3H32B

Crystal structure of d-dimer from human fibrin complexed with gly-his-arg-pro-tyr-amide
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
308
structure length
308
Chain Sequence
LYIDETVNSNIPTNLRVLRSILENLRSKIQKLESDVSAQMEYCRTPCTVSCNIPVVSGKECEEIIRKGGETSEMYLIQPDSSVKPYRVYCDMNTENGGWTVIQNRQDGSVDFGRKWDPYKQGFGNVATNTDGKNYCGLPGEYWLGNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGGFTVQNEANKYQISVNKYRGTAGNALMDGASQLMGENRTMTIHNGMFFSTYDRDNDGWLTSDPRKQCSKEDGGGWWYNRCHAANPNGRYYWGGQYTWDMAKHGTDDGVVWMNWKGSWYSMRKMSMKIRPFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Two families of synthetic peptides that enhance fibrin turbidity and delay fibrinolysis by different mechanisms.
pubmed doi rcsb
molecule tags Blood clotting
molecule keywords Fibrinogen alpha chain
total genus 74
structure length 308
sequence length 308
chains with identical sequence E
ec nomenclature
pdb deposition date 2009-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
B PF08702 Fib_alpha Fibrinogen alpha/beta chain family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3h32B01
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 3h32B02
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 3h32B03
4M7HA 1JC9A 1RF1A 2OYHC 2JHMF 2XNXC 2J2PA 2JHHC 2FIBA 3HUSB 1JY3O 3E1IB 1RF0C 3E1IA 2A45H 1LWUC 1M1JC 2A45G 2FFDB 4ZFGA 3BVHB 2HPCA 1LTJA 2HPCB 2J0HA 1N86A 1FZEB 1RE4A 1LT9A 1RF0A 1FZAA 1RE3A 1FIBA 2Q9IC 3HUSC 2JHLF 2J3FA 2J64A 3HUSA 1RF1C 1RE3C 1RE3B 2J0GA 4JYOX 4NYTA 2Q9IB 4R9TA 2OYIB 1N86C 3H32A 2Z4EC 3H32B 2OYIA 2JHKF 2HPCC 2H43B 4EPUA 1FZBA 2GY7A 2J61B 2H43A 1RE4B 2WNPF 2OYIC 1N86B 2J3GA 2D39A 3FIBA 1LTJB 1FZCA 1Z3UA 2J0YA 1LWUB 2HODB 1RF0B 1RF1B 1Z3SA 2XNXA 2OYHA 1FZGC 1JY3P 1N73C 1FZDA 1N73A 2A45I 2JHIF 1FZAC 2HLOA 2HLOB 1LT9C 1FIDA 1RE4C 2J5ZA 2H43C 2FFDC 1FZBC 3GHGA 1M1JB 3BVHA 2FFDA 1M1JA 1FZFB 2HODA 1FZEA 1W2EA 1FZCB 2HLOC 2OYHB 2XNXB 2J3FD 1JY3N 1FZAB 4R9JA 2Q9IA 2J1GA 1FZGA 1N73B 1FZGB 1FZEC 2HODC 1JY2P 1JY2N 1FZCC 1LTJC 1FZFC 3BVHC 1FICA 4M7FA 3GHGB 1T3UA 3GHGC 2J60A 2J3OA 4JZCA 1JY2O 1FZFA 1FZBB 2J61A 1LWUA 2Z4EA 3E1IC 3H32C 2Z4EB 2J3UA 1LT9B
chains in the Genus database with same CATH superfamily
3FWNA 1HWTC 3K5BA 1P84H 1AFOA 5APSA 2JHHC 1JUNA 2RN0A 2A45H 4L76A 5AW2B 3L73D 3ITKA 3TSIA 1QVGO 1FZEB 1RE4A 3CX5I 1GL2C 3R2PA 4U3FE 3HUSA 2WSSH 1ZLLA 1NTZK 1KILB 1E79H 4BWNA 2E76C 1L4AD 3A0HE 1KD1Q 2JHKF 2CK3H 2E74D 3ZDMA 4OGQC 4WY4A 1KMIZ 1RF1B 3AEEC 2KSEA 1EC5A 3AE6C 1SQQG 3N4XA 2GUSA 1H89A 2C0WA 2FFDC 3JCUH 2KIKA 2ZVOB 1NTKJ 1P84E 3S1KA 3AECC 2WVRA 2E43A 1FZEA 2Z5IA 3CWBD 2MKVA 1BE3J 2WPVB 3VYIA 4K3AA 2NZ2A 2Q9IA 2W6BA 4LC1A 1BGYG 5KAFH 2V7QH 3G71P 1FICA 1L4AC 2WWWA 4EDFA 4JYCA 1BCCG 1FZBB 3C9IA 1NTZJ 1X9VA 1KILD 1Q2NA 1Q82Q 1K8AQ 2WSEH 1G2CB 1K05A 3L75E 2WSEJ 1SQBD 3IN6A 3EWKA 3BCCJ 3MIWA 1BE3G 3CCRP 2XDJA 5L8RJ 5E79E 4LGDE 2AXTE 2JKVA 1K9MQ 1P84D 5H2FE 1RQVA 3Q5RA 2FYNC 1VQ7P 2JHLF 1L0LE 2J64A 2JO1A 3MP7B 1S72P 2K1AA 1H0TB 2HPCC 2IYPA 3CI9A 1N7SA 1BSHA 1PPJD 1Z3UA 1NAYA 1NWQA 3H1JD 1LWUB 2OTJP 1KC8Q 5EFWB 1Z3SA 3L35A 1CI6A 2OGUA 2QVAA 1CW5A 1PGQA 1KYOI 3KQGA 4I2LC 3M9QA 1MKMA 4EI2A 3H1LD 1NTMD 1ZR4A 4U3FD 3USSA 2ZFCA 1KQLA 2KZJA 4GODA 3A7OA 3V2PA 3HD7A 3IF4A 3RK3E 1BGYD 1G1JA 2P58A 5BU8B 1AQTA 2R32A 3BVHC 3NFQA 3HRNA 3W67A 3F5HA 2HYNA 2Y9YA 2AEFA 2Q3EA 1NTKG 1LT9B 2KI7B 1WRGA 1ZR2A 2J2PA 1R8EA 2C0XA 2K3RA 2NPSA 5B5EH 3BRTB 1OVVA 2KSJA 3CWBE 1NOHA 1CSBA 4GIFA 3TDKA 3L74E 1GDTA 1HUCA 3L70G 2BCCG 1FZAA 3L36A 3V4WA 3BCCE 1GL2D 1M56D 3HD7D 1S5LH 3SWYA 3WU2H 2KXPB 3RGUA 2A06D 2IZ1A 2OYIA 3H1LE 5AVWB 1FZBA 3EFFK 1SQVE 1IFMA 1SQPK 2H89C 3CX5H 1SQPG 1R5SA 3D6YA 5CBNA 4M3LA 2OTLP 1FDOA 2N1TC 2YIUB 3FWLA 1S4XA 2QM7A 4OWFA 2J5ZA 2YKOA 4D6TJ 5GTIE 4PJ0E 5APXA 3H25A 3LIEA 2QJPC 1ZW0A 2HFED 3C1LA 3H1HE 3H1KG 2XNXB 4H13C 1SLQA 3CPWO 4R9JA 2W83C 2HODC 2A06E 1URQC 2RH0A 2J60A 2B87B 1LWUA 4BXLA 3GW6A 2KLUA 3V2NA 3CLQA 2GA1A 2OYHC 1QGKB 5AW8B 1L0NK 1Y8AA 4LLHA 1EQ7A 3E1IA 1K04A 2QJPB 3A2AA 2CPSA 3Q5SA 1EDLA 1LTJA 4TT3H 3D6ZA 2J0HA 3MGNA 2IBZE 5CMZA 2AEJA 3AE9C 1A02J 1NTMK 2P7JA 2WPSA 2O01N 3L37A 4R9TA 2XKMA 3MUDC 2V7QJ 3L71G 1VQ5P 2D2CC 3SSUA 3FXEA 1L4AA 3NMDA 1NKZB 2IBZI 2D39A 3GMAA 3JCUE 1SQXJ 1FZCA 1G1IA 1SFCB 2AXTH 3CXHE 3BASA 2IDBA 1FZAC 1WMKA 1LT9C 1KYOD 1YQ3C 2LKMA 3SFEC 4PD4D 2W90A 4I7ZB 3GG2A 2FFDA 2P2UA 2M8RA 3L70D 4DT0A 2HLOC 4ZKPA 1NTMG 1PGPA 3F89A 1LTJC 1KQFB 2ZAEB 3AE8C 4C46A 2NRGA 