3H32B

Crystal structure of d-dimer from human fibrin complexed with gly-his-arg-pro-tyr-amide
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
308
structure length
308
Chain Sequence
LYIDETVNSNIPTNLRVLRSILENLRSKIQKLESDVSAQMEYCRTPCTVSCNIPVVSGKECEEIIRKGGETSEMYLIQPDSSVKPYRVYCDMNTENGGWTVIQNRQDGSVDFGRKWDPYKQGFGNVATNTDGKNYCGLPGEYWLGNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGGFTVQNEANKYQISVNKYRGTAGNALMDGASQLMGENRTMTIHNGMFFSTYDRDNDGWLTSDPRKQCSKEDGGGWWYNRCHAANPNGRYYWGGQYTWDMAKHGTDDGVVWMNWKGSWYSMRKMSMKIRPFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Blood clotting
molecule keywords Fibrinogen alpha chain
publication title Two families of synthetic peptides that enhance fibrin turbidity and delay fibrinolysis by different mechanisms.
pubmed doi rcsb
total genus 74
structure length 308
sequence length 308
chains with identical sequence E
ec nomenclature
pdb deposition date 2009-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
B PF08702 Fib_alpha Fibrinogen alpha/beta chain family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3h32B01
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 3h32B02
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 3h32B03
2FIBA 3E1IB 1JY2O 2JHMF 3E1IA 1LWUB 1FIBA 1FZEB 2J60A 1JY3N 3BVHB 1RE3C 1M1JA 2OYIA 1N73B 1FZBB 1FZDA 4EPUA 1JY2P 1FZGB 1FICA 2WNPF 1FZEA 2OYHC 2J61A 2HODA 2D39A 2J3GA 2HPCB 3H32B 2H43B 2Z4EA 1FZFC 1LWUC 1RE3A 3BVHC 1FZBC 1N73C 1RE4C 1FZGC 2J0HA 2OYHA 1FZFB 1FZAB 2Q9IC 2XNXC 1RF1B 2JHIF 2J64A 2FFDC 2HPCC 1FZFA 3H32C 2H43C 3GHGC 1RE4B 2J1GA 4M7HA 1LWUA 3BVHA 2Q9IB 1FZBA 1N73A 2XNXB 4ZFGA 1FZGA 1JY2N 2FFDB 2HLOC 2Q9IA 3GHGB 1RF0C 1FZAC 1LT9C 4R9TA 1RF1C 2FFDA 2H43A 2HPCA 1JY3P 3H32A 3GHGA 4M7FA 2GY7A 1N86C 4NYTA 2HLOB 4JZCA 2J2PA 1RF0B 1LT9B 2A45H 2HLOA 1RF0A 1FZAA 1LT9A 1N86B 2J3FA 1RF1A 4R9JA 1LTJB 3HUSB 2A45G 1FIDA 1N86A 2OYIC 1RE4A 2J3OA 1JY3O 3FIBA 2XNXA 2J0GA 2A45I 1M1JB 2OYIB 1Z3UA 2Z4EC 2JHHC 1LTJC 1FZCC 3HUSC 2J3FD 2J61B 2J0YA 1T3UA 2HODB 4JYOX 2J3UA 1JC9A 2Z4EB 1W2EA 3E1IC 1FZCB 1RE3B 1M1JC 2JHKF 2JHLF 1LTJA 1FZCA 3HUSA 2J5ZA 2OYHB 1FZEC 1Z3SA 2HODC
chains in the Genus database with same CATH superfamily
4LGDE 3E1IB 2NPSD 3MD0A 1S9KD 2B9BA 2Z5IA 3SFDC 2M3EA 1NTKJ 2AEJA 4M3LA 1SLQA 2A06E 4W7ZA 2XZRA 3FWNA 3D71A 1BGYG 1KB9E 1NOHA 2OQQA 1S2EA 3H32B 3H1LJ 3AE5C 4DCKA 1URQA 5M1BA 1OW7A 1J2JB 3LW5H 3SSUA 1JNMA 3WU2H 2N1TC 3KXDA 2IBZD 5AW1B 4PD4E 2Q9IA 3GHGB 3JC22 1FZAC 3H1IG 2IZ1A 1RF1C 2K3RA 1CSBA 3C9IA 1L0LK 3P8CE 5CJ4A 2HLOB 4Y28J 1VF5D 2NPSA 1MV8A 1HGVA 2QJPC 1VDFA 1GL2C 5KLVG 3TGUJ 4U3FJ 2O01H 1FIDA 1RE4A 3NXSA 1T8ZA 5KAFH 5KAIH 1SQXE 4WY4C 5GTIE 2A45I 4PJ0E 1BCCJ 3CWBJ 3H25A 3L74G 3B5ND 3CC4P 3CMEP 1P84E 3TDKA 3A0BE 1GW3A 1JMBA 2YO2A 3F5HA 3PHLA 1FIBA 1QL2A 1ZXGA 5E79H 2MKVA 4IL6E 3H1ID 2V4HA 4EI2A 1FZFC 5TISE 3V2QA 1FJPA 3L75G 3P32A 2J0HA 4DOJA 2HPCC 1NTMK 1USEA 2FY8A 4BWNA 3L70E 1SQPJ 2POHA 2H43A 3CX5I 2FYUD 1KTMA 1AVOA 5B66H 3JCUH 4KT0J 1LT9A 5GTHH 5CHXA 1E79H 1YHQP 3FXEA 1VQPP 1EDIA 2UWJE 5DJUB 3G3ZA 1KILA 2ZAEB 2HG5D 3H1JG 4N78D 2I8DA 2YIUC 2FYZA 2LXBA 1DEBA 3H1HJ 1IFDA 4W80A 1VQ6P 1L0NE 1W2EA 2QE7H 2KNCA 1T3JA 1H8AA 3L75D 2J5ZA 4UB6H 3TGUG 3PJSK 4DZOA 1S4XA 1SQVG 2W90A 1VQOP 1KZUB 3L37A 1X8YA 1LGHB 3KHUA 1FDIA 1JY2O 2JHMF 3E1IA 1URQC 4NPFX 1KN7A 1NTKD 4JBZA 3EFGA 4DJGA 2C9LY 2J61A 3GF3A 1BCCG 4NPDA 3TSIA 1QLED 2ITAA 2OARA 3E1RA 1EDKA 2GUVA 2Q9IC 1NAYA 3G4SP 4YXDC 2W8ZA 3BVHA 2QJYB 2XNXB 2NPSC 3HE5B 2WPVB 4JPZB 2ZYAA 3GHGA 1RHZB 1JM0A 1KQGB 1SQBK 2A45H 4A7PA 2HLOA 1ZW0A 1G1JA 3TYYA 2A45G 3SWYA 3TGUD 4U3FD 1T2KC 2LKMA 2R5BA 1L0LG 3VN0A 4H44B 1RH5B 2YMYA 2Z4EC 4RO0A 3ABVC 2ZYDA 1S9KE 4EIJA 3R2PA 4D6TE 2KZJA 2B87B 1BCCD 1OVRA 1DD3A 3CWBD 1M57D 5KLIB 5CCGD 3L73E 4IL6X 5AVTB 1VF5C 3VMYA 1Z3SA 5APYA 1A02F 2MJZA 2WWWA 1NTZJ 5KJ7D 1BDCA 2IBZI 2FYNC 