IA 1FZFB 4JYOX 1JY3O 1LWUC 2XNXC 3H32C 1FZCC 2Q9IC 1N73B 2HODB 1JY3N
chains in the Genus database with same CATH superfamily
2YO2A 3Q3DA 2W8ZA 1SQBG 1M1JA 1AVOA 1NU1D 2SPZA 1U7MA 3MTUE 4WB4A 3NXSA 5GTIH 1JY2P 1EDIA 2XNXA 3KZIH 1Q81Q 1DX7A 1KYOH 1BDCA 1Q90D 3TK1A 2OYHB 2E74C 2KLUA 1W2EA 2Z5HA 3L74G 4NPDA 4JYCA 5H2FE 1HF9A 2H43B 5BU8B 3H1HD 1W2BO 2KOGA 3RBZA 3H6PA 2FIBA 4YXDC 3LIDA 1VQOP 3L71G 3B71A 5KJ7C 2JWAA 3H1IG 4GOEA 2GM4A 2XKMA 1GK6A 2ZYGA 2K9YA 4R4LA 4DCKA 3FWNA 3CWBD 1FZBA 1VQ6P 1IK9A 2C9NY 3GF7A 5DJUB 2WPRA 2QJKB 2HLOC 2A45I 3NTNA 1Z3UA 3CCRP 1LT1A 3H1KD 2Q3IA 1M1KQ 4U7JA 3HD7B 4JBZA 3O8ZA 4OGQC 5CJ0A 5AVVB 3S9OA 4D6TJ 4DOJA 2N1TA 3VN0A 5BU5A 2A06E 1T2KC 1FZAA 2HLOA 2XDJA 1OW7A 1VQLP 1N86C 2Z4EB 5KLVK 1VL2A 1FDOA 4YPCA 2O3JA 2QEXP 1USDA 4UB6H 4IL6E 1YBKA 3R2PA 2MJZA 1FZEA 5AVUB 4NPFX 4U3FG 3JCUE 2OYIA 2JHIF 1SFCD 3D70A 1RQVA 4OH8B 1L4AD 5GTHE 3L70J 3D71A 1VF5C 2FYUJ 3CI9A 2K37A 2A45H 3AE6C 2WSSH 2ZT9D 3S1KA 1NU1G 2D39A 3JC22 2WITA 3L35A 4JQ0D 2QE7H 3RK2B 2B88A 3CD6P 1SQVJ 1KILB 3RBXA 1CZQA 1Q82Q 1KQFB 4GT1A 2JHLF 4UB8E 1RF1B 3H1HG 1IO4A 4IOIH 4WVZA 3G4SP 3EWKA 1L2PA 3A7OA 3RK3D 1NYHA 3CXHD 1HWTC 2O01N 3KYQA 3CCQP 3GHGC 1JY3O 3AECC 2YKPA 1N73B 1SVFA 4RJTA 2YNYA 3AE4C 2J3UA 1NTZK 1FZGB 2QJYB 3H1KG 1WMKA 2QJPB 3MUDA 4D6TD 2JHHC 2IBZI 1S1CX 1LP1A 1LJ2A 2YKOA 1HBWA 2FFDB 3E7KA 1KYOE 2FYNB 1YJ9P 1BGYD 3FXDA 1JC9A 1KD1Q 4PV1B 1E79H 3HE4B 3ZDMA 1NTZD 3OAKA 3I55P 1ZOYC 5APUA 2RH0A 2PAJA 1AFOA 3G9RA 1Q2NA 3G3ZA 4AUWA 4HYTB 3WUVA 1L4AC 3A0BE 1RE3A 1H0TA 5L8RJ 2E5YA 1X79B 3FIBA 2LXBA 1Z3SA 1EDJA 2HR3A 1SFCA 1LT9B 1SQBE 1X9VA 4H13D 3CX5E 3PH0A 5CCGD 3TYYA 2ZT9C 5AW0B 1A02J 4EDFA 4O9BA 1ZR4A 3MHVA 1H88A 3A0HH 1LTJB 2H88C 2HPCC 2WSFH 2BCCJ 2Y0DA 2AEFA 2ZXEB 1NKNA 2R5DA 3L74E 3H32A 2AXTH 2Q9IA 3JSVC 1MZ9A 5KKZB 1QX8A 1QGKB 1QVFO 4H0LC 2R5BA 3W68A 3L71E 4ASVA 3H1IJ 1EDKA 1IFDA 1TU3F 1W5CE 3H1IE 2RMZA 1NAFA 4ZFGA 3PP5A 5B5EE 3C8VA 1H89A 3OA7A 2WMMA 3AE2C 1SQPJ 5E79H 1PP9J 2KSJA 2KP8A 4M7FA 1NVOA 3L72J 1N7SD 2B89A 1S9KE 1VQ8P 2HG5D 3VOPA 1GU4A 3E1RA 1GL2C 1ZLLA 4BRYB 2HODC 4D6TG 2CPSA 1NAYA 2W83C 1BGYG 5H2FH 1GD2E 2KB7P 3HTKB 2E42A 1KQGB 4U3FE 2HODA 1HJ0A 1KORA 1LGHB 2FXOA 2W27A 2N9YB 2YKQA 1L0LK 1HGZA 4KJMA 2J3OA 2ZFCA 1H8AA 3M9HA 3CCVP 1KMIZ 3L70G 3BCCE 1URQA 2ZAEB 3WMM0 1FDIA 1BSHA 5CCGC 3BASA 2HFED 1EQ7A 1KB9D 5TJHA 1LTGC 1NU1E 1OVVA 1XTCC 1L0LD 4KHXA 4M3LA 3D6ZA 1QEXA 2KNCA 3PRJA 2J5ZA 1EZVG 2IFMA 3ABVC 1ZV8A 1FE6A 1JNMA 2BCCD 1XTGB 1SQXJ 1RE4A 4I7ZC 1OWAA 5APSA 1NTKJ 2KSEA 3H1HJ 2MKVA 1JY3P 4IL6H 1L0NK 3TSIA 1T8ZA 3HE5B 2Q7CA 2ZXXA 4M7HA 3JCUH 4EPUA 1J1DB 3T97B 1R5SA 3RK2D 1SQQK 4RESB 2WSEJ 3CWBJ 1KILD 3Q5RA 2N1TD 2B9BA 2Q3EA 2WPVB 2K9JA 2KYVA 3Q5SA 1HUCA 2P7JA 1N7SC 3H1KE 2OYHA 3L72D 4GDOA 1SQQD 3U1AA 3O6QB 2H43A 1FZDA 2E76D 3QWOC 3GW6A 1FOSE 2WWWA 3H1JE 3U59A 2ITAA 5AVTB 2KS1B 1RF0B 1PGOA 1KC8Q 3WUUA 4UB8H 2P1JA 2E75B 1NTMK 2P10A 2QG4A 1LTIC 3H1LD 2I1JA 4Y99B 3MD0A 2J5UA 2R32A 2E43A 3HUSC 2P58A 5KLVJ 4EOTA 1PL5A 5AW2B 3LW5H 5AVXB 2DW3A 2W90A 2Y9YA 4PV1D 5TISE 3UIAA 2WSCJ 1S2EA 1SQXK 3CX5I 1PGPA 5KLIB 1NTKK 1FIDA 3HUSA 2G3AA 1OFCX 4ZNCA 1T6AA 1P84D 2WNPF 2J64A 3KDPB 3AE8C 2I1KA 3SWKA 1ZRTD 1G1JA 5KAIE 2M3BA 1YTZT 1SQXD 2BCCG 1BSNA 4WWIA 1MUUA 1Y47A 2CPBA 1NTKD 5APVA 2NPSB 1FZBC 1NKZB 3BRVB 1USEA 2QSIA 4JPZB 2V4HA 1LWUB 1AJYA 1EXJA 4R9JA 2J61B 3A0BH 2N1TC 2FYZA 3CXHE 5APQA 2OTJP 1JUNA 1GU5A 2XZRA 1FZAC 3V5BA 5AW1B 2UWJE 1LTTC 3CX5H 3ITKA 2QM7A 4JYBA 1SQPG 1PP9G 1KILA 1IFIA 1IZNB 4OVNF 3L72G 1SQQG 1G1IA 4D6TE 1S5LX 2E76C 3E1IB 1RF1A 1FZEC 4H44C 1BGYJ 1J2JB 2OYIC 5AVSB 3AEEC 1LNQA 5EFWB 2R44A 2M3EA 1NTZJ 3N7NA 5CBOA 1BE3D 2QM8A 5APTA 3FXEA 1J1EC 3H1LG 1M1JB 2J2PA 1N73A 1FZFC 5B5EH 2WZ7A 1Q86Q 2IX7C 5KLVD 2Z5IA 1CSBA 1VQ4P 1FZCB 1FZGA 2G8YA 3CC7P 3L70E 2PP6A 2GUVA 3FX0A 4ASWA 2FYUE 2J3FD 2BEZF 3B8EB 2FFDA 1FZFA 1HVVA 1YQ4C 3RL0D 3SWYA 1KFNA 1EZVE 2JO1A 2Y0CA 3HE4A 5CBNA 5CHXA 4I2LC 2E74B 4R4MA 4ZKUA 2NRGA 2XV5A 3WU2E 1SQVE 2H7HA 1JOCA 3MZWB 1SQXG 4R9TA 2OTLP 1NTKG 1VDFA 4WBAA 1QLED 2CK3H 2WVRA 3TGUD 1FICA 1LTJC 1LT9A 1CW5A 1FDMA 2AEMA 1FBMA 3MUDC 3PHLA 2HLOB 3CWBG 4N78D 3K5BA 1PV3A 3W67A 1OW8A 1OMIA 4L73A 2D2CB 3CCLP 1LTJA 