1K73Q 2J3OA 4YXDC 1SS1A 1HJBA 1GU4A 5APTA 3E1IC 2IBZD 2YXQB 2WQYC 1T8ZA 2XV5A 2FIBA 3O8ZA 1NHLA 3E1IB 1LWUC 3H1HD 3JSVC 1M8OB 5KAIH 1L0ND 3A0BH 3PJSK 3BRVB 4Y99B 1NGMB 4YPCA 3CMEP 2YO2A 1NO4A 2K9YA 4NYTA 1GW3A 1GTWA 1VQ8P 3NXSA 3V2QA 3C8VA 5CBOA 1HTLC 3V2RA 2IX7C 1Q90D 1N7SB 5GTHE 5GTIH 1S3JA 3H1HG 1CI6B 1RF0B 5AW0B 2E75D 2OYHA 3VMAA 2QEXP 1OVRA 3L75G 2JHIF 3CCUP 3AEGC 3RK3C 1FC2C 1IK9A 4DZOA 1URQA 3D70A 3UIAA 1LNQA 4Y28J 2HODA 2R5DA 3KDPB 3VMZA 3M91A 3L73J 1MZ9A 4HH2A 2E76D 4MN4C 3D71A 4NPEA 4OGQB 1IFJA 3W68A 2KLVA 4KHXA 1EZVI 2NPSD 4JQ0D 3CCMP 1T2KC 3JC22 3H32C 2Z4EB 3IFMA 1X22A 1KZUB 3AEFC 1QL2A 1Q7YQ 2YXRB 5AVVB 1PL5A 3E7KA 2O01H 2Q1KA 3L4FA 1DX7A 3V6IA 5KLVK 3AE5C 5KJ7C 1JEKA 3HUSC 1WT6A 3WUTA 1AA0A 3RL0B 2OYIB 3L74J 3H1KJ 1VQ9P 3HE4B 2GY7A 3H1JJ 3Q5PA 3RK3B 3PRJA 1N86B 3P32A 4PV1B 3RL0C 1JCDA 2Y9ZA 3L75D 3M0DC 1T6AA 3H1IJ 3MHVA 4CPGA 2WSFJ 4XE5B 2KOGA 1OVUA 2M3EA 2JWDA 1SQXG 4I6MC 1SQBJ 1GW4A 1ZV8A 2LXBA 4N78D 3FGAD 1YTZI 1IZNB 4W80A 2WZ7A 3M9HA 4H13D 1PPJG 2N1TB 1NTME 4WWIA 3BCCD 3TF5A 4AUWA 1Y47A 4EYYQ 3B71A 2M0BA 2QE7H 1M57D 1JY2N 1MUUA 4PV1C 2H88C 5AW9B 1T3UA 2BCCD 3SFDC 1SQVD 2Y0DA 2Z4EA 4ASVA 1YJ9P 1P84I 4PD4H 5KLVG 3U1AA 1H88A 4M7HA 4H44B 1JC9A 2XNXC 1SVFA 1AVOA 1IO4A 2UWJE 1Q86Q 1DH3A 1JB0J 1RE3A 4ZKUA 2PP6A 1RE3B 2J0GA 3LW5J 1BGYE 2Z4EC 4IL6E 2ZXXA 3CXHD 4N78E 2W8ZA 3OW2O 3CX5E 4OGQD 3L70J 1ZMEC 3BATA 3KZIH 2E42A 1SQPD 2J0YA 2Y0CA 4QMAA 1LP1A 1X8YA 1J1DB 4BRYB 2DW3A 2YKQA 1GK4A 1M1JB 2H8PD 3H1IE 1M1JA 2B9BA 5CCGD 5B66H 2WITA 1A02F 1SQXD 5KTBA 1HGZA 1FZEC 1VL2A 2BCCJ 3CCLP 1QLED 3GHGB 4RESB 1N7SD 1OWAA 1FE6A 4AQRD 2OARA 2QA4P 1RQUA 1KYOH 2N1TD 3H1KD 2CPBA 4YXWH 1KV4A 5CCGA 1JTHB 1AJYA 2BASA 1JCCA 2QJYB 1M1JC 1UIXA 2G3AA 3PP5A 2BEQD 3CX5D 2P1JA 3H1ID 1VQOP 5KAFE 1FIBA 1GU5A 3TNUA 4UB8H 2O1KA 2WPRA 4WY4C 1BSNA 5B66E 4EIJA 1VDFA 2ZVNB 2KK7A 3MD0A 4DOJA 3HE4A 1VF5D 3FX0A 2J3GA 3RL0D 3CL3D 3HTKB 1PP9E 1LGHB 1GK6A 4GT1A 2XNXA 1FZDA 5APWA 1M7LA 1N73A 5AVSB 4HB1A 1EXJA 1HGVA 1SQBE 2OQQA 1H0TA 3RK2B 3WU2E 3G4SP 1OW8A 2A06G 3Q2YA 1BCCD 2ZYDA 2J5UA 4JPZB 1FZFB 3VMYA 4I1LA 3AE7C 4A7PA 3IR9A 3FXDA 4PD4E 3CC2P 2Q6QA 4R4MA 1BE3D 5CHXA 4K35A 2B89A 1FZFC 1NVOA 2D2CB 4JZCA 1SQVK 2VRSA 1OX3A 2FYUG 3U59A 2KUBA 2RKLA 1FDIA 3CXHI 1R5LA 1FJKA 5AW7B 1RF0C 1OIPA 2K37A 4BRYA 5E79H 3H1LG 4ZNCA 2FFDB 4R4LA 2HG5D 5APQA 2FYZA 4O9BA 4TLFA 2KP8A 2J59M 1MV8A 3CCJP 3I5CA 3M0DA 1VQNP 3II6A 1SQVG 5APYA 3KZIE 2WNPF 1YI2P 2M5AA 5CJ4A 4B86A 2FYUK 3L73G 5BU5A 4IFMA 4L73A 1M90Q 4NPFX 2H7HA 1S9KE 2WSFH 1LTIC 1YBKA 1JY3P 1HBWA 2R44A 1NYHA 1DEBA 1L0NE 3BCCG 5KAIE 2HLOA 2HR3A 1FIDA 4YTPC 4IFFA 3B5ND 1Z56A 1J1EC 3L74D 1IC2A 4AYCA 3RBXA 1E5WA 1D7MA 1ZN5A 2WT7A 2AEMA 1YJWP 3H1HJ 1G2CA 1SQQK 1FZCC 1OW7A 3P7KA 3CCEP 4EOTA 1PP9D 1X0TA 3GHGC 3T97B 4IOIH 1LTTC 2JJLA 4H44C 3L72D 1KILA 1YQ4C 4RO0A 1J2JB 3HUSB 3G6EP 3HE5B 1EZVG 2FXMA 2FYUJ 3OJAB 4WB4A 3AE3C 1GD2E 2IZ0A 3KHUA 4RKUJ 2ITAA 2K9JA 3P8MC 2HPCB 3VP8A 1NTKK 2O3JA 3WUUA 3RBZA 1JMBA 3AE2C 3GLMA 1RE3C 1MFZA 2POHA 3V5BA 2JP3A 1NU1E 1Y9BA 2PRRA 3AEAC 2FYNB 2N9BA 5DJUB 2H43B 4C7RA 3A0HH 4IFDK 2KS1B 3M0AA 2ZT9D 3VTPC 3AE4C 1N73C 1PP9G 1L0LG 3G9RA 4Y99C 2I1JA 1USDA 1XTGB 1PGOA 3V4QA 2JDIH 1L4AB 1SQQD 1PPJE 4RJTA 2Z5HA 1S1CX 1FOSE 2E5YA 3H1JG 1PFIA 4W7YA 4GOFA 4C7NB 1IFNA 1JMMA 4GKGA 3O6QB 3L74G 3L72G 1USEA 2J61A 5CCHC 5KLVD 1OXZA 3G3ZA 2YMKA 2W27A 1JY3O 3P8CE 2PAJA 1U57A 2K9JB 1ZOYC 2I8DA 1N86A 1LT9A 3NTNA 4HYTB 3SWFA 3SWKA 4NPDA 1PGJA 1PV3A 3PH0A 1LTGC 1GMJA 1OZHA 4EPUA 3L72E 1RE4B 2YO3A 2LR2A 2YIUC 1LTJB 3Q1MA 3KYQA 1L0NJ 1IFPA 1KN7A 1SQVJ 3A3YB 2IFNA 3HD7B 2FKWB 1GL2B 4PD4I 3HE5A 5KJ7A 2HLOB 2RMZA 2ZT9B 1N2DC 1IK7A 2MJZA 2Q3IA 4GDOA 3CCQP 5AVUB 2R3CA 3VN0A 1FBMA 3I56P 1NU1D 5KLVE 1SFCA 1H8AA 2QRXA 1L0LD 5C39A 2J1GA 1FS0E 1SFCC 5AVXB 1DD3A 4OH8B 1IJDB 1YHQP 3P8CD 1VQ6P 2D2CD 1LTBC 3L71J 4D6TD 1JY2O 1M1KQ 3CMAP 2FXOA 1SQPJ 2JHMF 5M1BA 1EXIA 1S2EA 2O01J 3CC7P 3LIDA 1VF5B 4Z1MH 2QJKB 1BCCE 5AW4B 3RK2D 2LXCB 2WT7B 2E5TA 3AEBC 2KZIA 3MTUE 1SQQE 1KQGB 2ZYGA 1JTHA 1SQQJ 3B5NA 1SQXE 3IAOA 2J61B 2H43A 3B5NB 3H1KE 2WPQA 3FIBA 1W2BO 5APUA 2QG4A 1EDIA 4DCKA 4N3YB 1QEXA 2M3BA 4U3FG 2A45I 1FAVA 2QIWA 2H43C 1CZQA 1HF9A 1KB9E 3OA7A 1ZRTE 3H6PA 4HKZH 1W2EA 1YYCA 1JY3N 2C9LY 1L0NG 4H0LC 3LW5H 1MFTA 2IYOA 1NU1K 1N73B 1KYOE 1ZP0C 1LT1A 1YITP 2WSCH 2Y0EA 1SP4A 2E74C 1QX8A 2K88A 1J1DC 5DJTB 2E75C 1KFNA 1UIIA 1YTZT 5APVA 2SPZA 3L71E 5KKZB 3B5NC 2HPCA 4L74A 3MUDA 