2OTLP 1M1JA 1VPCA 1JY2P 1MFTA 4YXWH 2R44A 1PPJG 1NKZB 3BRVB 2KOGA 3CCQP 1X0TA 3H1HG 1FOSE 2QVAA 1PZQA 4BRYB 1USDA 3L71G 1JTHA 3NTNA 1M56D 2O3JA 3H6PA 2YXQB 3CX5H 1X9VA 1SFCB 2H43C 1EZVD 4H13B 1YIJP 4ZFGA 1LT9C 1GW4A 5CCGA 3AE1C 3AE4C 4GOFA 1SQPD 3VMXA 4XE5B 4CPGA 5KJ7A 1ZMEC 1BGYE 1KILC 2ZXXA 4NPEA 4JYCA 1EC5A 1FS0E 1OIPA 1GZLA 3RK2B 1NVOA 1PP9E 2KIKA 2OYIB 2Q3IA 3KZIH 1M1KQ 3N4XA 4JYOX 3C8VA 2KP8A 2FYUK 4R4MA 3E1IC 1L4AD 3H1HD 5AVZB 3RL0B 3GW6A 1JUNA 3H1IE 3L71D 1M7LA 2OYHB 3R4YA 4EYYQ 2H8PD 1KILE 1IFIA 1K8AQ 3T97B 2QM7A 5CBOA 3QWOC 1ZRTD 3CX5D 5KLVE 1LTSC 5AW2B 3M0DA 2D39A 3D70A 1OFCX 2NRGA 4H44D 3BVHC 3HD7A 5KAFE 1BE3G 4Y99B 1Q81Q 1AA0A 2YKQA 3GHGC 3OJAB 2Q7CA 4M7HA 3L74E 1QVFO 1PP9J 1Q7YQ 4DT0A 4N3YB 3V2RA 2HLOC 3Q2YA 2FBWC 3H1KG 1NTKK 3P8MC 3ZDMA 3L72J 2HR3A 3HE5A 1CZQA 3TK1A 3FX0A 3A7OA 4N78E 1RF0B 5KTBA 4PV1B 2OGUA 3SWKA 5E79E 3A5TA 2O01N 2ZVNB 1MZ9A 1VQKP 3L75E 1ZN5A 3V5BA 1SQBG 5K5GB 2GM4A 1AVYA 2J3FD 2WPSA 2FXMA 5AVYB 1SFCD 1H88A 1JCCA 2B87A 4H13D 1NU1E 1JOCA 1ZP0C 2E5YA 1M1JC 2IBZG 3GG2A 1GU5A 1ZV8A 4I6MC 2CPSA 2KYVA 2KSEA 1NTZD 4IOIH 1SVFA 1PGQA 3GLMA 3V4WA 1WMKA 1MUUA 1EDJA 3A3YB 2PGDA 2AEMA 5GTHE 3H1KD 1VQ9P 3CXHH 3V2PA 1MFZA 2D2CC 3RK2D 3USSA 2P67A 3H1JE 4I2LC 4BRYA 1UIXA 5CCGC 2E76B 4XA4A 1DD4A 1NJIQ 4HJGH 2OYOA 2KS1A 3BATA 2IZ0A 1ZOYC 1YJNP 3CPWO 1SFCA 1SQQJ 3RL0D 1FZGA 2CK3H 5KJ7C 1SQBD 2E74C 4OWFA 1SQVE 1MKMA 2Y9ZA 2BCCJ 2WMMA 4UB6E 3AEAC 2KI7B 4JZCA 2J2PA 5BU8B 1CI6B 1T6AA 4C7NA 1VQ4P 1UIIA 3CCVP 2R5DA 1N86B 5AW6B 1K05A 2W83C 3C1LA 1HVVA 3WMM0 3N7NA 1KFMA 1LTAC 2JHHC 5APUA 2JR8A 2JWDA 1OZHA 1TU3F 1N2DC 2M5AB 5BU5A 2KUBA 1S5LE 3I56P 1H0TB 2PFXA 2JEEA 1S72P 1OVUA 1N7SB 1SQPK 3NMDA 1BSHA 1RE3B 3B8EB 3CXHD 3CC2P 3M0DC 2Q6QA 1LP1A 2IFNA 1EZVI 5H2FH 1AJYA 1HBWA 2FYUG 2H88C 3T97A 2L5GB 3HD7C 2BASA 1N73B 1FZBB 4EPUA 4PV1D 2JKVA 1K73Q 3HE4A 2WITA 1L0LE 2Z4EA 5APWA 3AE7C 4OGQB 4OVNF 2ZFCA 5APXA 2QJYC 2XNXC 2WSCH 1HH0A 3TNUB 3F89A 1LWUA 3K5BA 3U1CA 1BSNA 2HYNA 2W6BA 1YBKA 2I1KA 4R9TA 1HTLC 2WT7A 1OW6A 4M7FA 3U59A 1GU4A 1EXIA 3BCCE 3L72D 1RF0A 4JF7A 2QEXP 1IFPA 1PPJE 2Q1KA 1LTJB 1SQXJ 5C39A 3HUSB 1NTKG 3W68A 1HJ0A 2KK7A 3L71E 3B5NA 4ZKPA 1ZR2A 5KKZC 2BEZF 3H1LG 4UB8H 2HODB 2E76D 1GDTA 2AXCA 4H0LD 1RQVA 1AQ5A 3CCRP 1NTME 1FZEB 3M9BA 2HFED 1IK9A 1KYOH 4QMAA 3MTUE 1DX7A 2N1TB 2R32A 2J5UA 2Q3EA 2W27A 1SFCC 4U3FG 1FZGC 4OH8B 1LTIC 2C0XA 2QM8A 4H13C 1FZAB 3WUUA 2PAJA 1RF1B 1U7MA 1IK7A 3MUDA 5B5EH 1N7SD 3L70J 3CWBG 1K9MQ 2QJPB 1NTZK 1SQQD 5CCHD 1Q90D 2WSFJ 3H32A 3H1LD 3RK3C 2BCCD 1KD1Q 4WY4B 3CL3D 1CI6A 3KQGA 4XFJA 1GMJA 5AW7B 1SS1A 1S5LX 3O6QB 1YJ9P 1N86A 1X79B 1L4AB 2OYIC 1YJWP 5BVZA 1OX3A 4OGQD 1G2CB 3GMAA 1J1DC 1BE3E 3VP9A 1NO4A 1L0NJ 3EFFK 2J3UA 4RESB 2XDJA 3S4RA 1KYOD 3RK3E 1EZVG 4WB4A 4O9BA 5GTIH 2O1JA 2JHLF 2ZT9B 3BRTB 2Y9YA 4GKGA 4PJ0H 2M8RA 3L36A 3QH9A 1PL5A 2A06D 3VTPC 1HUCA 1SQPG 3AE9C 4EDFA 3AECC 1P84H 4AUWA 3S9OA 3MHVA 3A0BH 1S3JA 3VYIA 3PTZA 2HPCB 1QX8A 4Y99C 1YQ3C 3SFEC 1LWUC 1SQBE 5APTA 3HTKB 1G1IA 2KLVA 1H89A 4IL6H 2JHIF 1IC2A 1RY3A 2J58A 3SWFA 2WVRA 1Y47A 3V4QA 5AVXB 2J59M 3E7KA 4B86A 2IBZE 2FFDB 1RF0C 1KV4A 1WT6A 3P8CD 3AE3C 4NYTA 1SP4A 3AEGC 2WSEJ 3CCUP 1JB0J 4N6JA 3B5NC 1FOSF 4R4LA 3CXHI 2K88A 3MIWA 3B4SA 1IJDB 2N1TD 4W7YA 1ZLLA 5EFWB 4L73A 3Q5RA 3FIBA 1LT1A 3L70G 2WSSH 2J0GA 4D6TJ 3VMAA 3RBZA 4HYTB 1A02J 3AEDC 3II6A 3L73J 3GF7A 2WPQA 1FBMA 1RQUA 1P84D 2OTJP 5AW5B 3PRJA 2C9NY 1J1EB 1LTGC 2DW3A 3A0HH 2P2UA 4WY4D 4ASWA 3WU2E 1FZEA 4WVZA 3MUDC 2Z5HA 1VQ8P 3PLNA 2XV5A 2G3AA 3H32C 1RE4B 2W6JH 4EOTA 1NHLA 3ITKA 1U57A 3L70D 2ZT9D 2QRXA 1JY3P 2LXCB 2GY7A 1N86C 3I5CA 5KAIE 1BGYJ 5TJHA 2FYUE 2NZ2A 1NYHA 2K37A 2YKOA 2ZYGA 3AEEC 2JP3A 3U1AA 1NTZG 4LLHA 4L76A 3PH0A 4C46A 1L4AA 2P10A 2XNXA 2GUSA 1G2CA 2IYOA 1FC2C 1SQQK 2J0YA 4TT3H 1L0ND 3H1IJ 2C0WA 3M9HA 2E42A 2E75B 1QL1A 3CD6P 3VP8A 5KLVJ 1FJKA 2J60A 1JY3N 3JSVC 