4OGQB 2FXMA 1FU1A 2WTYA 1K04A 1X0TA 2YMKA 3CCJP 1EDLA 2P2UA 1N86B 4AYCA 1JMMA 1RHZB 1YITP 1KQSO 3SSUA 1PFIA 2RKLA 2H8PD 3PJSK 1RE3C 5AW9B 3M9QA 4NPEA 2KXPB 4WY4B 3IR9A 3BATA 1JCDA 1E5WA 2JEEA 1URQD 2YIUC 3B5NB 1SFCC 1PPJD 2OTKE 1VF5B 3AEGC 2R3CA 3RGUA 5KLVG 1QL2A 2E75D 4K3AA 2POHA 3SFEC 4BRYA 3LIEA 1BCCD 1KB9E 2V7QH 2L5GB 3H32C 2Q9IC 1L0LJ 3RL0C 3V4QA 1JM0A 2P67A 1K73Q 2M5AA 2W6JH 3HTKA 4XFJA 2J3FA 2JHMF 3VMZA 4HB1A 1IC2A 3AEFC 5KTBA 2BCCE 1FJPA 1N2DC 4PD4D 1K05A 1PGQA 4K35A 1M7LA 4JZCA 1JB0J 3P8CE 2JR8A 3TGUG 1FJKA 3GHGB 1IFJA 3RK3C 3CXHI 3M91A 1LTBC 5TISH 1L0NJ 2YXRB 5CJ4A 3V2PA 4EI2A 1SQPE 1PP9E 3WUTA 2AXCA 1S72P 1UIIA 1SQQJ 2BEQD 1JTHA 3CC2P 3L72E 1SQQE 4C7NB 1NJIQ 5CCHA 1KFMA 3HE5A 3CCMP 5KAIH 3T97A 5AW5B 3H25A 3A2AA 2ZVOB 1JY2N 3H1LJ 2Q6QA 1VQ9P 1NTZG 3M0DC 4W7ZA 5B66E 3HD7D 3G6EP 1URQC 1KYOD 1L4AB 1JCCA 1K8AQ 1DH3A 1PPJG 1RQUA 3VP9A 5AVQB 3CXHH 3U1CA 1CI6B 2WPSA 1NTMJ 3AEDC 1SQBK 3M0DA 3BRTB 3GG2A 3O6QA 4H13C 3L73D 4GOFA 1RE4C 1MKMA 2XU6A 1BCCG 3IF4A 1OX3A 2JWDA 4LGDE 1IJDB 1EZVI 1RF0A 2QA4P 1P84E 2FBWC 2HPCB 1N7LA 1UIXA 4EYYQ 1KQLA 1YTZI 1SQBD 1ZRTE 1GZLA 1KTMA 3M9BA 4H0LB 1SQXE 1HH0A 4N3YB 2ZJSE 4GIFA 3V2NA 1NTKE 4AQRD 5CMZA 3H1HE 1AQ5A 5KAFE 1HGVA 1MFZA 2Y9ZA 1X8YA 2B87B 3SFDC 3L74D 2J1GA 2KUBA 2OYHC 2QIWA 3EFGA 3CWBE 3V4WA 1PZQA 3L71D 2H43C 4HKZH 3VYIA 1L0ND 4I6MC 4A7PA 1OIPA 2J0GA 4IFDK 1GL2B 1LWUC 1QL1A 2HODB 5AW4B 3WU2H 2QJKC 1KN7A 4Z1MH 1LWUA 4IFFA 2D2CD 2FXPA 3BVHB 2J61A 3OW2O 3KXDA 1BE3J 3HD7C 1FAVA 3I5CA 3NMDA 4YTPC 4NYTA 1A02F 2WT7B 1NWQA 1GW3A 4I1LA 1S3JA 4XA4A 4RKUJ 2Z4EC 3F5HA 5KLVE 3V6IA 4BXLA 1GDTA 2KIKA 3HD7A 1NTMD 1JO5A 1IFPA 5BVZA 4WY4D 3E1IA 1KB9I 3TDKA 3FGAD 3L73G 2Z4EA 3B5ND 1OW6A 2WQYC 2BASA 1VF5D 1L0LG 3BCCD 2XNDH 4I7ZB 3TNUB 2IDBA 1VQPP 3KHUA 1WT6A 2K9JB 2J59M 2O01J 1FZCA 2ZVNB 2K1AA 3TGUJ 2IPPA 3GMAA 3AEBC 1NGMB 3L75D 3TGUE 2YXQB 3RK2C 4KT0J 3L37A 1GMJA 3F89A 1KILC 3RK3E 1PGJA 3OJAB 1FC2C 2O1JA 5APXA 4YXWH 1YQ3C 4IL6X 4N78E 1U57A 2K88A 3L4FA 1QVGO 2YO3A 2FKWB 1RF1C 1M8OB 4RO0A 1N7SB 1L0NG 1G2CB 1KB9H 2H89C 2KI7B 2OGUA 2JHKF 2Y0EA 5KJ7A 1BGYE 3CLQA 2A45G 1N73C 2D2CC 2PRRA 1FZGC 1NTZE 2IBZD 2QJYC 2IYOA 2QJPC 3HUSB 1ZMEC 3H1JD 1SP4A 2JDIH 2FFDC 2I8DA 1PPJE 5C39A 1OXZA 2FYNC 3Q1MA 2E5TA 2XNXB 2J58A 4PV1C 4L76A 1N86A 1BCCJ 4WY4C 1YYCA 1NTMG 1BCCE 1VQNP 4BWNA 3B5NC 5AVWB 3R4YA 1P84I 2OYOA 4C7RA 1S5LE 3C9IA 5AVZB 3AE5C 4GODA 3BCCG 4WY4A 1LTAC 2QVAA 1FZBB 3B5NA 1LT9C 4PD4E 4HH2A 3AE1C 3CMAP 4XE5B 1AQTA 1PIXA 3C1LA 4IFMA 5B66H 4DJGA 2K3RA 2C0WA 3IN6A 2J0HA 1IFNA 1M90Q 3L75G 4B86A 2KZIA 2N1TB 4DZOA 1FOSF 1R8EA 3P32A 1FZAB 2M8RA 4H0LD 1DIPA 4DT0A 5KKZC 3SWFA 4W80A 1YIJP 1EXIA 5CCHD 3MGNA 1YHQP 2J3GA 3LW5J 1P84H 2E76B 4PJ0E 2YMYA 1YI2P 1FZEB 4H44B 2OYIB 4CPGA 3Q5PA 3QH9A 2KK7A 2NZ2A 4N6JA 2O1KA 2J60A 1FIBA 2LXCB 5KAFH 1J1EB 2A06D 3IFMA 1GL2D 5GTIE 3GHGA 3NFQA 3KZIE 3CC4P 1T3UA 1BE3G 2IBZG 2Q5UA 4LC1A 1FZFB 3H1JG 4QMAA 1NHLA 1ZXGA 1JY3N 2FY8A 3CL3D 2WSEH 2FYUK 1Q7YQ 1IFMA 2OARA 3L36A 2GUSA 4C7NA 4L74A 3L73J 3L73E 1M56D 3USSA 3GF3A 1GTWA 3VMXA 1VQKP 1L0LE 3MIWA 4MN4C 3L70D 2FYUD 1SQVK 1X22A 1OVRA 1SQBJ 1HTLC 1L4AA 1SLQA 4TT3H 3MP7B 4GKGA 1EZVD 3AE7C 1VQMP 3TF5A 4Y28J 2GY7A 1CI6A 3L74J 1FS0E 1SQVD 2IFNA 3P7KA 1AA0A 4C46A 1LP1B 1KILE 1OVUA 3L71J 4UB6E 1KZUB 3VMYA 2NPSD 2HPCA 5CCHC 1NO4A 1L0NE 2WSCH 1JY2O 1DD3A 2LKMA 3FWLA 3HRNA 2Q1KA 3GLMA 5AW6B 2IYPA 1J1DC 3KPEA 1RH5B 3RL0g 1GK4A 3CCSP 3B4SA 3PLNA 4LLHA 4HJGH 2JP3A 2B87A 1RE3B 1H0TB 1D7MA 1HJBA 2C9LY 1ZP0C 5AVRB 1DEEG 2VRSA 2YIUB 2JKVA 1AV1A 1SFCB 3H1LE 2A06G 2O01H 2HYNA 2LR2A 4L75A 3IAOA 1K9MQ 2M5AB 1M57D 1Y9BA 1RF0C 3Q2YA 1GL2A 3PTZA 1DEBA 4U3FJ 3BVHC 2M0BA 2E75C 1NTME 3D6YA 3M06A 3VP8A 2ZT9B 3H32B 2Q9IB 3RL0B 4EIJA 4Y99C 1Y8AA 2IZ0A 1MV8A 3CCEP 3A5TA 1MFTA 2KS1A 1LTSC 3BCCJ 2R3SA 3BVHA 4ZKPA 3M0AA 3N4XA 1IK7A 2FYUG 3CX5D 4OWFA 1WRGA 1DD4A 1NU1J 2WT7A 1JMBA 4PD4I 2JJLA 5KLIC 1R5LA 2RN0A 3V2RA 3CPWO 5APYA 5DJTB 3EFFK 1YJNP 1KV4A 2KLVA 3L75J 2J0YA 5CCGA 3L75E 1JTHB 3RK3B 2E74D 3A3YB 3CCUP 1SQVG 1U7JA 2PFXA 3AE9C 3G71P 3CMEP 1SQPK 2NPSC 1YJWP 3P8CD 3S4RA 2PGDA 1JEKA 3H1ID 2OQQA 5K5GB 5KJ7D 1ZW0A 5GTHH 4JF7A 1SS1A 3AEAC 2W6AA 1S5LH 3V2QA 3TNUA 3KQGA 2NPSA 1VQ5P 1SQPD 2ZYDA 1PP9D 2V7QJ 1BDDA 3H1KJ 5M1BA 1ZN5A 4PD4H 5AW7B 1NOHA 1VQ7P 1S9KD 1NH4A 3AE3C 1ZR2A 4W7YA 4OGQD 1URQB 1BE3E 2IBZE 2QRXA 1T2KD 2WSFJ 1KYOI 3A0HE 3H1JJ 4H44D 1OZHA 3VMAA 3II6A 2WPQA 3E1IC 3EQ2A 2GA1A 2N9BA 2KNCB 1S4XA 2AXTE 1N7SA 1G2CA 1GW4A 2W6BA 2KZJA 4H13B 4U3FD 4ZMDA 5AVYB 1RE4B 1AVYA 1NU1K 2L91A 2ZYAA 5AW3B 5AW8B 4TLFA 1M1JC 1T3JA 1VPCA 5APWA 4PJ0H 2IZ1A 2C0XA 1N8RQ 3VTPC 1RY3A 4JYOX 1EC5A 2XNXC 2AEJA 1FZCC 3P8MC 1Z56A 5E79E 3I56P