1JO5A 1NH4A 3MZWB 3CCVP 1FOSF 1JM0A 4H0LB 2IBZG 4PJ0H 3HTKA 2J3FA 4UB8E 1LTAC 1NU1G 4H0LD 2Q9IB 1PP9J 3H1LJ 1BCCJ 4I7ZC 2E74B 4ZMDA 1HH0A 2XU6A 2R5BA 2XNDH 1RY3A 4JYBA 2Q7CA 3PTZA 3PLNA 1FZGC 2G8YA 2BEZF 3CXHH 3L71D 1W5CE 1OW6A 3VOPA 5KLVJ 3S9OA 1FZCB 5AVYB 3M06A 2OTKE 2E75B 1LP1B 1LJ2A 4H13B 1PIXA 3QH9A 2FY8A 3AE1C 1AV1A 1XTCC 5TISE 2OYOA 4N6JA 2M5AB 3TGUE 1URQD 2Q5UA 1FJPA 1U7MA 1SQPE 2N1TA 2J3UA 2ZT9C 2YMYA 1NTZD 1KB9D 1SQBK 2FBWC 1SQBG 1L2PA 1U7JA 5CCHA 1HVVA 3RK3D 3GF3A 3BVHB 1VQKP 2QJKC 4ASWA 3KPEA 3ABVC 1HJ0A 2FYUD 1BGYJ 3R4YA 4JBZA 3A0BE 3GF7A 3M9BA 1NJIQ 3CCSP 5AVQB 1RF1C 2WMMA 3CWBJ 4JYOX 1ZRTD 3CD6P 4WY4D 3E1RA 1N86C 3H1JE 4PV1D 2JWAA 3EFGA 2P10A 5AW1B 2AXCA 2OYIC 1S5LX 1VQMP 2JR8A 2HODB 1QVFO 4U7JA 3TNUB 2WSCJ 2GM4A 2IPPA 3L72J 3CWBG 5AVRB 1RE4C 2O1JA 2NPSB 1BDDA 5B5EE 3BVHA 1VQPP 2L5GB 1AVYA 1NTMJ 1AQ5A 1ZXGA 1OMIA 2J3FD 1YIJP 5CJ0A 5KJ7D 4D6TE 1NTZE 2J58A 3HD7C 1JY2P 1DEEG 1X79B 1OFCX 1S5LE 4M7FA 1SQXK 5AVTB 1DD4A 3L75J 2I1KA 1KB9H 2FYUE 3H1IG 4KJMA 2E76B 1KFMA 1NTKD 4WY4B 4WBAA 3CC4P 2W6JH 2JEEA 1KILC 4H44D 4D6TG 2ZJSE 3N7NA 4KT0J 1EZVE 3TYYA 1L0LJ 3VP9A 4OVNF 2A45G 1KB9I 1NU1J 3RK2C 1RHZB 3S4RA 1RF0A 1N8RQ 2Q9IC 4L75A 2P67A 1NTZG 1VQLP 2GUVA 3PHLA 4U3FJ 3H32B 1EDKA 2PGDA 1N7SC 1JNMA 3AEDC 1IFDA 2PFXA 5TJHA 2W6AA 3L70E 4XA4A 1FDMA 2XZRA 4HJGH 2IFMA 5AW6B 1EDJA 3EQ2A 5KLIC 2KNCA 4WVZA 1NKNA 1PZQA 1FZBC 3GHGA 3B4SA 3O6QA 4UB6H 3B8EB 5KKZC 3WMM0 1NTKE 3L73E 5KLIB 1KTMA 2KYVA 1L0LK 2BCCE 1VQ4P 1FZGB 1DIPA 3TGUJ 2WTYA 4DJGA 3TK1A 1VF5C 4IL6X 3Q3DA 2NPSC 5AW5B 1T2KD 2ZXEB 1N7LA 1S9KD 1RF1A 1KORA 1QL1A 2KNCB 5TISH 1IFIA 1BDCA 3TGUD 5GTHH 4ZFGA 3U1CA 4W7ZA 3TGUG 2QJYC 5CCGC 5K5GB 3VMXA 1SFCD 5BVZA 1GL2A 2C9NY 4UB6E 4GOEA 3H32A 3WUVA 1KILE 2B88A 1NAFA 4IL6H 1KQSO 5H2FH 1TU3F 3RL0g 1EZVD 4XFJA 2YNYA 2ZYAA 1Q81Q 1BE3E 1GZLA 2YKPA 3KXDA 3A5TA 2KB7P 3T97A 1FU1A 4C7NA 1J1EB 1JOCA 2L91A 2KS1A 1VPCA 2OYHB 5AW3B 1FZAB 1RH5B 1FZGA 3I55P 3QWOC 2R3SA 2FXPA 1LTSC 2V4HA 1T3JA 1URQB 5AVZB 2QM8A 4JF7A 5CCHD 2N9YB 1FZFA 1YJNP 3OAKA 2B87A 2QSIA
chains in the Genus database with same CATH topology
1T8ZA 1HWTC 1AFOA 1YTZT 2XV5A 5APSA 5APVA 1JUNA 2JHHC 1FJKA 2FIBA 3O8ZA 1NHLA 5AW7B 3E1IB 1RF0C 2A45H 1LWUC 5AW2B 2FFDB 3B5NC 2HPCA 2HG5D 3MUDA 3TSIA 1NH4A 3BRVB 5APQA 1JO5A 1FZEB 1RE4A 1FOSF 4Y99B 2FYZA 3HTKA 1GL2C 4O9BA 2YO2A 3R2PA 1NO4A 2KP8A 2J3FA 3HUSA 1LTAC 2J59M 1ZLLA 1MV8A 1NTZK 4NYTA 1GW3A 1KILB 2Q9IB 1GTWA 3NXSA 3V2QA 3I5CA 3M0DA 1HTLC 3II6A 1L4AD 3V2RA 2IX7C 2JHKF 1N7SB 1HH0A 5APYA 2XU6A 2R5BA 2WNPF 5CJ4A 4B86A 1RY3A 2FYUK 5BU5A 4WY4A 4JYBA 4IFMA 2H7HA 2Q7CA 1S9KE 1CI6B 2WSFH 1RF0B 1RF1B 1LTIC 5AW0B 2OYHA 1FZGC 1JY3P 1HBWA 3N4XA 1DEBA 2JHIF 2HLOA 2GUSA 1H89A 2C0WA 1FIDA 3RK3C 4IFFA 3B5ND 2FFDC 1IK9A 3VOPA 4DZOA 1URQA 1Z56A 1J1EC 3UIAA 1IC2A 4AYCA 2HODA 2R5DA 3KDPB 2E43A 1FZEA 1E5WA 2Z5IA 1FZCB 5AVYB 1ZN5A 2WT7A 3VYIA 3M06A 3VMZA 2Q9IA 1G2CA 3M91A 1SQQK 2W6BA 1MZ9A 4HH2A 4LC1A 1FZCC 1XTCC 3P7KA 4EOTA 1FICA 1IFJA 1L4AC 3GHGC 4N6JA 2KLVA 4KHXA 1URQD 2WWWA 2NPSD 2Q5UA 4JYCA 1FZBB 1T2KC 1FJPA 3C9IA 3H32C 2Z4EB 2N1TA 1LTTC 2J3UA 2JJLA 3IFMA 1X9VA 1KILD 1KZUB 2YMYA 1QL2A 2WSEH 1KILA 1G2CB 1J2JB 1SQBK 3HUSB 3HE5B 5AVVB 5CCHA 3MIWA 2FXMA 1HVVA 3OJAB 2O01H 2XDJA 4WB4A 3RK3D 3BVHB 1GD2E 4LGDE 3L4FA 3KPEA 3P8MC 2HPCB 3VP8A 1DX7A 5KLVK 1NTKK 3M9BA 5KJ7C 3HUSC 2JHLF 2J64A 5AVQB 1RF1C 1RE3C 1WT6A 1MFZA 2POHA 3V5BA 4JYOX 4WY4D 3RL0B 2OYIB 1N86C 2N9BA 2HPCC 3CI9A 3EFGA 3HE4B 2H43B 2GY7A 4C7RA 3RK3B 5AW1B 1N7SA 4IFDK 2OYIC 1N86B 3P32A 3M0AA 3RL0C 1JCDA 3M0DC 3VTPC 1Z3UA 1NWQA 1LWUB 2HODB 1Z3SA 1N73C 3L35A 1CI6A 3TNUB 1CW5A 4XE5B 2GM4A 2IPPA 2KOGA 4Y99C 2I1JA 3KQGA 1XTGB 4I2LC 3M9QA 5AVRB 1RE4C 2O1JA 4I6MC 2NPSB 1GW4A 1ZV8A 4N78D 3V4QA 1ZR4A 1YTZI 3BVHA 4W80A 1L4AB 2ZFCA 2L5GB 1KQLA 2WZ7A 3A7OA 3V2PA 3M9HA 1AQ5A 2Z5HA 3HD7A 2J3FD 1G1JA 2N1TB 5CJ0A 5KJ7D 5BU8B 4AUWA 2J58A 3HD7C 1FOSE 1JY2P 1JY2N 1X79B 1PFIA 2R32A 4W7YA 4C7NB 1MUUA 1IFNA 4M7FA 3NFQA 1JMMA 4GKGA 3BVHC 5AW9B 1T3UA 1SQXK 5AVTB 3HRNA 2I1KA 2HYNA 2J61A 5CCHC 2Z4EA 1KFMA 4WY4B 1LT9B 4WBAA 1WRGA 2JEEA 1KILC 1OXZA 3U1AA 1H88A 4M7HA 1JC9A 2XNXC 3G3ZA 1ZR2A 2J2PA 2W27A 1SVFA 1JY3O 2C0XA 3N7NA 2NPSA 1IO4A 3BRTB 3P8CE 3TYYA 3VP9A 2KSJA 1NOHA 2A45G 2PAJA 1CSBA 4GIFA 1DH3A 3RK2C 1N86A 1GDTA 1HUCA 1LT9A 1RF0A 3NTNA 1FZAA 1RE3A 2Q9IC 3L36A 3V4WA 1GL2D 2P67A 4ZKUA 4HYTB 3HD7D 2PP6A 3SWFA 1RE3B 2J0GA 2GUVA 3SWYA 2Z4EC 3H32B 2OYIA 1LTGC 1N7SC 