3OW2O 1NTKE 1HGZA 2K9YA 2KB7P 3L73G 2H43B 1N8RQ 2RN0A 2N9BA 2B89A 3CLQA 3L74J 3AE8C 3FGAD 2J64A 2L91A 5B66E 3JCUE 2J1GA 4IFMA 1QVGO 4GODA 3M91A 1R8EA 1KILB 5AVQB 2FFDA 3D6ZA 4KHXA 1KYOI 2H89C 2KNCB 3KDPB 2J3FA 3L75J 3CCLP 2KSJA 3TGUE 4U3FE 1FU1A 3G9RA 4H0LB 1W5CE 4I7ZB 1R5LA 1KB9I 4D6TD 3RGUA 3HRNA 1AQTA 1NU1J 2J61B 4K35A 3L73D 1BCCE 5B5EE 3CWBE 1JO5A 1OXZA 1FZEC 2LR2A 1PP9G 3VOPA 1T2KD 2IYPA 1IO4A 2AXTH 1SQXK 2XU6A 4PD4I 3CCSP 3BVHB 1D7MA 2OYIA 3L72G 1ZR4A 1PIXA 3LIEA 4KJMA 2YKPA 2V7QJ 1R5SA 3H1JJ 2WQYC 4WWIA 1LJ2A 2Y0CA 1FDOA 4GOEA 2OYHA 1XTGB 4Z1MH 3AE2C 1PV3A 4ASVA 1QGKB 3AE6C 1EZVE 1SQVJ 2YXRB 5AVRB 1S1CX 1NGMB 2E75D 1KMIZ 3M06A 3MP7B 1EDLA 5AVSB 2KXPB 2KZIA 5AW4B 1HJBA 1SQPE 3RBXA 1L4AC 1BGYD 1P84I 1BDDA 1JEKA 2IPPA 2J3OA 1EQ7A 2YO3A 1PP9D 4ZKUA 1KQFB 1M1JB 2QJKB 2M3BA 1HWTC 2ZT9C 1W2BO 4H44C 2G8YA 1FZCB 4RKUJ 1FAVA 1YTZI 3H1HE 1LTTC 1KILD 1JTHB 1M90Q 2PRRA 1JMMA 1SQQG 4L75A 3TF5A 2D2CB 5KLVD 1QEXA 5KLIC 1L0LJ 2BCCG 1PGOA 1IFMA 1YYCA 1OWAA 2WNPF 1ZRTE 1X22A 3CX5E 1CW5A 1N7LA 1EXJA 1NU1G 2RKLA 1GK6A 2IX7C 1Y8AA 2QG4A 1L0NK 3UIAA 1IFJA 2E74B 2FFDC 3W67A 3L74D 1NH4A 1DIPA 1KFNA 4HB1A 2V7QH 3BCCJ 4HH2A 2CPBA 2KLUA 2QIWA 4GDOA 3CMAP 1FE6A 1VL2A 4U7JA 1VQLP 3A0HE 1KB9H 1M8OB 2A06G 3KZIE 1AV1A 4IFDK 3L71J 1LNQA 3L4FA 1GL2B 1NAFA 3CCMP 1Q2NA 3RL0g 2FKWB 2SPZA 1VQ7P 2W6AA 5AVWB 1NU1D 1J1EC 1JC9A 1HF9A 3RK2C 4PD4H 2WZ7A 3WUTA 2O1KA 1KORA 3HD7B 2I1JA 1NTMJ 2AEFA 1YI2P 2JDIH 3O8ZA 2ZXEB 2FIBA 2QSIA 1S5LH 3FXDA 3LIDA 3RL0C 1NWQA 5L8RJ 2R3SA 1DH3A 5AW0B 3Q1MA 1NTZE 1VQ5P 2OYHC 3EQ2A 2FXOA 3B71A 2M5AA 2K9JB 1H0TA 1N7SA 3AEBC 3H1KE 1U7JA 3H1JD 1RE3A 1SQXG 1RE4C 5CJ0A 3S1KA 5CCHA 1FZFB 2IFMA 2WPRA 3KYQA 2BEQD 2JJLA 3L35A 1KB9D 4ZMDA 2R3CA 3IN6A 1FZBA 1N73A 1SQVD 4RJTA 2XNDH 2Y0DA 1GD2E 2E5TA 2QA4P 2B88A 4I1LA 4MN4C 1Q86Q 2D2CD 2H7HA 3G71P 2ZVOB 1OMIA 5KKZB 2E43A 3EWKA 4PD4D 1BE3J 4BXLA 3M9QA 3TNUA 5TISH 1JY3O 4PV1C 3IAOA 3Q3DA 3BCCG 2YNYA 2P58A 2E74D 5DJTB 3CCEP 4GT1A 1PGJA 1T3UA 2E75C 4LC1A 3H1KJ 2YIUB 2JWAA 3MZWB 1SQXD 1LTJA 1FZCA 3HUSA 3Q5PA 3CXHE 1IFNA 1IZNB 4WBAA 2WSFH 2KS1B 2RMZA 1OW8A 1FZDA 1FZGB 1FICA 2HODA 1L0LD 1SQBJ 1URQB 2PP6A 1KQLA 1GL2D 4C7NB 3NFQA 1NTMG 2WTYA 3G6EP 3RK3B 4YTPC 1Y9BA 3V6IA 2Q9IB 5AVUB 3AEFC 1L0NG 1JY2N 3HD7D 5KLVK 5APSA 3OA7A 2M0BA 1Z56A 3BCCD 2N1TA 2E76C 2NPSB 3V2NA 2N9YB 2RH0A 4IFFA 3OAKA 3L72E 1YQ4C 1J1DB 2AXTE 1PPJD 3A2AA 1FZAA 1YITP 3D6YA 5AVVB 1RF1A 1AFOA 4H0LC 4I7ZC 1LP1B 3WUVA 2ZJSE 1YTZT 1GTWA 1GL2A 1Z3UA 5AW8B 1OVVA 3HE4B 1FDMA 5H2FE 2Z4EB 3PP5A 4WY4A 1NKNA 3IF4A 1XTCC 3IFMA 3P7KA 2JHKF 2XKMA 1E5WA 3I55P 1WRGA 3O6QA 3LW5J 5CMZA 1NTMD 5APVA 5AW3B 1L2PA 3Q5SA 1N7SC 1VF5B 1LWUB 1RE3C 2WSEH 3FWLA 5CCHC 2FYNB 2J3GA 3IR9A 2WT7B 5APQA 3CC7P 2K9JA 3BASA 4AQRD 1NU1K 3KPEA 1FZBC 1N73C 2JO1A 2FXPA 1K04A 3M0AA 1DEEG 1FZFA 4D6TG 2O01J 1KQSO 4OGQC 2OTKE 4C7RA 3B5NB 4L74A 1KC8Q 4YPCA 2FYUJ 3MGNA 2IDBA 1SQQE 1LTBC 1Q82Q 2HPCA 4ZNCA 2GA1A 2YMKA 3H1LE 1JCDA 1LT9B 3HTKA 3CCJP 4HKZH 2BCCE 4UB8E 2P7JA 4R9JA 5AW9B 1URQD 2K1AA 2QJKC 1BE3D 5CBNA 1VQMP 4K3AA 4GIFA 2WSCJ 1LTJC 1SQVK 1FZCC 3HUSC 1PFIA 3CI9A 4AYCA 4JQ0D 3RK3D 1VQNP 1GK4A 2Y0EA 1KYOE 2VRSA 1PGPA 2Q5UA 3VMZA 4TLFA 2P1JA 2HODC 4JYBA
chains in the Genus database with same CATH topology
4LGDE 3E1IB 3L36A 2NPSD 3MD0A 1S9KD 2QM7A 2Z5IA 3VTPC 1HUCA 4M3LA 1SLQA 1LTSC 4W7ZA 1IFMA 1YYCA 1OWAA 2XZRA 5AW2B 2WNPF 3M0DA 1CW5A 1N7LA 4AUWA 1NOHA 2D39A 1GK6A 2IX7C 3VYIA 3H32B 2HPCB 1URQA 1L0NK 4Y99C 1LWUC 3BVHC 5APTA 3HD7A 3HTKB 3UIAA 1J2JB 1IFJA 3LW5H 1JNMA 1G1IA 2KLVA 1H89A 4Y99B 2JHIF 2FFDC 1IC2A 1RY3A 2YKQA 2N1TC 2J58A 3GHGC 3SWFA 1NH4A 3OJAB 2Q7CA 4M7HA 3V4QA 5AW1B 1KFNA 5AVXB 2J59M 4B86A 4N3YB 2FFDB 3V2RA 2HLOC 2Q9IA 3GHGB 1RF0C 1FZAC 1NTKK 3P8MC 4HH2A 1RF1C 1WT6A 3P8CD 1CSBA 2CPBA 3C9IA 3HE5A 1L0LK 4NYTA 3P8CE 1CZQA 1SP4A 5CJ4A 2HLOB 3TK1A 4N78E 3A7OA 1RF0B 5KTBA 2NPSA 