chains in the Genus database with same CATH topology
2YO2A 3C9IA 5AVZB 1LTGC 1XTCC 4KHXA 4M3LA 3HTKA 1LTAC 4WY4A 1M1JA 2J3FA 2JHMF 3VMZA 2J5ZA 2IFMA 1IC2A 1FZBB 3MTUE 3B5NA 1LT9C 4WB4A 5KTBA 3NXSA 1ZV8A 4HH2A 1JY2P 1FJPA 1JNMA 1N2DC 2XNXA 4XE5B 1XTGB 1RE4A 1DX7A 4IFMA 1OWAA 1M7LA 3TK1A 5APSA 2OYHB 1W2EA 2Z5HA 1JY3P 4JZCA 2C0WA 2J0HA 4JYCA 1L0NK 1IFNA 3P8CE 3TSIA 1T8ZA 2H43B 3HE5B 5BU8B 4B86A 2Q7CA 2KOGA 2N1TB 4M7HA 4DZOA 3H6PA 1FOSF 2FIBA 4EPUA 1J1DB 3LIDA 3P32A 1FJKA 1FZAB 2M8RA 3RK2D 3GHGB 1IFJA 1SQQK 3RK3C 5KJ7C 4RESB 3SWFA 4W80A 3M91A 1LTBC 1KILD 5CCHD 2GM4A 2XKMA 3MGNA 1GK6A 5CJ4A 2N1TD 3V2PA 1FZBA 2J3GA 1IK9A 2C9NY 2YMYA 2WPRA 1FZEB 2KYVA 2HLOC 1JTHA 2OYIB 2A45I 3NTNA 1HUCA 2P7JA 1N7SC 4C7NB 2OYHA 1Z3UA 3U1AA 2Q3IA 5CCHA 1KFMA 2H43A 3HD7B 3HE5A 3O8ZA 4N6JA 5CJ0A 5AVVB 1FZDA 4DOJA 2O1KA 2N1TA 3VN0A 5BU5A 2J60A 1T2KC 1FOSE 2WWWA 1FIBA 3T97A 5AW5B 3U59A 1FZAA 3IFMA 1J1EB 3A2AA 1GL2D 2HLOA 2XDJA 5AVTB 3GHGA 1RF0B 3NFQA 1N86C 2Z4EB 1JY2N 5KLVK 1T3UA 2Q5UA 4LC1A 2P1JA 1FZFB 1NTMK 3M0DC 4W7ZA 3HD7D 1URQC 1LTIC 1L4AB 1JCCA 2I1JA 1NHLA 4Y99B 3MD0A 1JY3N 3R2PA 3CL3D 2WSEH 2FYUK 1IFMA 2MJZA 2OARA 1FZEA 1DH3A 3L36A 5AVUB 2R32A 2E43A 3VP9A 2OYIA 2GUSA 3HUSC 2JHIF 5AVQB 1SFCD 4C7NA 4EOTA 3U1CA 1CI6B 5AW2B 2WPSA 1SQBK 3LW5H 3M0DA 4OH8B 3BRTB 1L4AD 5AVXB 3UIAA 1GTWA 3VMXA 1RE4C 1SQXK 2XU6A 3MIWA 4LGDE 1IJDB 3CI9A 1NTKK 1FIDA 1RF0A 3HUSA 2A45H 1SQVK 2HPCB 1HTLC 1N7LA 2WNPF 1KQLA 2J64A 1YTZI 3KDPB 1L4AA 1SLQA 2I1KA 2D39A 3L35A 2WITA 4GKGA 1GZLA 3M9BA 3RK2B 1G1JA 1HH0A 1YTZT 2M3BA 4N3YB 4GIFA 3V2NA 4AQRD 5CMZA 1AQ5A 1KILB 1CZQA 1HGVA 1MUUA 2GY7A 1CI6A 1MFZA 2CPBA 5APVA 2NPSB 1X8YA 1FZBC 4GT1A 2IFNA 1NKZB 3P7KA 2JHLF 3BRVB 1RF1B 4C46A 2J1GA 1IO4A 1LWUB 2OYHC 1KZUB 4R9JA 3VMYA 3EFGA 2J61B 3V4WA 2NPSD 2HPCA 5CCHC 1NO4A 2WSCH 2H43C 1JY2O 2LKMA 3HRNA 2N1TC 2FYZA 5AW6B 3VYIA 3A7OA 1J1DC 3KPEA 5APQA 3RK3D 1JUNA 4I6MC 1GU5A 1GK4A 2XZRA 1FZAC 1HWTC 3V5BA 3KYQA 5AW1B 4IFDK 2J0GA 1LTTC 3GHGC 1GL2B 1JY3O 1LWUC 2YKPA 1QL1A 2QM7A 4JYBA 1N73B 4LLHA 2HODB 1SVFA 1KILA 2YNYA 2J3UA 1NTZK 1IFIA 1FZGB 1RE3B 5AW4B 1G1IA 3MUDA 1HJBA 3E1IB 2C9LY 1RF1A 1FZEC 2JHHC 1J2JB 2OYIC 5AVRB 5AVSB 1LWUA 2YKOA 1HBWA 4IFFA 2FFDB 2VRSA 3BVHB 2J61A 1SFCB 2O01H 2HYNA 1JC9A 3HD7C 1FAVA 3I5CA 3NMDA 3N7NA 4NYTA 1A02F 2QM8A 3HE4B 2WT7B 1NWQA 5APTA 1GW3A 3OAKA 4I1LA 1J1EC 4XA4A 1RF0C 1M1JB 2Z4EC 1GL2A 5APUA 1DEBA 2PAJA 1AFOA 2J2PA 1N73A 3BVHC 1FZFC 1GDTA 3G3ZA 2WZ7A 4AUWA 2IX7C 3M06A 3VP8A 2Z5IA 4HYTB 1CSBA 1L4AC 3HD7A 3H32B 1FZCB 1FZGA 2Q9IB 1JO5A 1RE3A 3RL0B 4EIJA 4Y99C 2PP6A 2GUVA 5BVZA 4WY4D 1MV8A 3E1IA 2J3FD 3A5TA 1X79B 1LTSC 2Z4EA 3FIBA 3B8EB 1Z3SA 3B5ND 2FFDA 2BASA 3BVHA 1FZFA 1SFCA 1LT9B 4ZKPA 1X9VA 3M0AA 1HVVA 3N4XA 5CCGD 3RL0D 3SWYA 3TYYA 1KFNA 5AW0B 1A02J 1WRGA 4O9BA 3HE4A 2WT7A 1ZR4A 2JJLA 5CHXA 4I2LC 1H88A 4ZKUA 3V2RA 2XV5A 3TNUB 5APYA 2H7HA 1LTJB 2HPCC 2WSFH 2ZXEB 1JOCA 1NKNA 2R5DA 1WT6A 2J59M 2KLVA 4R9TA 2J0YA 3H32A 1FZCA 2Q9IA 5CCGA 1MZ9A 1JTHB 1VDFA 3RK3B 2IPPA 3A3YB 4WBAA 2R5BA 3RK2C 3L37A 1FICA 1KILC 1LTJC 1IFDA 1SQPK 2NPSC 1LT9A 3OJAB 1NAFA 3P8CD 1CW5A 2O1JA 5APXA 1FDMA 4ZFGA 4N78E 3PP5A 1FBMA 3L4FA 5KJ7D 2YO3A 2HLOB 2FKWB 1RF1C 4N78D 1H89A 3OA7A 1N7SB 1G2CB 4JF7A 2W6AA 3V2QA 3TNUA 1LTJA 3KQGA 2FXMA 2NPSA 1FU1A 2KSJA 2KP8A 2WTYA 2JHKF 4M7FA 2P2UA 1N7SD 1S9KE 1N86B 2HG5D 5KJ7A 4AYCA 3VOPA 1GU4A 1ZN5A 1JMMA 5AW7B 1GL2C 1NOHA 1ZLLA 1S9KD 1NH4A 3CLQA 1ZR2A 2A45G 1N73C 4W7YA 2HODC 1URQB 1PFIA 2CPSA 2H8PD 1T2KD 1FZGC 1RE3C 5AW9B 3M9QA 3II6A 2WPQA 1GD2E 3E1IC 2KB7P 3EQ2A 2N9BA 3HUSB 3HTKB 4WY4B 3IR9A 3BATA 2E42A 1N7SA 1SP4A 1JCDA 1E5WA 2JEEA 2FFDC 1URQD 1G2CA 1GW4A 3B5NB 1OXZA 1SFCC 2HODA 1LGHB 2W6BA 