1JNMA 4N78E 1IFDA 5AVWB 1FZBA 4EPUA 1RE4B 2YO3A 3BATA 1IFMA 1LTJB 1SQPK 2E42A 2W6AA 3KYQA 2J0YA 4XA4A 3A3YB 1FDMA 2IFNA 3HD7B 2FKWB 1GL2B 4M3LA 2XZRA 3HE5A 2IFMA 5AW6B 5KJ7A 2N1TC 3EQ2A 1X8YA 2HLOB 2QM7A 1J1DB 1N2DC 2J5ZA 2MJZA 1NKNA 2YKOA 1FZBC 2YKQA 3GHGA 1GK4A 5APXA 1M1JB 2H8PD 2Q3IA 5AVUB 3LIEA 3B8EB 2HFED 1M1JA 2R3CA 3VN0A 3WMM0 1FBMA 5CCGD 1SFCA 1H8AA 2WITA 1A02F 2XNXB 2KYVA 1SLQA 1L0LK 4R9JA 2J1GA 1SFCC 5AVXB 5KTBA 4OH8B 1FZGB 1HGZA 1FZEC 2HODC 2WTYA 1IJDB 3P8CD 3GHGB 1URQC 1LTBC 4RESB 1N7SD 3TK1A 2J60A 1OWAA 4AQRD 1JY2O 2NPSC 1LWUA 5AW5B 1T2KD 2ZXEB 1N7LA 1S9KD 2OARA 3V2NA 3CLQA 2JHMF 1RF1A 2OYHC 2N1TD 5AW8B 1L0NK 2CPBA 5CCGA 1JTHB 1EQ7A 4LLHA 3E1IA 2BASA 3LIDA 1JCCA 1QL1A 1M1JC 3A2AA 1IFIA 2CPSA 4ZFGA 1LTJA 3PP5A 3U1CA 2P1JA 4W7ZA 2J0HA 3MGNA 5CMZA 5AW4B 3RK2D 5CCGC 2WT7B 1FIBA 3MTUE 1GU5A 3TNUA 1NTMK 3VMXA 1A02J 1SFCD 5BVZA 1GL2A 2P7JA 2WPSA 2C9NY 2O1KA 3L37A 4R9TA 2XKMA 2WPRA 4WY4C 3H32A 1JTHA 4EIJA 1VDFA 3B5NA 1NAFA 3MD0A 4DOJA 2J61B 3HE4A 2H43A 1L4AA 3B5NB 3NMDA 1NKZB 2J3GA 2WPQA 2D39A 3FIBA 5APUA 1FZCA 3RL0D 3CL3D 3HTKB 4N3YB 1LGHB 1GK6A 4GT1A 1G1IA 2XNXA 2M3BA 1FZDA 1SFCB 5APWA 1M7LA 1N73A 3BASA 2YNYA 5AVSB 2A45I 1HGVA 1FZAC 1FAVA 3RK2B 1LT9C 1GZLA 2YKPA 2LKMA 2H43C 3A5TA 1CZQA 2KB7P 3T97A 1FU1A 3OA7A 4C7NA 1J1EB 2FFDA 2P2UA 1FZFB 1JOCA 3H6PA 2M8RA 1W2EA 3VMYA 4I1LA 1VPCA 2HLOC 2OYHB 5AW3B 4ZKPA 1YYCA 1JY3N 2C9LY 1FZAB 3IR9A 3LW5H 1FZGA 1N73B 1NU1K 1LTSC 5CHXA 1T3JA 1LTJC 1FZFC 1URQB 2WSCH 4C46A 5AVZB 1SP4A 2QM8A 2J3OA 4JF7A 5CCHD 1SQVK 4JZCA 2VRSA 1HJBA 1FZFA 1GU4A 3OAKA 5APTA 3E1IC 1J1DC 3U59A 1KFNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M7H A;  1JC9 A;  1RF1 A;  2OYH C;  2JHM F;  2XNX C;  2J2P A;  2JHH C;  2FIB A;  3HUS B;  1JY3 O;  3E1I B;  1RF0 C;  3E1I A;  2A45 H;  1LWU C;  1M1J C;  2A45 G;  2FFD B;  4ZFG A;  3BVH B;  2HPC A;  1LTJ A;  2HPC B;  2J0H A;  1N86 A;  1FZE B;  1RE4 A;  1LT9 A;  1RF0 A;  1FZA A;  1RE3 A;  1FIB A;  2Q9I C;  3HUS C;  2JHL F;  2J3F A;  2J64 A;  3HUS A;  1RF1 C;  1RE3 C;  1RE3 B;  2J0G A;  4JYO X;  4NYT A;  2Q9I B;  4R9T A;  2OYI B;  1N86 C;  3H32 A;  2Z4E C;  3H32 B;  2OYI A;  2JHK F;  2HPC C;  2H43 B;  4EPU A;  1FZB A;  2GY7 A;  2J61 B;  2H43 A;  1RE4 B;  2WNP F;  2OYI C;  1N86 B;  2J3G A;  2D39 A;  3FIB A;  1LTJ B;  1FZC A;  1Z3U A;  2J0Y A;  1LWU B;  2HOD B;  1RF0 B;  1RF1 B;  1Z3S A;  2XNX A;  2OYH A;  1FZG C;  1JY3 P;  1N73 C;  1FZD A;  1N73 A;  2A45 I;  2JHI F;  1FZA C;  2HLO A;  2HLO B;  1LT9 C;  1FID A;  1RE4 C;  2J5Z A;  2H43 C;  2FFD C;  1FZB C;  3GHG A;  1M1J B;  3BVH A;  2FFD A;  1M1J A;  1FZF B;  2HOD A;  1FZE A;  1W2E A;  1FZC B;  2HLO C;  2OYH B;  2XNX B;  2J3F D;  1JY3 N;  1FZA B;  4R9J A;  2Q9I A;  2J1G A;  1FZG A;  1N73 B;  1FZG B;  1FZE C;  2HOD C;  1JY2 P;  1JY2 N;  1FZC C;  1LTJ C;  1FZF C;  3BVH C;  1FIC A;  4M7F A;  3GHG B;  1T3U A;  3GHG C;  2J60 A;  2J3O A;  4JZC A;  1JY2 O;  1FZF A;  1FZB B;  2J61 A;  1LWU A;  2Z4E A;  3E1I C;  3H32 C;  2Z4E B;  2J3U A;  1LT9 B; 
#chains in the Genus database with same CATH topology
 3FWN A;  1HWT C;  3K5B A;  1P84 H;  1AFO A;  5APS A;  2JHH C;  1JUN A;  2RN0 A;  2A45 H;  4L76 A;  5AW2 B;  3L73 D;  3ITK A;  3TSI A;  1QVG O;  1FZE B;  1RE4 A;  3CX5 I;  1GL2 C;  3R2P A;  4U3F E;  3HUS A;  2WSS H;  1ZLL A;  1NTZ K;  1KIL B;  1E79 H;  4BWN A;  2E76 C;  1L4A D;  3A0H E;  1KD1 Q;  2JHK F;  2CK3 H;  2E74 D;  3ZDM A;  4OGQ C;  4WY4 A;  1KMI Z;  1RF1 B;  3AEE C;  2KSE A;  1EC5 A;  3AE6 C;  1SQQ G;  3N4X A;  2GUS A;  1H89 A;  2C0W A;  2FFD C;  3JCU H;  2KIK A;  2ZVO B;  1NTK J;  1P84 E;  3S1K A;  3AEC C;  2WVR A;  2E43 A;  1FZE A;  2Z5I A;  3CWB D;  2MKV A;  1BE3 J;  2WPV B;  3VYI A;  4K3A A;  2NZ2 A;  2Q9I A;  2W6B A;  4LC1 A;  1BGY G;  5KAF H;  2V7Q H;  3G71 P;  1FIC A;  1L4A C;  2WWW A;  4EDF A;  4JYC A;  1BCC G;  1FZB B;  3C9I A;  1NTZ J;  1X9V A;  1KIL D;  1Q2N A;  1Q82 Q;  1K8A Q;  2WSE H;  1G2C B;  1K05 A;  3L75 E;  2WSE J;  1SQB D;  3IN6 A;  3EWK A;  3BCC J;  3MIW A;  1BE3 G;  3CCR P;  2XDJ A;  5L8R J;  5E79 E;  4LGD E;  2AXT E;  2JKV A;  1K9M Q;  1P84 D;  5H2F E;  1RQV A;  3Q5R A;  2FYN C;  1VQ7 P;  2JHL F;  1L0L E;  2J64 A;  2JO1 A;  3MP7 B;  1S72 P;  2K1A A;  1H0T B;  2HPC C;  2IYP A;  3CI9 A;  1N7S A;  1BSH A;  1PPJ D;  1Z3U A;  1NAY A;  1NWQ A;  3H1J D;  1LWU B;  2OTJ P;  1KC8 Q;  5EFW B;  1Z3S A;  3L35 A;  1CI6 A;  2OGU A;  2QVA A;  1CW5 