1MV8A 4N6JA 1HGVA 3B5NC 1FOSF 1VDFA 1GL2C 3MIWA 4IFDK 2O01H 1FIDA 3A5TA 1IJDB 1RE4A 2N1TD 4W7YA 1ZLLA 3NXSA 3L4FA 1T8ZA 3FIBA 1MZ9A 1GL2B 2J0GA 4WY4C 1NAFA 1ZN5A 2A45I 3V5BA 2FKWB 2GM4A 4HYTB 2J3FD 2WPSA 2FXMA 5AVYB 1A02J 3II6A 2W6AA 1SFCD 5AVWB 1JC9A 1J1EC 1H88A 1JCCA 2WPQA 3RK2C 1FBMA 2WZ7A 1JOCA 2O1KA 3HD7B 3B5ND 2I1JA 1M1JC 5AW5B 2C9NY 1J1EB 3O8ZA 2ZXEB 1GU5A 1ZV8A 1LTGC 1GW3A 2FIBA 4I6MC 2YO2A 2CPSA 2KYVA 3LIDA 2P2UA 4WY4D 1FIBA 3RL0C 1NWQA 1QL2A 1SVFA 1DH3A 5AW0B 3V4WA 1FZEA 1MUUA 2OYHC 3A3YB 3EQ2A 3V2PA 1MFZA 1FZFC 1N7SA 3RK2D 1RE3A 2P67A 3V2QA 1FJPA 1RE4C 2Z5HA 3P32A 5CJ0A 5CCHA 2J0HA 1FZFB 2IFMA 2WPRA 4I2LC 2XV5A 5CCGC 3KYQA 4XA4A 4DOJA 3H32C 2HPCC 2JJLA 1RE4B 1NTMK 3BATA 3L35A 2R3CA 4EOTA 1SFCA 1NHLA 1FZBA 1N73A 3RL0D 1FZGA 5KJ7C 1GD2E 2POHA 4I1LA 1JY3P 2H43A 2GY7A 1N86C 3I5CA 4JZCA 2J2PA 5BU8B 2H7HA 1CI6B 4C7NA 2YKOA 1LT9A 2R5DA 3U1AA 1N86B 2E43A 5CHXA 5AW6B 1HVVA 3M9QA 3TNUA 4LLHA 1JY3O 3WMM0 4C46A 3N7NA 1KFMA 1L4AA 1LTAC 2XNXA 2GUSA 3G3ZA 1KILA 1G2CA 2HG5D 4N78D 2YNYA 2JHHC 2FYZA 5APUA 1SQQK 4GT1A 2J0YA 1T3UA 1N2DC 5BU5A 4LC1A 1DEBA 2JEEA 1IFDA 4W80A 2C0WA 1N7SB 1SQPK 3M9HA 1W2EA 3NMDA 1T3JA 2E42A 1RE3B 1H8AA 3B8EB 1LTJA 1FZCA 3HUSA 2J5ZA 1QL1A 3M0DC 1IFNA 4DZOA 4WBAA 2IFNA 1KZUB 3L37A 3VP8A 2WSFH 1X8YA 1LGHB 1FJKA 1JY2O 1HBWA 2JHMF 3E1IA 1URQC 3T97A 2J60A 1JY3N 2L5GB 3HD7C 2BASA 1N73B 1FZBB 1FZDA 4EPUA 3EFGA 1FZGB 1FICA 2C9LY 2J61A 2HODA 3HE4A 1HGZA 1URQB 3TSIA 2PP6A 2KB7P 2WITA 2H43B 2Z4EA 2OARA 5APWA 1KQLA 1GL2D 2N9BA 4C7NB 2ZFCA 3NFQA 2GUVA 5APXA 3CLQA 2Q9IC 2XNXC 2J64A 2WSCH 2WTYA 1HH0A 3TNUB 2J1GA 4IFMA 3RK3B 1LWUA 3BVHA 3U1CA 2Q9IB 5AVUB 2XNXB 3M91A 2NPSC 1JY2N 3HD7D 5KLVK 2HYNA 5APSA 3OA7A 3HE5B 1KILB 2W6BA 5AVQB 2I1KA 4R9TA 1Z56A 1HTLC 4JYBA 2FFDA 2WT7A 2N1TA 4M7FA 3GHGA 3U59A 1GU4A 2NPSB 3V2NA 4KHXA 4IFFA 1SQBK 3OAKA 2A45H 1J1DB 2HLOA 3A2AA 3KDPB 1RF0A 1FZAA 4JF7A 5AVVB 1G1JA 1RF1A 1AFOA 3TYYA 2J3FA 1LTJB 3HUSB 2A45G 3SWYA 1T2KC 2KSJA 2LKMA 2R5BA 3VN0A 1FU1A 1YTZT 3B5NA 2YMYA 4ZKPA 1GTWA 1ZR2A 1GL2A 2Z4EC 1Z3UA 1S9KE 3HRNA 5AW8B 4EIJA 3R2PA 2J61B 2HODB 3HE4B 1FDMA 2Z4EB 3PP5A 4WY4A 1NKNA 1GDTA 1XTCC 3IFMA 3P7KA 5CCGD 1JO5A 5AVTB 2JHKF 1OXZA 2XKMA 1E5WA 3VMYA 1WRGA 1FZEC 1Z3SA 5CMZA 3VOPA 5APYA 1T2KD 1AQ5A 1A02F 2MJZA 2WWWA 5APVA 5AW3B 5KJ7D 1IO4A 1N7SC 1SQXK 2XU6A 1LWUB 1FZEB 3BVHB 1RE3C 1M1JA 2OYIA 1VPCA 2WSEH 3M9BA 1ZR4A 1JY2P 2HFED 5CCHC 1IK9A 3LIEA 2YKPA 1NKZB 3BRVB 3MTUE 1DX7A 2J3GA 2KOGA 3IR9A 2N1TB 5APQA 2WT7B 2R32A 2W27A 3BASA 4AQRD 1FOSE 1NU1K 1SFCC 3KPEA 1FZBC 1N73C 1FZGC 4OH8B 1LTIC 1JTHA 2C0XA 2OYHA 2QM8A 3NTNA 1XTGB 1FZAB 3M0AA 2PAJA 1RF1B 3H6PA 1X9VA 1SFCB 3MUDA 2H43C 1FZFA 1N7SD 5AVRB 4ZFGA 4C7RA 3B5NB 1NTZK 3M06A 1LT9C 5CCHD 1GW4A 3MGNA 5CCGA 1LTBC 3H32A 2HPCA 5AVSB 3VMXA 4XE5B 3RK3C 5AW4B 1HJBA 1JCDA 1LT9B 3HTKA 1L4AC 4WY4B 5KJ7A 3CL3D 1CI6A 3KQGA 1KILC 2P7JA 5AW7B 4R9JA 4JYCA 2IPPA 5AW9B 1URQD 1N86A 1X79B 1L4AB 2OYIC 2J3OA 1EQ7A 5BVZA 2YO3A 1GZLA 3RK2B 1G2CB 1J1DC 3VP9A 4ZKUA 1M1JB 2OYIB 1NO4A 4GIFA 1LTJC 1SQVK 1FZCC 3HUSC 2Q3IA 2M3BA 3N4XA 4JYOX 1HWTC 1PFIA 3CI9A 4AYCA 2J3UA 4RESB 2XDJA 3RK3D 2KP8A 2FYUK 3E1IC 1FZCB 1L4AD 5AVZB 3RL0B 4WB4A 4O9BA 1GK4A 1JUNA 1FAVA 2O1JA 1YTZI 2JHLF 1LTTC 1KILD 2VRSA 3BRTB 1JTHB 1M7LA 2OYHB 4GKGA 2Q5UA 3VMZA 2P1JA 2H8PD 2HODC 2M8RA 1IFIA 1JMMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FIB A;  3E1I B;  1JY2 O;  2JHM F;  3E1I A;  1LWU B;  1FIB A;  1FZE B;  2J60 A;  1JY3 N;  3BVH B;  1RE3 C;  1M1J A;  2OYI A;  1N73 B;  1FZB B;  1FZD A;  4EPU A;  1JY2 P;  1FZG B;  1FIC A;  2WNP F;  1FZE A;  2OYH C;  2J61 A;  2HOD A;  2D39 A;  2J3G A;  2HPC B;  3H32 B;  2H43 B;  2Z4E A;  1FZF C;  1LWU C;  1RE3 A;  3BVH C;  1FZB C;  1N73 C;  1RE4 C;  1FZG C;  2J0H A;  2OYH A;  1FZF B;  1FZA B;  2Q9I C;  2XNX C;  1RF1 B;  2JHI F;  2J64 A;  2FFD C;  2HPC C;  1FZF A;  