2XNXB 5AVYB 2W27A 2J58A 2YKQA 1RE4B 1L0LK 1HGZA 2R3CA 1NU1K 5AW3B 5AW8B 2J3OA 2ZFCA 1H8AA 1QL2A 1N86A 3M9HA 4WY4C 1YYCA 1M1JC 1T3JA 1VPCA 5APWA 2POHA 2C0XA 3LIEA 3B5NC 5AVWB 3VTPC 1URQA 1RY3A 4JYOX 3WMM0 2XNXC 2L5GB 3H32C 1FZCC 2Q9IC 4C7RA 5CCGC 3BASA 2HFED 1EQ7A 3P8MC 3RL0C 3V4QA 1Z56A 2P67A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J3U A;  1FIC A;  1FZG B;  1RE3 B;  1LTJ C;  1M1J A;  2J3F A;  1FZE A;  1LT9 A;  2JHM F;  2J5Z A;  2OYI A;  3HUS C;  2JHI F;  3E1I B;  1FZB B;  4ZFG A;  1RF1 A;  1FZE C;  2JHH C;  1LT9 C;  2OYI C;  2HLO B;  1JY2 P;  1LWU A;  1RF1 C;  2FFD B;  2XNX A;  3BVH B;  2J61 A;  1RE4 A;  1JC9 A;  1RE4 C;  2OYH B;  1W2E A;  1JY3 P;  1LTJ A;  4NYT A;  4JZC A;  2J0H A;  1FID A;  1RF0 A;  3HUS A;  2H43 B;  2A45 H;  2JHK F;  2HPC B;  4M7H A;  1RF0 C;  1M1J B;  4M7F A;  2FIB A;  4EPU A;  2Z4E C;  2WNP F;  2J64 A;  1N86 B;  2J2P A;  1FZA B;  1N73 A;  3BVH C;  1FZF C;  3GHG B;  2A45 G;  2D39 A;  1N73 C;  2HOD C;  3H32 B;  1FZC B;  1FZG A;  2Q9I B;  1RE3 A;  1FZG C;  1RE3 C;  3E1I A;  2J3F D;  1FZB A;  2J3G A;  2GY7 A;  2Z4E A;  3FIB A;  1Z3S A;  3E1I C;  1FZB C;  3HUS B;  2FFD A;  1FZE B;  3BVH A;  1FZF A;  2JHL F;  1LT9 B;  2HLO C;  2OYI B;  2A45 I;  2FFD C;  1RF1 B;  2J1G A;  2HOD A;  2OYH A;  1Z3U A;  1LWU B;  2XNX B;  2OYH C;  4R9J A;  2J61 B;  1RE4 B;  2H43 A;  1FZD A;  2HPC A;  2J60 A;  2H43 C;  1JY2 O;  2J3O A;  1FIB A;  1N86 A;  1LTJ B;  2HPC C;  1FZA A;  1M1J C;  2HLO A;  3GHG A;  1RF0 B;  1N86 C;  2Z4E B;  1JY2 N;  1FZA C;  2J0G A;  4R9T A;  2J0Y A;  1T3U A;  3GHG C;  3H32 A;  1FZC A;  2Q9I A;  1FZF B;  4JYO X;  1JY3 O;  1LWU C;  2XNX C;  3H32 C;  1FZC C;  2Q9I C;  1N73 B;  2HOD B;  1JY3 N; 
#chains in the Genus database with same CATH topology
 2YO2 A;  3Q3D A;  2W8Z A;  1SQB G;  1M1J A;  1AVO A;  1NU1 D;  2SPZ A;  1U7M A;  3MTU E;  4WB4 A;  3NXS A;  5GTI H;  1JY2 P;  1EDI A;  2XNX A;  3KZI H;  1Q81 Q;  1DX7 A;  1KYO H;  1BDC A;  1Q90 D;  3TK1 A;  2OYH B;  2E74 C;  2KLU A;  1W2E A;  2Z5H A;  3L74 G;  4NPD A;  4JYC A;  5H2F E;  1HF9 A;  2H43 B;  5BU8 B;  3H1H D;  1W2B O;  2KOG A;  3RBZ A;  3H6P A;  2FIB A;  4YXD C;  3LID A;  1VQO P;  3L71 G;  3B71 A;  5KJ7 C;  2JWA A;  3H1I G;  4GOE A;  2GM4 A;  2XKM A;  1GK6 A;  2ZYG A;  2K9Y A;  4R4L A;  4DCK A;  3FWN A;  3CWB D;  1FZB A;  1VQ6 P;  1IK9 A;  2C9N Y;  3GF7 A;  5DJU B;  2WPR A;  2QJK B;  2HLO C;  2A45 I;  3NTN A;  1Z3U A;  3CCR P;  1LT1 A;  3H1K D;  2Q3I A;  1M1K Q;  4U7J A;  3HD7 B;  4JBZ A;  3O8Z A;  4OGQ C;  5CJ0 A;  5AVV B;  3S9O A;  4D6T J;  4DOJ A;  2N1T A;  3VN0 A;  5BU5 A;  2A06 E;  1T2K C;  1FZA A;  2HLO A;  2XDJ A;  1OW7 A;  1VQL P;  1N86 C;  2Z4E B;  5KLV K;  1VL2 A;  1FDO A;  4YPC A;  2O3J A;  2QEX P;  1USD A;  4UB6 H;  4IL6 E;  1YBK A;  3R2P A;  2MJZ A;  1FZE A;  5AVU B;  4NPF X;  4U3F G;  3JCU E;  2OYI A;  2JHI F;  1SFC D;  3D70 A;  1RQV A;  4OH8 B;  1L4A D;  5GTH E;  3L70 J;  3D71 A;  1VF5 C;  2FYU J;  3CI9 A;  2K37 A;  2A45 H;  3AE6 C;  2WSS H;  2ZT9 D;  3S1K A;  1NU1 G;  2D39 A;  3JC2 2;  2WIT A;  3L35 A;  4JQ0 D;  2QE7 H;  3RK2 B;  2B88 A;  3CD6 P;  1SQV J;  1KIL B;  3RBX A;  1CZQ A;  1Q82 Q;  1KQF B;  4GT1 A;  2JHL F;  4UB8 E;  1RF1 B;  3H1H G;  1IO4 A;  4IOI H;  4WVZ A;  3G4S P;  3EWK A;  1L2P A;  3A7O A;  3RK3 D;  1NYH A;  3CXH D;  1HWT C;  2O01 N;  3KYQ A;  3CCQ P;  3GHG C;  1JY3 O;  3AEC C;  2YKP A;  1N73 B;  1SVF A;  4RJT A;  2YNY A;  3AE4 C;  2J3U A;  1NTZ K;  1FZG B;  2QJY B;  3H1K G;  1WMK A;  2QJP B;  3MUD A;  4D6T D;  2JHH C;  2IBZ I;  1S1C X;  1LP1 A;  1LJ2 A;  2YKO A;  1HBW A;  2FFD B;  3E7K A;  1KYO E;  2FYN B;  1YJ9 P;  1BGY D;  3FXD A;  1JC9 A;  1KD1 Q;  4PV1 B;  1E79 H;  3HE4 B;  3ZDM A;  1NTZ D;  3OAK A;  3I55 P;  1ZOY C;  5APU A;  2RH0 A;  2PAJ A;  1AFO A;  3G9R A;  1Q2N A;  3G3Z A;  4AUW A;  4HYT B;  3WUV A;  1L4A C;  3A0B E;  1RE3 A;  1H0T A;  5L8R J;  2E5Y A;  1X79 B;  3FIB A;  2LXB A;  1Z3S A;  1EDJ A;  2HR3 A;  1SFC A;  1LT9 B;  1SQB E;  1X9V A;  4H13 D;  3CX5 E;  3PH0 A;  5CCG D;  3TYY A;  2ZT9 C;  5AW0 B;  1A02 J;  4EDF A;  4O9B A;  1ZR4 A;  3MHV A;  1H88 A;  3A0H H;  1LTJ B;  2H88 C;  