A;  1PGQ A;  1KYO I;  3KQG A;  4I2L C;  3M9Q A;  1MKM A;  4EI2 A;  3H1L D;  1NTM D;  1ZR4 A;  4U3F D;  3USS A;  2ZFC A;  1KQL A;  2KZJ A;  4GOD A;  3A7O A;  3V2P A;  3HD7 A;  3IF4 A;  3RK3 E;  1BGY D;  1G1J A;  2P58 A;  5BU8 B;  1AQT A;  2R32 A;  3BVH C;  3NFQ A;  3HRN A;  3W67 A;  3F5H A;  2HYN A;  2Y9Y A;  2AEF A;  2Q3E A;  1NTK G;  1LT9 B;  2KI7 B;  1WRG A;  1ZR2 A;  2J2P A;  1R8E A;  2C0X A;  2K3R A;  2NPS A;  5B5E H;  3BRT B;  1OVV A;  2KSJ A;  3CWB E;  1NOH A;  1CSB A;  4GIF A;  3TDK A;  3L74 E;  1GDT A;  1HUC A;  3L70 G;  2BCC G;  1FZA A;  3L36 A;  3V4W A;  3BCC E;  1GL2 D;  1M56 D;  3HD7 D;  1S5L H;  3SWY A;  3WU2 H;  2KXP B;  3RGU A;  2A06 D;  2IZ1 A;  2OYI A;  3H1L E;  5AVW B;  1FZB A;  3EFF K;  1SQV E;  1IFM A;  1SQP K;  2H89 C;  3CX5 H;  1SQP G;  1R5S A;  3D6Y A;  5CBN A;  4M3L A;  2OTL P;  1FDO A;  2N1T C;  2YIU B;  3FWL A;  1S4X A;  2QM7 A;  4OWF A;  2J5Z A;  2YKO A;  4D6T J;  5GTI E;  4PJ0 E;  5APX A;  3H25 A;  3LIE A;  2QJP C;  1ZW0 A;  2HFE D;  3C1L A;  3H1H E;  3H1K G;  2XNX B;  4H13 C;  1SLQ A;  3CPW O;  4R9J A;  2W83 C;  2HOD C;  2A06 E;  1URQ C;  2RH0 A;  2J60 A;  2B87 B;  1LWU A;  4BXL A;  3GW6 A;  2KLU A;  3V2N A;  3CLQ A;  2GA1 A;  2OYH C;  1QGK B;  5AW8 B;  1L0N K;  1Y8A A;  4LLH A;  1EQ7 A;  3E1I A;  1K04 A;  2QJP B;  3A2A A;  2CPS A;  3Q5S A;  1EDL A;  1LTJ A;  4TT3 H;  3D6Z A;  2J0H A;  3MGN A;  2IBZ E;  5CMZ A;  2AEJ A;  3AE9 C;  1A02 J;  1NTM K;  2P7J A;  2WPS A;  2O01 N;  3L37 A;  4R9T A;  2XKM A;  3MUD C;  2V7Q J;  3L71 G;  1VQ5 P;  2D2C C;  3SSU A;  3FXE A;  1L4A A;  3NMD A;  1NKZ B;  2IBZ I;  2D39 A;  3GMA A;  3JCU E;  1SQX J;  1FZC A;  1G1I A;  1SFC B;  2AXT H;  3CXH E;  3BAS A;  2IDB A;  1FZA C;  1WMK A;  1LT9 C;  1KYO D;  1YQ3 C;  2LKM A;  3SFE C;  4PD4 D;  2W90 A;  4I7Z B;  3GG2 A;  2FFD A;  2P2U A;  2M8R A;  3L70 D;  4DT0 A;  2HLO C;  4ZKP A;  1NTM G;  1PGP A;  3F89 A;  1LTJ C;  1KQF B;  2ZAE B;  3AE8 C;  4C46 A;  2NRG A;  1K73 Q;  2J3O A;  4YXD C;  1SS1 A;  1HJB A;  1GU4 A;  5APT A;  3E1I C;  2IBZ D;  2YXQ B;  2WQY C;  1T8Z A;  2XV5 A;  2FIB A;  3O8Z A;  1NHL A;  3E1I B;  1LWU C;  3H1H D;  3JSV C;  1M8O B;  5KAI H;  1L0N D;  3A0B H;  3PJS K;  3BRV B;  4Y99 B;  1NGM B;  4YPC A;  3CME P;  2YO2 A;  1NO4 A;  2K9Y A;  4NYT A;  1GW3 A;  1GTW A;  1VQ8 P;  3NXS A;  3V2Q A;  3C8V A;  5CBO A;  1HTL C;  3V2R A;  2IX7 C;  1Q90 D;  1N7S B;  5GTH E;  5GTI H;  1S3J A;  3H1H G;  1CI6 B;  1RF0 B;  5AW0 B;  2E75 D;  2OYH A;  3VMA A;  2QEX P;  1OVR A;  3L75 G;  2JHI F;  3CCU P;  3AEG C;  3RK3 C;  1FC2 C;  1IK9 A;  4DZO A;  1URQ A;  3D70 A;  3UIA A;  1LNQ A;  4Y28 J;  2HOD A;  2R5D A;  3KDP B;  3VMZ A;  3M91 A;  3L73 J;  1MZ9 A;  4HH2 A;  2E76 D;  4MN4 C;  3D71 A;  4NPE A;  4OGQ B;  1IFJ A;  3W68 A;  2KLV A;  4KHX A;  1EZV I;  2NPS D;  4JQ0 D;  3CCM P;  1T2K C;  3JC2 2;  3H32 C;  2Z4E B;  3IFM A;  1X22 A;  1KZU B;  3AEF C;  1QL2 A;  1Q7Y Q;  2YXR B;  5AVV B;  1PL5 A;  3E7K A;  2O01 H;  2Q1K A;  3L4F A;  1DX7 A;  3V6I A;  5KLV K;  3AE5 C;  5KJ7 C;  1JEK A;  3HUS C;  1WT6 A;  3WUT A;  1AA0 A;  3RL0 B;  2OYI B;  3L74 J;  3H1K J;  1VQ9 P;  3HE4 B;  2GY7 A;  3H1J J;  3Q5P A;  3RK3 B;  3PRJ A;  1N86 B;  3P32 A;  4PV1 B;  3RL0 C;  1JCD A;  2Y9Z A;  3L75 D;  3M0D C;  1T6A A;  3H1I J;  3MHV A;  4CPG A;  2WSF J;  4XE5 B;  2KOG A;  1OVU A;  2M3E A;  2JWD A;  1SQX G;  4I6M C;  1SQB J;  1GW4 A;  1ZV8 A;  2LXB A;  4N78 D;  3FGA D;  1YTZ I;  1IZN B;  4W80 A;  2WZ7 A;  3M9H A;  4H13 D;  1PPJ G;  2N1T B;  1NTM E;  4WWI A;  3BCC D;  3TF5 A;  4AUW A;  1Y47 A;  4EYY Q;  3B71 A;  2M0B A;  2QE7 H;  1M57 D;  1JY2 N;  1MUU A;  4PV1 C;  2H88 C;  5AW9 B;  1T3U A;  2BCC D;  3SFD C;  1SQV D;  2Y0D A;  2Z4E A;  4ASV A;  1YJ9 P;  1P84 I;  4PD4 H;  5KLV G;  3U1A A;  1H88 A;  4M7H A;  4H44 B;  1JC9 A;  2XNX C;  1SVF A;  1AVO A;  1IO4 A;  2UWJ E;  1Q86 Q;  1DH3 A;  1JB0 J;  1RE3 A;  4ZKU A;  2PP6 A;  1RE3 B;  2J0G A;  3LW5 J;  1BGY E;  2Z4E C;  4IL6 E;  2ZXX A;  3CXH D;  4N78 E;  2W8Z A;  3OW2 O;  3CX5 E;  4OGQ D;  3L70 J;  1ZME C;  3BAT A;  3KZI H;  2E42 A;  1SQP D;  2J0Y A;  2Y0C A;  4QMA A;  1LP1 A;  1X8Y A;  1J1D B;  4BRY B;  2DW3 A;  2YKQ A;  1GK4 A;  1M1J B;  2H8P D;  3H1I E;  1M1J A;  2B9B A;  5CCG D;  5B66 H;  2WIT A;  1A02 F;  1SQX D;  5KTB A;  1HGZ A;  1FZE C;  1VL2 A;  2BCC J;  3CCL P;  1QLE D;  3GHG B;  4RES B;  1N7S D;  1OWA A;  1FE6 A;  4AQR D;  2OAR A;  