3H32 C;  2H43 C;  3GHG C;  1RE4 B;  2J1G A;  4M7H A;  1LWU A;  3BVH A;  2Q9I B;  1FZB A;  1N73 A;  2XNX B;  4ZFG A;  1FZG A;  1JY2 N;  2FFD B;  2HLO C;  2Q9I A;  3GHG B;  1RF0 C;  1FZA C;  1LT9 C;  4R9T A;  1RF1 C;  2FFD A;  2H43 A;  2HPC A;  1JY3 P;  3H32 A;  3GHG A;  4M7F A;  2GY7 A;  1N86 C;  4NYT A;  2HLO B;  4JZC A;  2J2P A;  1RF0 B;  1LT9 B;  2A45 H;  2HLO A;  1RF0 A;  1FZA A;  1LT9 A;  1N86 B;  2J3F A;  1RF1 A;  4R9J A;  1LTJ B;  3HUS B;  2A45 G;  1FID A;  1N86 A;  2OYI C;  1RE4 A;  2J3O A;  1JY3 O;  3FIB A;  2XNX A;  2J0G A;  2A45 I;  1M1J B;  2OYI B;  1Z3U A;  2Z4E C;  2JHH C;  1LTJ C;  1FZC C;  3HUS C;  2J3F D;  2J61 B;  2J0Y A;  1T3U A;  2HOD B;  4JYO X;  2J3U A;  1JC9 A;  2Z4E B;  1W2E A;  3E1I C;  1FZC B;  1RE3 B;  1M1J C;  2JHK F;  2JHL F;  1LTJ A;  1FZC A;  3HUS A;  2J5Z A;  2OYH B;  1FZE C;  1Z3S A;  2HOD C; 
#chains in the Genus database with same CATH topology
 4LGD E;  3E1I B;  2NPS D;  3MD0 A;  1S9K D;  2B9B A;  2Z5I A;  3SFD C;  2M3E A;  1NTK J;  2AEJ A;  4M3L A;  1SLQ A;  2A06 E;  4W7Z A;  2XZR A;  3FWN A;  3D71 A;  1BGY G;  1KB9 E;  1NOH A;  2OQQ A;  1S2E A;  3H32 B;  3H1L J;  3AE5 C;  4DCK A;  1URQ A;  5M1B A;  1OW7 A;  1J2J B;  3LW5 H;  3SSU A;  1JNM A;  3WU2 H;  2N1T C;  3KXD A;  2IBZ D;  5AW1 B;  4PD4 E;  2Q9I A;  3GHG B;  3JC2 2;  1FZA C;  3H1I G;  2IZ1 A;  1RF1 C;  2K3R A;  1CSB A;  3C9I A;  1L0L K;  3P8C E;  5CJ4 A;  2HLO B;  4Y28 J;  1VF5 D;  2NPS A;  1MV8 A;  1HGV A;  2QJP C;  1VDF A;  1GL2 C;  5KLV G;  3TGU J;  4U3F J;  2O01 H;  1FID A;  1RE4 A;  3NXS A;  1T8Z A;  5KAF H;  5KAI H;  1SQX E;  4WY4 C;  5GTI E;  2A45 I;  4PJ0 E;  1BCC J;  3CWB J;  3H25 A;  3L74 G;  3B5N D;  3CC4 P;  3CME P;  1P84 E;  3TDK A;  3A0B E;  1GW3 A;  1JMB A;  2YO2 A;  3F5H A;  3PHL A;  1FIB A;  1QL2 A;  1ZXG A;  5E79 H;  2MKV A;  4IL6 E;  3H1I D;  2V4H A;  4EI2 A;  1FZF C;  5TIS E;  3V2Q A;  1FJP A;  3L75 G;  3P32 A;  2J0H A;  4DOJ A;  2HPC C;  1NTM K;  1USE A;  2FY8 A;  4BWN A;  3L70 E;  1SQP J;  2POH A;  2H43 A;  3CX5 I;  2FYU D;  1KTM A;  1AVO A;  5B66 H;  3JCU H;  4KT0 J;  1LT9 A;  5GTH H;  5CHX A;  1E79 H;  1YHQ P;  3FXE A;  1VQP P;  1EDI A;  2UWJ E;  5DJU B;  3G3Z A;  1KIL A;  2ZAE B;  2HG5 D;  3H1J G;  4N78 D;  2I8D A;  2YIU C;  2FYZ A;  2LXB A;  1DEB A;  3H1H J;  1IFD A;  4W80 A;  1VQ6 P;  1L0N E;  1W2E A;  2QE7 H;  2KNC A;  1T3J A;  1H8A A;  3L75 D;  2J5Z A;  4UB6 H;  3TGU G;  3PJS K;  4DZO A;  1S4X A;  1SQV G;  2W90 A;  1VQO P;  1KZU B;  3L37 A;  1X8Y A;  1LGH B;  3KHU A;  1FDI A;  1JY2 O;  2JHM F;  3E1I A;  1URQ C;  4NPF X;  1KN7 A;  1NTK D;  4JBZ A;  3EFG A;  4DJG A;  2C9L Y;  2J61 A;  3GF3 A;  1BCC G;  4NPD A;  3TSI A;  1QLE D;  2ITA A;  2OAR A;  3E1R A;  1EDK A;  2GUV A;  2Q9I C;  1NAY A;  3G4S P;  4YXD C;  2W8Z A;  3BVH A;  2QJY B;  2XNX B;  2NPS C;  3HE5 B;  2WPV B;  4JPZ B;  2ZYA A;  3GHG A;  1RHZ B;  1JM0 A;  1KQG B;  1SQB K;  2A45 H;  4A7P A;  2HLO A;  1ZW0 A;  1G1J A;  3TYY A;  2A45 G;  3SWY A;  3TGU D;  4U3F D;  1T2K C;  2LKM A;  2R5B A;  1L0L G;  3VN0 A;  4H44 B;  1RH5 B;  2YMY A;  2Z4E C;  4RO0 A;  3ABV C;  2ZYD A;  1S9K E;  4EIJ A;  3R2P A;  4D6T E;  2KZJ A;  2B87 B;  1BCC D;  1OVR A;  1DD3 A;  3CWB D;  1M57 D;  5KLI B;  5CCG D;  3L73 E;  4IL6 X;  5AVT B;  1VF5 C;  3VMY A;  1Z3S A;  5APY A;  1A02 F;  2MJZ A;  2WWW A;  1NTZ J;  5KJ7 D;  1BDC A;  2IBZ I;  2FYN C;  2OTL P;  1M1J A;  1VPC A;  1JY2 P;  1MFT A;  4YXW H;  2R44 A;  1PPJ G;  1NKZ B;  3BRV B;  2KOG A;  3CCQ P;  1X0T A;  3H1H G;  1FOS E;  2QVA A;  1PZQ A;  4BRY B;  1USD A;  3L71 G;  1JTH A;  3NTN A;  1M56 D;  2O3J A;  3H6P A;  2YXQ B;  3CX5 H;  1X9V A;  1SFC B;  2H43 C;  1EZV D;  4H13 B;  1YIJ P;  4ZFG A;  1LT9 C;  1GW4 A;  5CCG A;  3AE1 C;  3AE4 C;  4GOF A;  1SQP D;  3VMX A;  4XE5 B;  4CPG A;  5KJ7 A;  1ZME C;  1BGY E;  1KIL C;  2ZXX A;  