2HPC C;  2WSF H;  2BCC J;  2Y0D A;  2AEF A;  2ZXE B;  1NKN A;  2R5D A;  3L74 E;  3H32 A;  2AXT H;  2Q9I A;  3JSV C;  1MZ9 A;  5KKZ B;  1QX8 A;  1QGK B;  1QVF O;  4H0L C;  2R5B A;  3W68 A;  3L71 E;  4ASV A;  3H1I J;  1EDK A;  1IFD A;  1TU3 F;  1W5C E;  3H1I E;  2RMZ A;  1NAF A;  4ZFG A;  3PP5 A;  5B5E E;  3C8V A;  1H89 A;  3OA7 A;  2WMM A;  3AE2 C;  1SQP J;  5E79 H;  1PP9 J;  2KSJ A;  2KP8 A;  4M7F A;  1NVO A;  3L72 J;  1N7S D;  2B89 A;  1S9K E;  1VQ8 P;  2HG5 D;  3VOP A;  1GU4 A;  3E1R A;  1GL2 C;  1ZLL A;  4BRY B;  2HOD C;  4D6T G;  2CPS A;  1NAY A;  2W83 C;  1BGY G;  5H2F H;  1GD2 E;  2KB7 P;  3HTK B;  2E42 A;  1KQG B;  4U3F E;  2HOD A;  1HJ0 A;  1KOR A;  1LGH B;  2FXO A;  2W27 A;  2N9Y B;  2YKQ A;  1L0L K;  1HGZ A;  4KJM A;  2J3O A;  2ZFC A;  1H8A A;  3M9H A;  3CCV P;  1KMI Z;  3L70 G;  3BCC E;  1URQ A;  2ZAE B;  3WMM 0;  1FDI A;  1BSH A;  5CCG C;  3BAS A;  2HFE D;  1EQ7 A;  1KB9 D;  5TJH A;  1LTG C;  1NU1 E;  1OVV A;  1XTC C;  1L0L D;  4KHX A;  4M3L A;  3D6Z A;  1QEX A;  2KNC A;  3PRJ A;  2J5Z A;  1EZV G;  2IFM A;  3ABV C;  1ZV8 A;  1FE6 A;  1JNM A;  2BCC D;  1XTG B;  1SQX J;  1RE4 A;  4I7Z C;  1OWA A;  5APS A;  1NTK J;  2KSE A;  3H1H J;  2MKV A;  1JY3 P;  4IL6 H;  1L0N K;  3TSI A;  1T8Z A;  3HE5 B;  2Q7C A;  2ZXX A;  4M7H A;  3JCU H;  4EPU A;  1J1D B;  3T97 B;  1R5S A;  3RK2 D;  1SQQ K;  4RES B;  2WSE J;  3CWB J;  1KIL D;  3Q5R A;  2N1T D;  2B9B A;  2Q3E A;  2WPV B;  2K9J A;  2KYV A;  3Q5S A;  1HUC A;  2P7J A;  1N7S C;  3H1K E;  2OYH A;  3L72 D;  4GDO A;  1SQQ D;  3U1A A;  3O6Q B;  2H43 A;  1FZD A;  2E76 D;  3QWO C;  3GW6 A;  1FOS E;  2WWW A;  3H1J E;  3U59 A;  2ITA A;  5AVT B;  2KS1 B;  1RF0 B;  1PGO A;  1KC8 Q;  3WUU A;  4UB8 H;  2P1J A;  2E75 B;  1NTM K;  2P10 A;  2QG4 A;  1LTI C;  3H1L D;  2I1J A;  4Y99 B;  3MD0 A;  2J5U A;  2R32 A;  2E43 A;  3HUS C;  2P58 A;  5KLV J;  4EOT A;  1PL5 A;  5AW2 B;  3LW5 H;  5AVX B;  2DW3 A;  2W90 A;  2Y9Y A;  4PV1 D;  5TIS E;  3UIA A;  2WSC J;  1S2E A;  1SQX K;  3CX5 I;  1PGP A;  5KLI B;  1NTK K;  1FID A;  3HUS A;  2G3A A;  1OFC X;  4ZNC A;  1T6A A;  1P84 D;  2WNP F;  2J64 A;  3KDP B;  3AE8 C;  2I1K A;  3SWK A;  1ZRT D;  1G1J A;  5KAI E;  2M3B A;  1YTZ T;  1SQX D;  2BCC G;  1BSN A;  4WWI A;  1MUU A;  1Y47 A;  2CPB A;  1NTK D;  5APV A;  2NPS B;  1FZB C;  1NKZ B;  3BRV B;  1USE A;  2QSI A;  4JPZ B;  2V4H A;  1LWU B;  1AJY A;  1EXJ A;  4R9J A;  2J61 B;  3A0B H;  2N1T C;  2FYZ A;  3CXH E;  5APQ A;  2OTJ P;  1JUN A;  1GU5 A;  2XZR A;  1FZA C;  3V5B A;  5AW1 B;  2UWJ E;  1LTT C;  3CX5 H;  3ITK A;  2QM7 A;  4JYB A;  1SQP G;  1PP9 G;  1KIL A;  1IFI A;  1IZN B;  4OVN F;  3L72 G;  1SQQ G;  1G1I A;  4D6T E;  1S5L X;  2E76 C;  3E1I B;  1RF1 A;  1FZE C;  4H44 C;  1BGY J;  1J2J B;  2OYI C;  5AVS B;  3AEE C;  1LNQ A;  5EFW B;  2R44 A;  2M3E A;  1NTZ J;  3N7N A;  5CBO A;  1BE3 D;  2QM8 A;  5APT A;  3FXE A;  1J1E C;  3H1L G;  1M1J B;  2J2P A;  1N73 A;  1FZF C;  5B5E H;  2WZ7 A;  1Q86 Q;  2IX7 C;  5KLV D;  2Z5I A;  1CSB A;  1VQ4 P;  1FZC B;  1FZG A;  2G8Y A;  3CC7 P;  3L70 E;  2PP6 A;  2GUV A;  3FX0 A;  4ASW A;  2FYU E;  2J3F D;  2BEZ F;  3B8E B;  2FFD A;  1FZF A;  1HVV A;  1YQ4 C;  3RL0 D;  3SWY A;  1KFN A;  1EZV E;  2JO1 A;  2Y0C A;  3HE4 A;  5CBN A;  5CHX A;  4I2L C;  2E74 B;  4R4M A;  4ZKU A;  2NRG A;  2XV5 A;  3WU2 E;  1SQV E;  2H7H A;  1JOC A;  3MZW B;  1SQX G;  4R9T A;  2OTL P;  1NTK G;  1VDF A;  4WBA A;  1QLE D;  2CK3 H;  2WVR A;  3TGU D;  1FIC A;  1LTJ C;  1LT9 A;  1CW5 A;  1FDM A;  2AEM A;  1FBM A;  3MUD C;  3PHL A;  2HLO B;  3CWB G;  4N78 D;  3K5B A;  1PV3 A;  3W67 A;  1OW8 A;  1OMI A;  4L73 A;  2D2C B;  3CCL P;  1LTJ A;  4OGQ B;  2FXM A;  1FU1 A;  2WTY A;  1K04 A;  1X0T A;  2YMK A;  3CCJ P;  1EDL A;  2P2U A;  1N86 B;  4AYC A;  1JMM A;  1RHZ B;  1YIT P;  1KQS O;  3SSU A;  1PFI A;  2RKL A;  2H8P D;  3PJS K;  1RE3 C;  5AW9 B;  3M9Q A;  4NPE A;  2KXP B;  4WY4 B;  3IR9 A;  3BAT A;  1JCD A;  1E5W A;  2JEE A;  1URQ D;  2YIU C;  3B5N B;  1SFC C;  1PPJ D;  2OTK E;  1VF5 B;  3AEG C;  2R3C A;  3RGU A;  5KLV G;  1QL2 A;  2E75 D;  4K3A A;  2POH A;  3SFE C;  4BRY A;  3LIE A;  1BCC D;  1KB9 E;  