2QA4 P;  1RQU A;  1KYO H;  2N1T D;  3H1K D;  2CPB A;  4YXW H;  1KV4 A;  5CCG A;  1JTH B;  1AJY A;  2BAS A;  1JCC A;  2QJY B;  1M1J C;  1UIX A;  2G3A A;  3PP5 A;  2BEQ D;  3CX5 D;  2P1J A;  3H1I D;  1VQO P;  5KAF E;  1FIB A;  1GU5 A;  3TNU A;  4UB8 H;  2O1K A;  2WPR A;  4WY4 C;  1BSN A;  5B66 E;  4EIJ A;  1VDF A;  2ZVN B;  2KK7 A;  3MD0 A;  4DOJ A;  3HE4 A;  1VF5 D;  3FX0 A;  2J3G A;  3RL0 D;  3CL3 D;  3HTK B;  1PP9 E;  1LGH B;  1GK6 A;  4GT1 A;  2XNX A;  1FZD A;  5APW A;  1M7L A;  1N73 A;  5AVS B;  4HB1 A;  1EXJ A;  1HGV A;  1SQB E;  2OQQ A;  1H0T A;  3RK2 B;  3WU2 E;  3G4S P;  1OW8 A;  2A06 G;  3Q2Y A;  1BCC D;  2ZYD A;  2J5U A;  4JPZ B;  1FZF B;  3VMY A;  4I1L A;  3AE7 C;  4A7P A;  3IR9 A;  3FXD A;  4PD4 E;  3CC2 P;  2Q6Q A;  4R4M A;  1BE3 D;  5CHX A;  4K35 A;  2B89 A;  1FZF C;  1NVO A;  2D2C B;  4JZC A;  1SQV K;  2VRS A;  1OX3 A;  2FYU G;  3U59 A;  2KUB A;  2RKL A;  1FDI A;  3CXH I;  1R5L A;  1FJK A;  5AW7 B;  1RF0 C;  1OIP A;  2K37 A;  4BRY A;  5E79 H;  3H1L G;  4ZNC A;  2FFD B;  4R4L A;  2HG5 D;  5APQ A;  2FYZ A;  4O9B A;  4TLF A;  2KP8 A;  2J59 M;  1MV8 A;  3CCJ P;  3I5C A;  3M0D A;  1VQN P;  3II6 A;  1SQV G;  5APY A;  3KZI E;  2WNP F;  1YI2 P;  2M5A A;  5CJ4 A;  4B86 A;  2FYU K;  3L73 G;  5BU5 A;  4IFM A;  4L73 A;  1M90 Q;  4NPF X;  2H7H A;  1S9K E;  2WSF H;  1LTI C;  1YBK A;  1JY3 P;  1HBW A;  2R44 A;  1NYH A;  1DEB A;  1L0N E;  3BCC G;  5KAI E;  2HLO A;  2HR3 A;  1FID A;  4YTP C;  4IFF A;  3B5N D;  1Z56 A;  1J1E C;  3L74 D;  1IC2 A;  4AYC A;  3RBX A;  1E5W A;  1D7M A;  1ZN5 A;  2WT7 A;  2AEM A;  1YJW P;  3H1H J;  1G2C A;  1SQQ K;  1FZC C;  1OW7 A;  3P7K A;  3CCE P;  4EOT A;  1PP9 D;  1X0T A;  3GHG C;  3T97 B;  4IOI H;  1LTT C;  2JJL A;  4H44 C;  3L72 D;  1KIL A;  1YQ4 C;  4RO0 A;  1J2J B;  3HUS B;  3G6E P;  3HE5 B;  1EZV G;  2FXM A;  2FYU J;  3OJA B;  4WB4 A;  3AE3 C;  1GD2 E;  2IZ0 A;  3KHU A;  4RKU J;  2ITA A;  2K9J A;  3P8M C;  2HPC B;  3VP8 A;  1NTK K;  2O3J A;  3WUU A;  3RBZ A;  1JMB A;  3AE2 C;  3GLM A;  1RE3 C;  1MFZ A;  2POH A;  3V5B A;  2JP3 A;  1NU1 E;  1Y9B A;  2PRR A;  3AEA C;  2FYN B;  2N9B A;  5DJU B;  2H43 B;  4C7R A;  3A0H H;  4IFD K;  2KS1 B;  3M0A A;  2ZT9 D;  3VTP C;  3AE4 C;  1N73 C;  1PP9 G;  1L0L G;  3G9R A;  4Y99 C;  2I1J A;  1USD A;  1XTG B;  1PGO A;  3V4Q A;  2JDI H;  1L4A B;  1SQQ D;  1PPJ E;  4RJT A;  2Z5H A;  1S1C X;  1FOS E;  2E5Y A;  3H1J G;  1PFI A;  4W7Y A;  4GOF A;  4C7N B;  1IFN A;  1JMM A;  4GKG A;  3O6Q B;  3L74 G;  3L72 G;  1USE A;  2J61 A;  5CCH C;  5KLV D;  1OXZ A;  3G3Z A;  2YMK A;  2W27 A;  1JY3 O;  3P8C E;  2PAJ A;  1U57 A;  2K9J B;  1ZOY C;  2I8D A;  1N86 A;  1LT9 A;  3NTN A;  4HYT B;  3SWF A;  3SWK A;  4NPD A;  1PGJ A;  1PV3 A;  3PH0 A;  1LTG C;  1GMJ A;  1OZH A;  4EPU A;  3L72 E;  1RE4 B;  2YO3 A;  2LR2 A;  2YIU C;  1LTJ B;  3Q1M A;  3KYQ A;  1L0N J;  1IFP A;  1KN7 A;  1SQV J;  3A3Y B;  2IFN A;  3HD7 B;  2FKW B;  1GL2 B;  4PD4 I;  3HE5 A;  5KJ7 A;  2HLO B;  2RMZ A;  2ZT9 B;  1N2D C;  1IK7 A;  2MJZ A;  2Q3I A;  4GDO A;  3CCQ P;  5AVU B;  2R3C A;  3VN0 A;  1FBM A;  3I56 P;  1NU1 D;  5KLV E;  1SFC A;  1H8A A;  2QRX A;  1L0L D;  5C39 A;  2J1G A;  1FS0 E;  1SFC C;  5AVX B;  1DD3 A;  4OH8 B;  1IJD B;  1YHQ P;  3P8C D;  1VQ6 P;  2D2C D;  1LTB C;  3L71 J;  4D6T D;  1JY2 O;  1M1K Q;  3CMA P;  2FXO A;  1SQP J;  2JHM F;  5M1B A;  1EXI A;  1S2E A;  2O01 J;  3CC7 P;  3LID A;  1VF5 B;  4Z1M H;  2QJK B;  1BCC E;  5AW4 B;  3RK2 D;  2LXC B;  2WT7 B;  2E5T A;  3AEB C;  2KZI A;  3MTU E;  1SQQ E;  1KQG B;  2ZYG A;  1JTH A;  1SQQ J;  3B5N A;  1SQX E;  3IAO A;  2J61 B;  2H43 A;  3B5N B;  3H1K E;  2WPQ A;  3FIB A;  1W2B O;  5APU A;  2QG4 A;  1EDI A;  4DCK A;  4N3Y B;  1QEX A;  2M3B A;  4U3F G;  2A45 I;  1FAV A;  2QIW A;  2H43 C;  1CZQ A;  1HF9 A;  1KB9 E;  3OA7 A;  1ZRT E;  3H6P A;  4HKZ H;  1W2E A;  1YYC A;  1JY3 N;  2C9L Y;  1L0N G;  4H0L C;  3LW5 H;  1MFT A;  2IYO A;  1NU1 K;  1N73 B;  1KYO E;  1ZP0 C;  1LT1 A;  1YIT P;  2WSC H;  2Y0E A;  1SP4 A;  2E74 C;  1QX8 A;  2K88 A;  1J1D C;  5DJT B;  2E75 C;  1KFN A;  1UII A;  1YTZ T;  5APV A;  2SPZ A;  3L71 E;  5KKZ B;  3B5N C;  2HPC A;  4L74 A;  3MUD A;  1JO5 A;  1NH4 A;  3MZW B;  3CCV P;  1FOS F;  1JM0 A;  4H0L B;  2IBZ G;  4PJ0 H;  3HTK A;  2J3F A;  4UB8 E;  1LTA C;  1NU1 G;  4H0L D;  2Q9I B;  1PP9 J;  3H1L J;  1BCC J;  4I7Z C;  2E74 B;  4ZMD A;  1HH0 A;  2XU6 A;  2R5B A;  2XND