4NPE A;  4JYC A;  1EC5 A;  1FS0 E;  1OIP A;  1GZL A;  3RK2 B;  1NVO A;  1PP9 E;  2KIK A;  2OYI B;  2Q3I A;  3KZI H;  1M1K Q;  3N4X A;  4JYO X;  3C8V A;  2KP8 A;  2FYU K;  4R4M A;  3E1I C;  1L4A D;  3H1H D;  5AVZ B;  3RL0 B;  3GW6 A;  1JUN A;  3H1I E;  3L71 D;  1M7L A;  2OYH B;  3R4Y A;  4EYY Q;  2H8P D;  1KIL E;  1IFI A;  1K8A Q;  3T97 B;  2QM7 A;  5CBO A;  3QWO C;  1ZRT D;  3CX5 D;  5KLV E;  1LTS C;  5AW2 B;  3M0D A;  2D39 A;  3D70 A;  1OFC X;  2NRG A;  4H44 D;  3BVH C;  3HD7 A;  5KAF E;  1BE3 G;  4Y99 B;  1Q81 Q;  1AA0 A;  2YKQ A;  3GHG C;  3OJA B;  2Q7C A;  4M7H A;  3L74 E;  1QVF O;  1PP9 J;  1Q7Y Q;  4DT0 A;  4N3Y B;  3V2R A;  2HLO C;  3Q2Y A;  2FBW C;  3H1K G;  1NTK K;  3P8M C;  3ZDM A;  3L72 J;  2HR3 A;  3HE5 A;  1CZQ A;  3TK1 A;  3FX0 A;  3A7O A;  4N78 E;  1RF0 B;  5KTB A;  4PV1 B;  2OGU A;  3SWK A;  5E79 E;  3A5T A;  2O01 N;  2ZVN B;  1MZ9 A;  1VQK P;  3L75 E;  1ZN5 A;  3V5B A;  1SQB G;  5K5G B;  2GM4 A;  1AVY A;  2J3F D;  2WPS A;  2FXM A;  5AVY B;  1SFC D;  1H88 A;  1JCC A;  2B87 A;  4H13 D;  1NU1 E;  1JOC A;  1ZP0 C;  2E5Y A;  1M1J C;  2IBZ G;  3GG2 A;  1GU5 A;  1ZV8 A;  4I6M C;  2CPS A;  2KYV A;  2KSE A;  1NTZ D;  4IOI H;  1SVF A;  1PGQ A;  3GLM A;  3V4W A;  1WMK A;  1MUU A;  1EDJ A;  3A3Y B;  2PGD A;  2AEM A;  5GTH E;  3H1K D;  1VQ9 P;  3CXH H;  3V2P A;  1MFZ A;  2D2C C;  3RK2 D;  3USS A;  2P67 A;  3H1J E;  4I2L C;  4BRY A;  1UIX A;  5CCG C;  2E76 B;  4XA4 A;  1DD4 A;  1NJI Q;  4HJG H;  2OYO A;  2KS1 A;  3BAT A;  2IZ0 A;  1ZOY C;  1YJN P;  3CPW O;  1SFC A;  1SQQ J;  3RL0 D;  1FZG A;  2CK3 H;  5KJ7 C;  1SQB D;  2E74 C;  4OWF A;  1SQV E;  1MKM A;  2Y9Z A;  2BCC J;  2WMM A;  4UB6 E;  3AEA C;  2KI7 B;  4JZC A;  2J2P A;  5BU8 B;  1CI6 B;  1T6A A;  4C7N A;  1VQ4 P;  1UII A;  3CCV P;  2R5D A;  1N86 B;  5AW6 B;  1K05 A;  2W83 C;  3C1L A;  1HVV A;  3WMM 0;  3N7N A;  1KFM A;  1LTA C;  2JHH C;  5APU A;  2JR8 A;  2JWD A;  1OZH A;  1TU3 F;  1N2D C;  2M5A B;  5BU5 A;  2KUB A;  1S5L E;  3I56 P;  1H0T B;  2PFX A;  2JEE A;  1S72 P;  1OVU A;  1N7S B;  1SQP K;  3NMD A;  1BSH A;  1RE3 B;  3B8E B;  3CXH D;  3CC2 P;  3M0D C;  2Q6Q A;  1LP1 A;  2IFN A;  1EZV I;  5H2F H;  1AJY A;  1HBW A;  2FYU G;  2H88 C;  3T97 A;  2L5G B;  3HD7 C;  2BAS A;  1N73 B;  1FZB B;  4EPU A;  4PV1 D;  2JKV A;  1K73 Q;  3HE4 A;  2WIT A;  1L0L E;  2Z4E A;  5APW A;  3AE7 C;  4OGQ B;  4OVN F;  2ZFC A;  5APX A;  2QJY C;  2XNX C;  2WSC H;  1HH0 A;  3TNU B;  3F89 A;  1LWU A;  3K5B A;  3U1C A;  1BSN A;  2HYN A;  2W6B A;  1YBK A;  2I1K A;  4R9T A;  1HTL C;  2WT7 A;  1OW6 A;  4M7F A;  3U59 A;  1GU4 A;  1EXI A;  3BCC E;  3L72 D;  1RF0 A;  4JF7 A;  2QEX P;  1IFP A;  1PPJ E;  2Q1K A;  1LTJ B;  1SQX J;  5C39 A;  3HUS B;  1NTK G;  3W68 A;  1HJ0 A;  2KK7 A;  3L71 E;  3B5N A;  4ZKP A;  1ZR2 A;  5KKZ C;  2BEZ F;  3H1L G;  4UB8 H;  2HOD B;  2E76 D;  1GDT A;  2AXC A;  4H0L D;  1RQV A;  1AQ5 A;  3CCR P;  1NTM E;  1FZE B;  3M9B A;  2HFE D;  1IK9 A;  1KYO H;  4QMA A;  3MTU E;  1DX7 A;  2N1T B;  2R32 A;  2J5U A;  2Q3E A;  2W27 A;  1SFC C;  4U3F G;  1FZG C;  4OH8 B;  1LTI C;  2C0X A;  2QM8 A;  4H13 C;  1FZA B;  3WUU A;  2PAJ A;  1RF1 B;  1U7M A;  1IK7 A;  3MUD A;  5B5E H;  1N7S D;  3L70 J;  3CWB G;  1K9M Q;  2QJP B;  1NTZ K;  1SQQ D;  5CCH D;  1Q90 D;  2WSF J;  3H32 A;  3H1L D;  3RK3 C;  2BCC D;  1KD1 Q;  4WY4 B;  3CL3 D;  1CI6 A;  3KQG A;  4XFJ A;  1GMJ A;  5AW7 B;  1SS1 A;  1S5L X;  3O6Q B;  1YJ9 P;  1N86 A;  1X79 B;  1L4A B;  2OYI C;  1YJW P;  5BVZ A;  1OX3 A;  4OGQ D;  1G2C B;  3GMA A;  1J1D C;  1BE3 E;  3VP9 A;  1NO4 A;  1L0N J;  3EFF K;  2J3U A;  4RES B;  2XDJ A;  3S4R A;  1KYO D;  3RK3 E;  1EZV G;  4WB4 A;  4O9B A;  5GTI H;  2O1J A;  2JHL F;  2ZT9 B;  3BRT B;  2Y9Y A;  4GKG A;  4PJ0 H;  2M8R A;  3L36 A;  3QH9 A;  1PL5 A;  2A06 D;  3VTP C;  1HUC A;  1SQP G;  3AE9 C;  4EDF A;  3AEC