2V7Q H;  2L5G B;  3H32 C;  2Q9I C;  1L0L J;  3RL0 C;  3V4Q A;  1JM0 A;  2P67 A;  1K73 Q;  2M5A A;  2W6J H;  3HTK A;  4XFJ A;  2J3F A;  2JHM F;  3VMZ A;  4HB1 A;  1IC2 A;  3AEF C;  5KTB A;  2BCC E;  1FJP A;  1N2D C;  4PD4 D;  1K05 A;  1PGQ A;  4K35 A;  1M7L A;  4JZC A;  1JB0 J;  3P8C E;  2JR8 A;  3TGU G;  1FJK A;  3GHG B;  1IFJ A;  3RK3 C;  3CXH I;  3M91 A;  1LTB C;  5TIS H;  1L0N J;  2YXR B;  5CJ4 A;  3V2P A;  4EI2 A;  1SQP E;  1PP9 E;  3WUT A;  2AXC A;  1S72 P;  1UII A;  1SQQ J;  2BEQ D;  1JTH A;  3CC2 P;  3L72 E;  1SQQ E;  4C7N B;  1NJI Q;  5CCH A;  1KFM A;  3HE5 A;  3CCM P;  5KAI H;  3T97 A;  5AW5 B;  3H25 A;  3A2A A;  2ZVO B;  1JY2 N;  3H1L J;  2Q6Q A;  1VQ9 P;  1NTZ G;  3M0D C;  4W7Z A;  5B66 E;  3HD7 D;  3G6E P;  1URQ C;  1KYO D;  1L4A B;  1JCC A;  1K8A Q;  1DH3 A;  1PPJ G;  1RQU A;  3VP9 A;  5AVQ B;  3CXH H;  3U1C A;  1CI6 B;  2WPS A;  1NTM J;  3AED C;  1SQB K;  3M0D A;  3BRT B;  3GG2 A;  3O6Q A;  4H13 C;  3L73 D;  4GOF A;  1RE4 C;  1MKM A;  2XU6 A;  1BCC G;  3IF4 A;  1OX3 A;  2JWD A;  4LGD E;  1IJD B;  1EZV I;  1RF0 A;  2QA4 P;  1P84 E;  2FBW C;  2HPC B;  1N7L A;  1UIX A;  4EYY Q;  1KQL A;  1YTZ I;  1SQB D;  1ZRT E;  1GZL A;  1KTM A;  3M9B A;  4H0L B;  1SQX E;  1HH0 A;  4N3Y B;  2ZJS E;  4GIF A;  3V2N A;  1NTK E;  4AQR D;  5CMZ A;  3H1H E;  1AQ5 A;  5KAF E;  1HGV A;  1MFZ A;  2Y9Z A;  1X8Y A;  2B87 B;  3SFD C;  3L74 D;  2J1G A;  2KUB A;  2OYH C;  2QIW A;  3EFG A;  3CWB E;  3V4W A;  1PZQ A;  3L71 D;  2H43 C;  4HKZ H;  3VYI A;  1L0N D;  4I6M C;  4A7P A;  1OIP A;  2J0G A;  4IFD K;  1GL2 B;  1LWU C;  1QL1 A;  2HOD B;  5AW4 B;  3WU2 H;  2QJK C;  1KN7 A;  4Z1M H;  1LWU A;  4IFF A;  2D2C D;  2FXP A;  3BVH B;  2J61 A;  3OW2 O;  3KXD A;  1BE3 J;  3HD7 C;  1FAV A;  3I5C A;  3NMD A;  4YTP C;  4NYT A;  1A02 F;  2WT7 B;  1NWQ A;  1GW3 A;  4I1L A;  1S3J A;  4XA4 A;  4RKU J;  2Z4E C;  3F5H A;  5KLV E;  3V6I A;  4BXL A;  1GDT A;  2KIK A;  3HD7 A;  1NTM D;  1JO5 A;  1IFP A;  5BVZ A;  4WY4 D;  3E1I A;  1KB9 I;  3TDK A;  3FGA D;  3L73 G;  2Z4E A;  3B5N D;  1OW6 A;  2WQY C;  2BAS A;  1VF5 D;  1L0L G;  3BCC D;  2XND H;  4I7Z B;  3TNU B;  2IDB A;  1VQP P;  3KHU A;  1WT6 A;  2K9J B;  2J59 M;  2O01 J;  1FZC A;  2ZVN B;  2K1A A;  3TGU J;  2IPP A;  3GMA A;  3AEB C;  1NGM B;  3L75 D;  3TGU E;  2YXQ B;  3RK2 C;  4KT0 J;  3L37 A;  1GMJ A;  3F89 A;  1KIL C;  3RK3 E;  1PGJ A;  3OJA B;  1FC2 C;  2O1J A;  5APX A;  4YXW H;  1YQ3 C;  4IL6 X;  4N78 E;  1U57 A;  2K88 A;  3L4F A;  1QVG O;  2YO3 A;  2FKW B;  1RF1 C;  1M8O B;  4RO0 A;  1N7S B;  1L0N G;  1G2C B;  1KB9 H;  2H89 C;  2KI7 B;  2OGU A;  2JHK F;  2Y0E A;  5KJ7 A;  1BGY E;  3CLQ A;  2A45 G;  1N73 C;  2D2C C;  2PRR A;  1FZG C;  1NTZ E;  2IBZ D;  2QJY C;  2IYO A;  2QJP C;  3HUS B;  1ZME C;  3H1J D;  1SP4 A;  2JDI H;  2FFD C;  2I8D A;  1PPJ E;  5C39 A;  1OXZ A;  2FYN C;  3Q1M A;  2E5T A;  2XNX B;  2J58 A;  4PV1 C;  4L76 A;  1N86 A;  1BCC J;  4WY4 C;  1YYC A;  1NTM G;  1BCC E;  1VQN P;  4BWN A;  3B5N C;  5AVW B;  3R4Y A;  1P84 I;  2OYO A;  4C7R A;  1S5L E;  3C9I A;  5AVZ B;  3AE5 C;  4GOD A;  3BCC G;  4WY4 A;  1LTA C;  2QVA A;  1FZB B;  3B5N A;  1LT9 C;  4PD4 E;  4HH2 A;  3AE1 C;  3CMA P;  4XE5 B;  1AQT A;  1PIX A;  3C1L A;  4IFM A;  5B66 H;  4DJG A;  2K3R A;  2C0W A;  3IN6 A;  2J0H A;  1IFN A;  1M90 Q;  3L75 G;  4B86 A;  2KZI A;  2N1T B;  4DZO A;  1FOS F;  1R8E A;  3P32 A;  1FZA B;  2M8R A;  4H0L D;  1DIP A;  4DT0 A;  5KKZ C;  3SWF A;  4W80 A;  1YIJ P;  1EXI A;  5CCH D;  3MGN A;  1YHQ P;  2J3G A;  3LW5 J;  1P84 H;  2E76 B;  4PJ0 E;  2YMY A;  1YI2 P;  1FZE B;  4H44 B;  2OYI B;  4CPG A;  3Q5P A;  3QH9 A;  2KK7 A;  2NZ2 A;  4N6J A;  2O1K A;  2J60 A;  1FIB A;  2LXC B;  5KAF H;  1J1E B;  2A06 D;  3IFM A;  1GL2 D;  5GTI E;  3GHG A;  3NFQ A;  3KZI E;  3CC4 P;  1T3U A;  1BE3 G;  2IBZ G;  2Q5U A;  4LC1 A;  1FZF B;  3H1J G;  4QMA A;  1NHL A;  1ZXG A;  1JY3 N;  2FY8 A;  3CL3 D;  2WSE H;  2FYU K;  1Q7Y Q;  1IFM A;  2OAR A;  3L36 A;  2GUS A;  4C7N A;  4L74 A;  3L73 J;  3L73 E;  1M56 D;  3USS A;  3GF3 A;  1GTW A;  3VMX A;  1VQK P;  1L0L E;  3MIW A;  4MN4 C;  3L70 D;  2FYU D;  1SQV K;  1X22 A;  1OVR A;  