H;  1RY3 A;  4JYB A;  2Q7C A;  3PTZ A;  3PLN A;  1FZG C;  2G8Y A;  2BEZ F;  3CXH H;  3L71 D;  1W5C E;  1OW6 A;  3VOP A;  5KLV J;  3S9O A;  1FZC B;  5AVY B;  3M06 A;  2OTK E;  2E75 B;  1LP1 B;  1LJ2 A;  4H13 B;  1PIX A;  3QH9 A;  2FY8 A;  3AE1 C;  1AV1 A;  1XTC C;  5TIS E;  2OYO A;  4N6J A;  2M5A B;  3TGU E;  1URQ D;  2Q5U A;  1FJP A;  1U7M A;  1SQP E;  2N1T A;  2J3U A;  2ZT9 C;  2YMY A;  1NTZ D;  1KB9 D;  1SQB K;  2FBW C;  1SQB G;  1L2P A;  1U7J A;  5CCH A;  1HVV A;  3RK3 D;  3GF3 A;  3BVH B;  1VQK P;  2QJK C;  4ASW A;  3KPE A;  3ABV C;  1HJ0 A;  2FYU D;  1BGY J;  3R4Y A;  4JBZ A;  3A0B E;  3GF7 A;  3M9B A;  1NJI Q;  3CCS P;  5AVQ B;  1RF1 C;  2WMM A;  3CWB J;  4JYO X;  1ZRT D;  3CD6 P;  4WY4 D;  3E1R A;  1N86 C;  3H1J E;  4PV1 D;  2JWA A;  3EFG A;  2P10 A;  5AW1 B;  2AXC A;  2OYI C;  1S5L X;  1VQM P;  2JR8 A;  2HOD B;  1QVF O;  4U7J A;  3TNU B;  2WSC J;  2GM4 A;  2IPP A;  3L72 J;  3CWB G;  5AVR B;  1RE4 C;  2O1J A;  2NPS B;  1BDD A;  5B5E E;  3BVH A;  1VQP P;  2L5G B;  1AVY A;  1NTM J;  1AQ5 A;  1ZXG A;  1OMI A;  2J3F D;  1YIJ P;  5CJ0 A;  5KJ7 D;  4D6T E;  1NTZ E;  2J58 A;  3HD7 C;  1JY2 P;  1DEE G;  1X79 B;  1OFC X;  1S5L E;  4M7F A;  1SQX K;  5AVT B;  1DD4 A;  3L75 J;  2I1K A;  1KB9 H;  2FYU E;  3H1I G;  4KJM A;  2E76 B;  1KFM A;  1NTK D;  4WY4 B;  4WBA A;  3CC4 P;  2W6J H;  2JEE A;  1KIL C;  4H44 D;  4D6T G;  2ZJS E;  3N7N A;  4KT0 J;  1EZV E;  3TYY A;  1L0L J;  3VP9 A;  4OVN F;  2A45 G;  1KB9 I;  1NU1 J;  3RK2 C;  1RHZ B;  3S4R A;  1RF0 A;  1N8R Q;  2Q9I C;  4L75 A;  2P67 A;  1NTZ G;  1VQL P;  2GUV A;  3PHL A;  4U3F J;  3H32 B;  1EDK A;  2PGD A;  1N7S C;  1JNM A;  3AED C;  1IFD A;  2PFX A;  5TJH A;  2W6A A;  3L70 E;  4XA4 A;  1FDM A;  2XZR A;  4HJG H;  2IFM A;  5AW6 B;  1EDJ A;  3EQ2 A;  5KLI C;  2KNC A;  4WVZ A;  1NKN A;  1PZQ A;  1FZB C;  3GHG A;  3B4S A;  3O6Q A;  4UB6 H;  3B8E B;  5KKZ C;  3WMM 0;  1NTK E;  3L73 E;  5KLI B;  1KTM A;  2KYV A;  1L0L K;  2BCC E;  1VQ4 P;  1FZG B;  1DIP A;  3TGU J;  2WTY A;  4DJG A;  3TK1 A;  1VF5 C;  4IL6 X;  3Q3D A;  2NPS C;  5AW5 B;  1T2K D;  2ZXE B;  1N7L A;  1S9K D;  1RF1 A;  1KOR A;  1QL1 A;  2KNC B;  5TIS H;  1IFI A;  1BDC A;  3TGU D;  5GTH H;  4ZFG A;  3U1C A;  4W7Z A;  3TGU G;  2QJY C;  5CCG C;  5K5G B;  3VMX A;  1SFC D;  5BVZ A;  1GL2 A;  2C9N Y;  4UB6 E;  4GOE A;  3H32 A;  3WUV A;  1KIL E;  2B88 A;  1NAF A;  4IL6 H;  1KQS O;  5H2F H;  1TU3 F;  3RL0 g;  1EZV D;  4XFJ A;  2YNY A;  2ZYA A;  1Q81 Q;  1BE3 E;  1GZL A;  2YKP A;  3KXD A;  3A5T A;  2KB7 P;  3T97 A;  1FU1 A;  4C7N A;  1J1E B;  1JOC A;  2L91 A;  2KS1 A;  1VPC A;  2OYH B;  5AW3 B;  1FZA B;  1RH5 B;  1FZG A;  3I55 P;  3QWO C;  2R3S A;  2FXP A;  1LTS C;  2V4H A;  1T3J A;  1URQ B;  5AVZ B;  2QM8 A;  4JF7 A;  5CCH D;  2N9Y B;  1FZF A;  1YJN P;  3OAK A;  2B87 A;  2QSI A; 
#chains in the Genus database with same CATH homology
 1T8Z A;  1HWT C;  1AFO A;  1YTZ T;  2XV5 A;  5APS A;  5APV A;  1JUN A;  2JHH C;  1FJK A;  2FIB A;  3O8Z A;  1NHL A;  5AW7 B;  3E1I B;  1RF0 C;  2A45 H;  1LWU C;  5AW2 B;  2FFD B;  3B5N C;  2HPC A;  2HG5 D;  3MUD A;  3TSI A;  1NH4 A;  3BRV B;  5APQ A;  1JO5 A;  1FZE B;  1RE4 A;  1FOS F;  4Y99 B;  2FYZ A;  3HTK A;  1GL2 C;  4O9B A;  2YO2 A;  3R2P A;  1NO4 A;  2KP8 A;  2J3F A;  3HUS A;  1LTA C;  2J59 M;  1ZLL A;  1MV8 A;  1NTZ K;  4NYT A;  1GW3 A;  1KIL B;  2Q9I B;  1GTW A;  3NXS A;  3V2Q A;  3I5C A;  3M0D A;  1HTL C;  3II6 A;  1L4A D;  3V2R A;  2IX7 C;  2JHK F;  1N7S B;  1HH0 A;  5APY A;  2XU6 A;  2R5B A;  2WNP F;  5CJ4 A;  4B86 A;  1RY3 A;  2FYU K;  5BU5 A;  4WY4 A;  4JYB A;  4IFM A;  2H7H A;  2Q7C A;  1S9K E;  1CI6 B;  2WSF H;  1RF0 B;  1RF1 B;  1LTI C;  5AW0 B;  2OYH A;  1FZG C;  1JY3 P;  1HBW A;  3N4X A;  1DEB A;  2JHI F;  2HLO A;  2GUS A;  1H89 A;  2C0W A;  1FID A;  3RK3 C;  4IFF A;  3B5N D;  2FFD C;  1IK9 A;  3VOP A;  4DZO A;  1URQ A;  1Z56 A;  1J1E C;  3UIA A;  1IC2 A;  4AYC A;  2HOD A;  2R5D A;  3KDP B;  2E43 A;  1FZE A;  1E5W A;  2Z5I A;  1FZC B;  5AVY B;  1ZN5 A;  2WT7 A;  3VYI A;  3M06 A;  3VMZ A;  2Q9I A;  1G2C A;  3M91 A;  1SQQ K;  2W6B A;  1MZ9 A;  4HH2 A;  4LC1 A;  1FZC C;  1XTC C;  3P7K A;  4EOT A;  1FIC A;  1IFJ A;  1L4A C;  3GHG C;  4N6J A;  2KLV A;  4KHX A;  1URQ D;  2WWW A;  2NPS D;  2Q5U A;  4JYC A;  1FZB B;  1T2K C;  1FJP A;  3C9I A;  3H32 C;  2Z4E B;  2N1T A;  1LTT C;  2J3U A;  2JJL A;  3IFM A;  1X9V A;  1KIL D;  