C;  1P84 H;  4AUW A;  3S9O A;  3MHV A;  3A0B H;  1S3J A;  3VYI A;  3PTZ A;  2HPC B;  1QX8 A;  4Y99 C;  1YQ3 C;  3SFE C;  1LWU C;  1SQB E;  5APT A;  3HTK B;  1G1I A;  2KLV A;  1H89 A;  4IL6 H;  2JHI F;  1IC2 A;  1RY3 A;  2J58 A;  3SWF A;  2WVR A;  1Y47 A;  3V4Q A;  5AVX B;  2J59 M;  3E7K A;  4B86 A;  2IBZ E;  2FFD B;  1RF0 C;  1KV4 A;  1WT6 A;  3P8C D;  3AE3 C;  4NYT A;  1SP4 A;  3AEG C;  2WSE J;  3CCU P;  1JB0 J;  4N6J A;  3B5N C;  1FOS F;  4R4L A;  3CXH I;  2K88 A;  3MIW A;  3B4S A;  1IJD B;  2N1T D;  4W7Y A;  1ZLL A;  5EFW B;  4L73 A;  3Q5R A;  3FIB A;  1LT1 A;  3L70 G;  2WSS H;  2J0G A;  4D6T J;  3VMA A;  3RBZ A;  4HYT B;  1A02 J;  3AED C;  3II6 A;  3L73 J;  3GF7 A;  2WPQ A;  1FBM A;  1RQU A;  1P84 D;  2OTJ P;  5AW5 B;  3PRJ A;  2C9N Y;  1J1E B;  1LTG C;  2DW3 A;  3A0H H;  2P2U A;  4WY4 D;  4ASW A;  3WU2 E;  1FZE A;  4WVZ A;  3MUD C;  2Z5H A;  1VQ8 P;  3PLN A;  2XV5 A;  2G3A A;  3H32 C;  1RE4 B;  2W6J H;  4EOT A;  1NHL A;  3ITK A;  1U57 A;  3L70 D;  2ZT9 D;  2QRX A;  1JY3 P;  2LXC B;  2GY7 A;  1N86 C;  3I5C A;  5KAI E;  1BGY J;  5TJH A;  2FYU E;  2NZ2 A;  1NYH A;  2K37 A;  2YKO A;  2ZYG A;  3AEE C;  2JP3 A;  3U1A A;  1NTZ G;  4LLH A;  4L76 A;  3PH0 A;  4C46 A;  1L4A A;  2P10 A;  2XNX A;  2GUS A;  1G2C A;  2IYO A;  1FC2 C;  1SQQ K;  2J0Y A;  4TT3 H;  1L0N D;  3H1I J;  2C0W A;  3M9H A;  2E42 A;  2E75 B;  1QL1 A;  3CD6 P;  3VP8 A;  5KLV J;  1FJK A;  2J60 A;  1JY3 N;  3JSV C;  3OW2 O;  1NTK E;  1HGZ A;  2K9Y A;  2KB7 P;  3L73 G;  2H43 B;  1N8R Q;  2RN0 A;  2N9B A;  2B89 A;  3CLQ A;  3L74 J;  3AE8 C;  3FGA D;  2J64 A;  2L91 A;  5B66 E;  3JCU E;  2J1G A;  4IFM A;  1QVG O;  4GOD A;  3M91 A;  1R8E A;  1KIL B;  5AVQ B;  2FFD A;  3D6Z A;  4KHX A;  1KYO I;  2H89 C;  2KNC B;  3KDP B;  2J3F A;  3L75 J;  3CCL P;  2KSJ A;  3TGU E;  4U3F E;  1FU1 A;  3G9R A;  4H0L B;  1W5C E;  4I7Z B;  1R5L A;  1KB9 I;  4D6T D;  3RGU A;  3HRN A;  1AQT A;  1NU1 J;  2J61 B;  4K35 A;  3L73 D;  1BCC E;  5B5E E;  3CWB E;  1JO5 A;  1OXZ A;  1FZE C;  2LR2 A;  1PP9 G;  3VOP A;  1T2K D;  2IYP A;  1IO4 A;  2AXT H;  1SQX K;  2XU6 A;  4PD4 I;  3CCS P;  3BVH B;  1D7M A;  2OYI A;  3L72 G;  1ZR4 A;  1PIX A;  3LIE A;  4KJM A;  2YKP A;  2V7Q J;  1R5S A;  3H1J J;  2WQY C;  4WWI A;  1LJ2 A;  2Y0C A;  1FDO A;  4GOE A;  2OYH A;  1XTG B;  4Z1M H;  3AE2 C;  1PV3 A;  4ASV A;  1QGK B;  3AE6 C;  1EZV E;  1SQV J;  2YXR B;  5AVR B;  1S1C X;  1NGM B;  2E75 D;  1KMI Z;  3M06 A;  3MP7 B;  1EDL A;  5AVS B;  2KXP B;  2KZI A;  5AW4 B;  1HJB A;  1SQP E;  3RBX A;  1L4A C;  1BGY D;  1P84 I;  1BDD A;  1JEK A;  2IPP A;  2J3O A;  1EQ7 A;  2YO3 A;  1PP9 D;  4ZKU A;  1KQF B;  1M1J B;  2QJK B;  2M3B A;  1HWT C;  2ZT9 C;  1W2B O;  4H44 C;  2G8Y A;  1FZC B;  4RKU J;  1FAV A;  1YTZ I;  3H1H E;  1LTT C;  1KIL D;  1JTH B;  1M90 Q;  2PRR A;  1JMM A;  1SQQ G;  4L75 A;  3TF5 A;  2D2C B;  5KLV D;  1QEX A;  5KLI C;  1L0L J;  2BCC G;  1PGO A;  1IFM A;  1YYC A;  1OWA A;  2WNP F;  1ZRT E;  1X22 A;  3CX5 E;  1CW5 A;  1N7L A;  1EXJ A;  1NU1 G;  2RKL A;  1GK6 A;  2IX7 C;  1Y8A A;  2QG4 A;  1L0N K;  3UIA A;  1IFJ A;  2E74 B;  2FFD C;  3W67 A;  3L74 D;  1NH4 A;  1DIP A;  1KFN A;  4HB1 A;  2V7Q H;  3BCC J;  4HH2 A;  2CPB A;  2KLU A;  2QIW A;  4GDO A;  3CMA P;  1FE6 A;  1VL2 A;  4U7J A;  1VQL P;  3A0H E;  1KB9 H;  1M8O B;  2A06 G;  3KZI E;  1AV1 A;  4IFD K;  3L71 J;  1LNQ A;  3L4F A;  1GL2 B;  1NAF A;  3CCM P;  1Q2N A;  3RL0 g;  2FKW B;  2SPZ A;  1VQ7 P;  2W6A A;  5AVW B;  1NU1 D;  1J1E C;  1JC9 A;  1HF9 A;  3RK2 C;  4PD4 H;  2WZ7 A;  3WUT A;  2O1K A;  1KOR A;  3HD7 B;  2I1J A;  1NTM J;  2AEF A;  1YI2 P;  2JDI H;  3O8Z A;  2ZXE B;  2FIB A;  2QSI A;  1S5L H;  3FXD A;  3LID A;  3RL0 C;  1NWQ A;  5L8R J;  2R3S A;  1DH3 A;  5AW0 B;  3Q1M A;  1NTZ E;  1VQ5 P;  2OYH C;  3EQ2 A;  2FXO A;  3B71 A;  2M5A A;  2K9J B;  1H0T A;  