1SQB J;  1HTL C;  1L4A A;  1SLQ A;  4TT3 H;  3MP7 B;  4GKG A;  1EZV D;  3AE7 C;  1VQM P;  3TF5 A;  4Y28 J;  2GY7 A;  1CI6 A;  3L74 J;  1FS0 E;  1SQV D;  2IFN A;  3P7K A;  1AA0 A;  4C46 A;  1LP1 B;  1KIL E;  1OVU A;  3L71 J;  4UB6 E;  1KZU B;  3VMY A;  2NPS D;  2HPC A;  5CCH C;  1NO4 A;  1L0N E;  2WSC H;  1JY2 O;  1DD3 A;  2LKM A;  3FWL A;  3HRN A;  2Q1K A;  3GLM A;  5AW6 B;  2IYP A;  1J1D C;  3KPE A;  1RH5 B;  3RL0 g;  1GK4 A;  3CCS P;  3B4S A;  3PLN A;  4LLH A;  4HJG H;  2JP3 A;  2B87 A;  1RE3 B;  1H0T B;  1D7M A;  1HJB A;  2C9L Y;  1ZP0 C;  5AVR B;  1DEE G;  2VRS A;  2YIU B;  2JKV A;  1AV1 A;  1SFC B;  3H1L E;  2A06 G;  2O01 H;  2HYN A;  2LR2 A;  4L75 A;  3IAO A;  1K9M Q;  2M5A B;  1M57 D;  1Y9B A;  1RF0 C;  3Q2Y A;  1GL2 A;  3PTZ A;  1DEB A;  4U3F J;  3BVH C;  2M0B A;  2E75 C;  1NTM E;  3D6Y A;  3M06 A;  3VP8 A;  2ZT9 B;  3H32 B;  2Q9I B;  3RL0 B;  4EIJ A;  4Y99 C;  1Y8A A;  2IZ0 A;  1MV8 A;  3CCE P;  3A5T A;  1MFT A;  2KS1 A;  1LTS C;  3BCC J;  2R3S A;  3BVH A;  4ZKP A;  3M0A A;  3N4X A;  1IK7 A;  2FYU G;  3CX5 D;  4OWF A;  1WRG A;  1DD4 A;  1NU1 J;  2WT7 A;  1JMB A;  4PD4 I;  2JJL A;  5KLI C;  1R5L A;  2RN0 A;  3V2R A;  3CPW O;  5APY A;  5DJT B;  3EFF K;  1YJN P;  1KV4 A;  2KLV A;  3L75 J;  2J0Y A;  5CCG A;  3L75 E;  1JTH B;  3RK3 B;  2E74 D;  3A3Y B;  3CCU P;  1SQV G;  1U7J A;  2PFX A;  3AE9 C;  3G71 P;  3CME P;  1SQP K;  2NPS C;  1YJW P;  3P8C D;  3S4R A;  2PGD A;  1JEK A;  3H1I D;  2OQQ A;  5K5G B;  5KJ7 D;  1ZW0 A;  5GTH H;  4JF7 A;  1SS1 A;  3AEA C;  2W6A A;  1S5L H;  3V2Q A;  3TNU A;  3KQG A;  2NPS A;  1VQ5 P;  1SQP D;  2ZYD A;  1PP9 D;  2V7Q J;  1BDD A;  3H1K J;  5M1B A;  1ZN5 A;  4PD4 H;  5AW7 B;  1NOH A;  1VQ7 P;  1S9K D;  1NH4 A;  3AE3 C;  1ZR2 A;  4W7Y A;  4OGQ D;  1URQ B;  1BE3 E;  2IBZ E;  2QRX A;  1T2K D;  2WSF J;  1KYO I;  3A0H E;  3H1J J;  4H44 D;  1OZH A;  3VMA A;  3II6 A;  2WPQ A;  3E1I C;  3EQ2 A;  2GA1 A;  2N9B A;  2KNC B;  1S4X A;  2AXT E;  1N7S A;  1G2C A;  1GW4 A;  2W6B A;  2KZJ A;  4H13 B;  4U3F D;  4ZMD A;  5AVY B;  1RE4 B;  1AVY A;  1NU1 K;  2L91 A;  2ZYA A;  5AW3 B;  5AW8 B;  4TLF A;  1M1J C;  1T3J A;  1VPC A;  5APW A;  4PJ0 H;  2IZ1 A;  2C0X A;  1N8R Q;  3VTP C;  1RY3 A;  4JYO X;  1EC5 A;  2XNX C;  2AEJ A;  1FZC C;  3P8M C;  1Z56 A;  5E79 E;  3I56 P; 
#chains in the Genus database with same CATH homology
 2YO2 A;  3C9I A;  5AVZ B;  1LTG C;  1XTC C;  4KHX A;  4M3L A;  3HTK A;  1LTA C;  4WY4 A;  1M1J A;  2J3F A;  2JHM F;  3VMZ A;  2J5Z A;  2IFM A;  1IC2 A;  1FZB B;  3MTU E;  3B5N A;  1LT9 C;  4WB4 A;  5KTB A;  3NXS A;  1ZV8 A;  4HH2 A;  1JY2 P;  1FJP A;  1JNM A;  1N2D C;  2XNX A;  4XE5 B;  1XTG B;  1RE4 A;  1DX7 A;  4IFM A;  1OWA A;  1M7L A;  3TK1 A;  5APS A;  2OYH B;  1W2E A;  2Z5H A;  1JY3 P;  4JZC A;  2C0W A;  2J0H A;  4JYC A;  1L0N K;  1IFN A;  3P8C E;  3TSI A;  1T8Z A;  2H43 B;  3HE5 B;  5BU8 B;  4B86 A;  2Q7C A;  2KOG A;  2N1T B;  4M7H A;  4DZO A;  3H6P A;  1FOS F;  2FIB A;  4EPU A;  1J1D B;  3LID A;  3P32 A;  1FJK A;  1FZA B;  2M8R A;  3RK2 D;  3GHG B;  1IFJ A;  1SQQ K;  3RK3 C;  5KJ7 C;  4RES B;  3SWF A;  4W80 A;  3M91 A;  1LTB C;  1KIL D;  5CCH D;  2GM4 A;  2XKM A;  3MGN A;  1GK6 A;  5CJ4 A;  2N1T D;  3V2P A;  1FZB A;  2J3G A;  1IK9 A;  2C9N Y;  2YMY A;  2WPR A;  1FZE B;  2KYV A;  2HLO C;  1JTH A;  2OYI B;  2A45 I;  3NTN A;  1HUC A;  2P7J A;  1N7S C;  4C7N B;  2OYH A;  1Z3U A;  3U1A A;  2Q3I A;  5CCH A;  1KFM A;  2H43 A;  3HD7 B;  3HE5 A;  3O8Z A;  4N6J A;  5CJ0 A;  5AVV B;  1FZD A;  4DOJ A;  2O1K A;  2N1T A;  3VN0 A;  5BU5 A;  2J60 A;  1T2K C;  1FOS E;  2WWW A;  1FIB A;  3T97 A;  5AW5 B;  3U59 A;  1FZA A;  3IFM A;  1J1E B;  3A2A A;  1GL2 D;  2HLO A;  2XDJ A;  5AVT B;  3GHG A;  1RF0 B;  3NFQ A;  1N86 C;  2Z4E B;  1JY2 N;  5KLV K;  1T3U A;  2Q5U A;  4LC1 A;  2P1J A;  1FZF B;  1NTM K;  3M0D C;  4W7Z A;  3HD7 D;  1URQ C;  1LTI C;  1L4A B;  1JCC A;  2I1J A;  1NHL A;  4Y99 B;  3MD0 A;  1JY3 N;  3R2P A;  3CL3 D;  2WSE H;  2FYU K;  1IFM A;  2MJZ A;  2OAR A;  1FZE A;  1DH3 A;  3L36 A;  5AVU B;  2R32 A;  2E43 A;  3VP9 A;  2OYI A;  2GUS A;  3HUS C;  2JHI F;  5AVQ B;  1SFC D;  4C7N A;  