1KZU B;  2YMY A;  1QL2 A;  2WSE H;  1KIL A;  1G2C B;  1J2J B;  1SQB K;  3HUS B;  3HE5 B;  5AVV B;  5CCH A;  3MIW A;  2FXM A;  1HVV A;  3OJA B;  2O01 H;  2XDJ A;  4WB4 A;  3RK3 D;  3BVH B;  1GD2 E;  4LGD E;  3L4F A;  3KPE A;  3P8M C;  2HPC B;  3VP8 A;  1DX7 A;  5KLV K;  1NTK K;  3M9B A;  5KJ7 C;  3HUS C;  2JHL F;  2J64 A;  5AVQ B;  1RF1 C;  1RE3 C;  1WT6 A;  1MFZ A;  2POH A;  3V5B A;  4JYO X;  4WY4 D;  3RL0 B;  2OYI B;  1N86 C;  2N9B A;  2HPC C;  3CI9 A;  3EFG A;  3HE4 B;  2H43 B;  2GY7 A;  4C7R A;  3RK3 B;  5AW1 B;  1N7S A;  4IFD K;  2OYI C;  1N86 B;  3P32 A;  3M0A A;  3RL0 C;  1JCD A;  3M0D C;  3VTP C;  1Z3U A;  1NWQ A;  1LWU B;  2HOD B;  1Z3S A;  1N73 C;  3L35 A;  1CI6 A;  3TNU B;  1CW5 A;  4XE5 B;  2GM4 A;  2IPP A;  2KOG A;  4Y99 C;  2I1J A;  3KQG A;  1XTG B;  4I2L C;  3M9Q A;  5AVR B;  1RE4 C;  2O1J A;  4I6M C;  2NPS B;  1GW4 A;  1ZV8 A;  4N78 D;  3V4Q A;  1ZR4 A;  1YTZ I;  3BVH A;  4W80 A;  1L4A B;  2ZFC A;  2L5G B;  1KQL A;  2WZ7 A;  3A7O A;  3V2P A;  3M9H A;  1AQ5 A;  2Z5H A;  3HD7 A;  2J3F D;  1G1J A;  2N1T B;  5CJ0 A;  5KJ7 D;  5BU8 B;  4AUW A;  2J58 A;  3HD7 C;  1FOS E;  1JY2 P;  1JY2 N;  1X79 B;  1PFI A;  2R32 A;  4W7Y A;  4C7N B;  1MUU A;  1IFN A;  4M7F A;  3NFQ A;  1JMM A;  4GKG A;  3BVH C;  5AW9 B;  1T3U A;  1SQX K;  5AVT B;  3HRN A;  2I1K A;  2HYN A;  2J61 A;  5CCH C;  2Z4E A;  1KFM A;  4WY4 B;  1LT9 B;  4WBA A;  1WRG A;  2JEE A;  1KIL C;  1OXZ A;  3U1A A;  1H88 A;  4M7H A;  1JC9 A;  2XNX C;  3G3Z A;  1ZR2 A;  2J2P A;  2W27 A;  1SVF A;  1JY3 O;  2C0X A;  3N7N A;  2NPS A;  1IO4 A;  3BRT B;  3P8C E;  3TYY A;  3VP9 A;  2KSJ A;  1NOH A;  2A45 G;  2PAJ A;  1CSB A;  4GIF A;  1DH3 A;  3RK2 C;  1N86 A;  1GDT A;  1HUC A;  1LT9 A;  1RF0 A;  3NTN A;  1FZA A;  1RE3 A;  2Q9I C;  3L36 A;  3V4W A;  1GL2 D;  2P67 A;  4ZKU A;  4HYT B;  3HD7 D;  2PP6 A;  3SWF A;  1RE3 B;  2J0G A;  2GUV A;  3SWY A;  2Z4E C;  3H32 B;  2OYI A;  1LTG C;  1N7S C;  1JNM A;  4N78 E;  1IFD A;  5AVW B;  1FZB A;  4EPU A;  1RE4 B;  2YO3 A;  3BAT A;  1IFM A;  1LTJ B;  1SQP K;  2E42 A;  2W6A A;  3KYQ A;  2J0Y A;  4XA4 A;  3A3Y B;  1FDM A;  2IFN A;  3HD7 B;  2FKW B;  1GL2 B;  4M3L A;  2XZR A;  3HE5 A;  2IFM A;  5AW6 B;  5KJ7 A;  2N1T C;  3EQ2 A;  1X8Y A;  2HLO B;  2QM7 A;  1J1D B;  1N2D C;  2J5Z A;  2MJZ A;  1NKN A;  2YKO A;  1FZB C;  2YKQ A;  3GHG A;  1GK4 A;  5APX A;  1M1J B;  2H8P D;  2Q3I A;  5AVU B;  3LIE A;  3B8E B;  2HFE D;  1M1J A;  2R3C A;  3VN0 A;  3WMM 0;  1FBM A;  5CCG D;  1SFC A;  1H8A A;  2WIT A;  1A02 F;  2XNX B;  2KYV A;  1SLQ A;  1L0L K;  4R9J A;  2J1G A;  1SFC C;  5AVX B;  5KTB A;  4OH8 B;  1FZG B;  1HGZ A;  1FZE C;  2HOD C;  2WTY A;  1IJD B;  3P8C D;  3GHG B;  1URQ C;  1LTB C;  4RES B;  1N7S D;  3TK1 A;  2J60 A;  1OWA A;  4AQR D;  1JY2 O;  2NPS C;  1LWU A;  5AW5 B;  1T2K D;  2ZXE B;  1N7L A;  1S9K D;  2OAR A;  3V2N A;  3CLQ A;  2JHM F;  1RF1 A;  2OYH C;  2N1T D;  5AW8 B;  1L0N K;  2CPB A;  5CCG A;  1JTH B;  1EQ7 A;  4LLH A;  3E1I A;  2BAS A;  3LID A;  1JCC A;  1QL1 A;  1M1J C;  3A2A A;  1IFI A;  2CPS A;  4ZFG A;  1LTJ A;  3PP5 A;  3U1C A;  2P1J A;  4W7Z A;  2J0H A;  3MGN A;  5CMZ A;  5AW4 B;  3RK2 D;  5CCG C;  2WT7 B;  1FIB A;  3MTU E;  1GU5 A;  3TNU A;  1NTM K;  3VMX A;  1A02 J;  1SFC D;  5BVZ A;  1GL2 A;  2P7J A;  2WPS A;  2C9N Y;  2O1K A;  3L37 A;  4R9T A;  2XKM A;  2WPR A;  4WY4 C;  3H32 A;  1JTH A;  4EIJ A;  1VDF A;  3B5N A;  1NAF A;  3MD0 A;  4DOJ A;  2J61 B;  3HE4 A;  2H43 A;  1L4A A;  3B5N B;  3NMD A;  1NKZ B;  2J3G A;  2WPQ A;  2D39 A;  3FIB A;  5APU A;  1FZC A;  3RL0 D;  3CL3 D;  3HTK B;  4N3Y B;  1LGH B;  1GK6 A;  4GT1 A;  1G1I A;  2XNX A;  2M3B A;  1FZD A;  1SFC B;  5APW A;  1M7L A;  1N73 A;  3BAS A;  2YNY A;  5AVS B;  2A45 I;  1HGV A;  1FZA C;  1FAV A;  3RK2 B;  1LT9 C;  1GZL A;  2YKP A;  2LKM A;  2H43 C;  3A5T A;  1CZQ A;  2KB7 P;  3T97 A;  1FU1 A;  3OA7 A;  4C7N A;  1J1E B;  2FFD A;  2P2U A;  1FZF B;  1JOC A;  3H6P A;  2M8R A;  1W2E A;  3VMY A;  4I1L A;  1VPC A;  2HLO C;  2OYH B;  5AW3 B;  4ZKP A;  1YYC A;  1JY3 N;  2C9L Y;  1FZA B;  3IR9 A;  3LW5 H;  1FZG A;  1N73 B;  1NU1 K;  1LTS C;  5CHX A;  1T3J A;  1LTJ C;  1FZF C;  1URQ B;  2WSC H;  4C46 A;  5AVZ B;  1SP4 A;  2QM8 A;  2J3O A;  4JF7 A;  5CCH D;  1SQV K;  4JZC A;  2VRS A;  1HJB A;  1FZF A;  1GU4 A;  3OAK A;  5APT A;  3E1I C;  1J1D C;  3U59 A;  1KFN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...