4EOT A;  3U1C A;  1CI6 B;  5AW2 B;  2WPS A;  1SQB K;  3LW5 H;  3M0D A;  4OH8 B;  3BRT B;  1L4A D;  5AVX B;  3UIA A;  1GTW A;  3VMX A;  1RE4 C;  1SQX K;  2XU6 A;  3MIW A;  4LGD E;  1IJD B;  3CI9 A;  1NTK K;  1FID A;  1RF0 A;  3HUS A;  2A45 H;  1SQV K;  2HPC B;  1HTL C;  1N7L A;  2WNP F;  1KQL A;  2J64 A;  1YTZ I;  3KDP B;  1L4A A;  1SLQ A;  2I1K A;  2D39 A;  3L35 A;  2WIT A;  4GKG A;  1GZL A;  3M9B A;  3RK2 B;  1G1J A;  1HH0 A;  1YTZ T;  2M3B A;  4N3Y B;  4GIF A;  3V2N A;  4AQR D;  5CMZ A;  1AQ5 A;  1KIL B;  1CZQ A;  1HGV A;  1MUU A;  2GY7 A;  1CI6 A;  1MFZ A;  2CPB A;  5APV A;  2NPS B;  1X8Y A;  1FZB C;  4GT1 A;  2IFN A;  1NKZ B;  3P7K A;  2JHL F;  3BRV B;  1RF1 B;  4C46 A;  2J1G A;  1IO4 A;  1LWU B;  2OYH C;  1KZU B;  4R9J A;  3VMY A;  3EFG A;  2J61 B;  3V4W A;  2NPS D;  2HPC A;  5CCH C;  1NO4 A;  2WSC H;  2H43 C;  1JY2 O;  2LKM A;  3HRN A;  2N1T C;  2FYZ A;  5AW6 B;  3VYI A;  3A7O A;  1J1D C;  3KPE A;  5APQ A;  3RK3 D;  1JUN A;  4I6M C;  1GU5 A;  1GK4 A;  2XZR A;  1FZA C;  1HWT C;  3V5B A;  3KYQ A;  5AW1 B;  4IFD K;  2J0G A;  1LTT C;  3GHG C;  1GL2 B;  1JY3 O;  1LWU C;  2YKP A;  1QL1 A;  2QM7 A;  4JYB A;  1N73 B;  4LLH A;  2HOD B;  1SVF A;  1KIL A;  2YNY A;  2J3U A;  1NTZ K;  1IFI A;  1FZG B;  1RE3 B;  5AW4 B;  1G1I A;  3MUD A;  1HJB A;  3E1I B;  2C9L Y;  1RF1 A;  1FZE C;  2JHH C;  1J2J B;  2OYI C;  5AVR B;  5AVS B;  1LWU A;  2YKO A;  1HBW A;  4IFF A;  2FFD B;  2VRS A;  3BVH B;  2J61 A;  1SFC B;  2O01 H;  2HYN A;  1JC9 A;  3HD7 C;  1FAV A;  3I5C A;  3NMD A;  3N7N A;  4NYT A;  1A02 F;  2QM8 A;  3HE4 B;  2WT7 B;  1NWQ A;  5APT A;  1GW3 A;  3OAK A;  4I1L A;  1J1E C;  4XA4 A;  1RF0 C;  1M1J B;  2Z4E C;  1GL2 A;  5APU A;  1DEB A;  2PAJ A;  1AFO A;  2J2P A;  1N73 A;  3BVH C;  1FZF C;  1GDT A;  3G3Z A;  2WZ7 A;  4AUW A;  2IX7 C;  3M06 A;  3VP8 A;  2Z5I A;  4HYT B;  1CSB A;  1L4A C;  3HD7 A;  3H32 B;  1FZC B;  1FZG A;  2Q9I B;  1JO5 A;  1RE3 A;  3RL0 B;  4EIJ A;  4Y99 C;  2PP6 A;  2GUV A;  5BVZ A;  4WY4 D;  1MV8 A;  3E1I A;  2J3F D;  3A5T A;  1X79 B;  1LTS C;  2Z4E A;  3FIB A;  3B8E B;  1Z3S A;  3B5N D;  2FFD A;  2BAS A;  3BVH A;  1FZF A;  1SFC A;  1LT9 B;  4ZKP A;  1X9V A;  3M0A A;  1HVV A;  3N4X A;  5CCG D;  3RL0 D;  3SWY A;  3TYY A;  1KFN A;  5AW0 B;  1A02 J;  1WRG A;  4O9B A;  3HE4 A;  2WT7 A;  1ZR4 A;  2JJL A;  5CHX A;  4I2L C;  1H88 A;  4ZKU A;  3V2R A;  2XV5 A;  3TNU B;  5APY A;  2H7H A;  1LTJ B;  2HPC C;  2WSF H;  2ZXE B;  1JOC A;  1NKN A;  2R5D A;  1WT6 A;  2J59 M;  2KLV A;  4R9T A;  2J0Y A;  3H32 A;  1FZC A;  2Q9I A;  5CCG A;  1MZ9 A;  1JTH B;  1VDF A;  3RK3 B;  2IPP A;  3A3Y B;  4WBA A;  2R5B A;  3RK2 C;  3L37 A;  1FIC A;  1KIL C;  1LTJ C;  1IFD A;  1SQP K;  2NPS C;  1LT9 A;  3OJA B;  1NAF A;  3P8C D;  1CW5 A;  2O1J A;  5APX A;  1FDM A;  4ZFG A;  4N78 E;  3PP5 A;  1FBM A;  3L4F A;  5KJ7 D;  2YO3 A;  2HLO B;  2FKW B;  1RF1 C;  4N78 D;  1H89 A;  3OA7 A;  1N7S B;  1G2C B;  4JF7 A;  2W6A A;  3V2Q A;  3TNU A;  1LTJ A;  3KQG A;  2FXM A;  2NPS A;  1FU1 A;  2KSJ A;  2KP8 A;  2WTY A;  2JHK F;  4M7F A;  2P2U A;  1N7S D;  1S9K E;  1N86 B;  2HG5 D;  5KJ7 A;  4AYC A;  3VOP A;  1GU4 A;  1ZN5 A;  1JMM A;  5AW7 B;  1GL2 C;  1NOH A;  1ZLL A;  1S9K D;  1NH4 A;  3CLQ A;  1ZR2 A;  2A45 G;  1N73 C;  4W7Y A;  2HOD C;  1URQ B;  1PFI A;  2CPS A;  2H8P D;  1T2K D;  1FZG C;  1RE3 C;  5AW9 B;  3M9Q A;  3II6 A;  2WPQ A;  1GD2 E;  3E1I C;  2KB7 P;  3EQ2 A;  2N9B A;  3HUS B;  3HTK B;  4WY4 B;  3IR9 A;  3BAT A;  2E42 A;  1N7S A;  1SP4 A;  1JCD A;  1E5W A;  2JEE A;  2FFD C;  1URQ D;  1G2C A;  1GW4 A;  3B5N B;  1OXZ A;  1SFC C;  2HOD A;  1LGH B;  2W6B A;  2XNX B;  5AVY B;  2W27 A;  2J58 A;  2YKQ A;  1RE4 B;  1L0L K;  1HGZ A;  2R3C A;  1NU1 K;  5AW3 B;  5AW8 B;  2J3O A;  2ZFC A;  1H8A A;  1QL2 A;  1N86 A;  3M9H A;  4WY4 C;  1YYC A;  1M1J C;  1T3J A;  1VPC A;  5APW A;  2POH A;  2C0X A;  3LIE A;  3B5N C;  5AVW B;  3VTP C;  1URQ A;  1RY3 A;  4JYO X;  3WMM 0;  2XNX C;  2L5G B;  3H32 C;  1FZC C;  2Q9I C;  4C7R A;  5CCG C;  3BAS A;  2HFE D;  1EQ7 A;  3P8M C;  3RL0 C;  3V4Q A;  1Z56 A;  2P67 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...