1N7S A;  3AEB C;  3H1K E;  1U7J A;  3H1J D;  1RE3 A;  1SQX G;  1RE4 C;  5CJ0 A;  3S1K A;  5CCH A;  1FZF B;  2IFM A;  2WPR A;  3KYQ A;  2BEQ D;  2JJL A;  3L35 A;  1KB9 D;  4ZMD A;  2R3C A;  3IN6 A;  1FZB A;  1N73 A;  1SQV D;  4RJT A;  2XND H;  2Y0D A;  1GD2 E;  2E5T A;  2QA4 P;  2B88 A;  4I1L A;  4MN4 C;  1Q86 Q;  2D2C D;  2H7H A;  3G71 P;  2ZVO B;  1OMI A;  5KKZ B;  2E43 A;  3EWK A;  4PD4 D;  1BE3 J;  4BXL A;  3M9Q A;  3TNU A;  5TIS H;  1JY3 O;  4PV1 C;  3IAO A;  3Q3D A;  3BCC G;  2YNY A;  2P58 A;  2E74 D;  5DJT B;  3CCE P;  4GT1 A;  1PGJ A;  1T3U A;  2E75 C;  4LC1 A;  3H1K J;  2YIU B;  2JWA A;  3MZW B;  1SQX D;  1LTJ A;  1FZC A;  3HUS A;  3Q5P A;  3CXH E;  1IFN A;  1IZN B;  4WBA A;  2WSF H;  2KS1 B;  2RMZ A;  1OW8 A;  1FZD A;  1FZG B;  1FIC A;  2HOD A;  1L0L D;  1SQB J;  1URQ B;  2PP6 A;  1KQL A;  1GL2 D;  4C7N B;  3NFQ A;  1NTM G;  2WTY A;  3G6E P;  3RK3 B;  4YTP C;  1Y9B A;  3V6I A;  2Q9I B;  5AVU B;  3AEF C;  1L0N G;  1JY2 N;  3HD7 D;  5KLV K;  5APS A;  3OA7 A;  2M0B A;  1Z56 A;  3BCC D;  2N1T A;  2E76 C;  2NPS B;  3V2N A;  2N9Y B;  2RH0 A;  4IFF A;  3OAK A;  3L72 E;  1YQ4 C;  1J1D B;  2AXT E;  1PPJ D;  3A2A A;  1FZA A;  1YIT P;  3D6Y A;  5AVV B;  1RF1 A;  1AFO A;  4H0L C;  4I7Z C;  1LP1 B;  3WUV A;  2ZJS E;  1YTZ T;  1GTW A;  1GL2 A;  1Z3U A;  5AW8 B;  1OVV A;  3HE4 B;  1FDM A;  5H2F E;  2Z4E B;  3PP5 A;  4WY4 A;  1NKN A;  3IF4 A;  1XTC C;  3IFM A;  3P7K A;  2JHK F;  2XKM A;  1E5W A;  3I55 P;  1WRG A;  3O6Q A;  3LW5 J;  5CMZ A;  1NTM D;  5APV A;  5AW3 B;  1L2P A;  3Q5S A;  1N7S C;  1VF5 B;  1LWU B;  1RE3 C;  2WSE H;  3FWL A;  5CCH C;  2FYN B;  2J3G A;  3IR9 A;  2WT7 B;  5APQ A;  3CC7 P;  2K9J A;  3BAS A;  4AQR D;  1NU1 K;  3KPE A;  1FZB C;  1N73 C;  2JO1 A;  2FXP A;  1K04 A;  3M0A A;  1DEE G;  1FZF A;  4D6T G;  2O01 J;  1KQS O;  4OGQ C;  2OTK E;  4C7R A;  3B5N B;  4L74 A;  1KC8 Q;  4YPC A;  2FYU J;  3MGN A;  2IDB A;  1SQQ E;  1LTB C;  1Q82 Q;  2HPC A;  4ZNC A;  2GA1 A;  2YMK A;  3H1L E;  1JCD A;  1LT9 B;  3HTK A;  3CCJ P;  4HKZ H;  2BCC E;  4UB8 E;  2P7J A;  4R9J A;  5AW9 B;  1URQ D;  2K1A A;  2QJK C;  1BE3 D;  5CBN A;  1VQM P;  4K3A A;  4GIF A;  2WSC J;  1LTJ C;  1SQV K;  1FZC C;  3HUS C;  1PFI A;  3CI9 A;  4AYC A;  4JQ0 D;  3RK3 D;  1VQN P;  1GK4 A;  2Y0E A;  1KYO E;  2VRS A;  1PGP A;  2Q5U A;  3VMZ A;  4TLF A;  2P1J A;  2HOD C;  4JYB A; 
#chains in the Genus database with same CATH homology
 4LGD E;  3E1I B;  3L36 A;  2NPS D;  3MD0 A;  1S9K D;  2QM7 A;  2Z5I A;  3VTP C;  1HUC A;  4M3L A;  1SLQ A;  1LTS C;  4W7Z A;  1IFM A;  1YYC A;  1OWA A;  2XZR A;  5AW2 B;  2WNP F;  3M0D A;  1CW5 A;  1N7L A;  4AUW A;  1NOH A;  2D39 A;  1GK6 A;  2IX7 C;  3VYI A;  3H32 B;  2HPC B;  1URQ A;  1L0N K;  4Y99 C;  1LWU C;  3BVH C;  5APT A;  3HD7 A;  3HTK B;  3UIA A;  1J2J B;  1IFJ A;  3LW5 H;  1JNM A;  1G1I A;  2KLV A;  1H89 A;  4Y99 B;  2JHI F;  2FFD C;  1IC2 A;  1RY3 A;  2YKQ A;  2N1T C;  2J58 A;  3GHG C;  3SWF A;  1NH4 A;  3OJA B;  2Q7C A;  4M7H A;  3V4Q A;  5AW1 B;  1KFN A;  5AVX B;  2J59 M;  4B86 A;  4N3Y B;  2FFD B;  3V2R A;  2HLO C;  2Q9I A;  3GHG B;  1RF0 C;  1FZA C;  1NTK K;  3P8M C;  4HH2 A;  1RF1 C;  1WT6 A;  3P8C D;  1CSB A;  2CPB A;  3C9I A;  3HE5 A;  1L0L K;  4NYT A;  3P8C E;  1CZQ A;  1SP4 A;  5CJ4 A;  2HLO B;  3TK1 A;  4N78 E;  3A7O A;  1RF0 B;  5KTB A;  2NPS A;  1MV8 A;  4N6J A;  1HGV A;  3B5N C;  1FOS F;  1VDF A;  1GL2 C;  3MIW A;  4IFD K;  2O01 H;  1FID A;  3A5T A;  1IJD B;  1RE4 A;  2N1T D;  4W7Y A;  1ZLL A;  3NXS A;  3L4F A;  1T8Z A;  3FIB A;  1MZ9 A;  1GL2 B;  2J0G A;  4WY4 C;  1NAF A;  1ZN5 A;  2A45 I;  3V5B A;  2FKW B;  2GM4 A;  4HYT B;  2J3F D;  2WPS A;  2FXM A;  5AVY B;  1A02 J;  3II6 A;  2W6A A;  1SFC D;  5AVW B;  1JC9 A;  1J1E C;  1H88 A;  1JCC A;  2WPQ A;  3RK2 C;  1FBM A;  2WZ7 A;  1JOC A;  2O1K A;  3HD7 B;  3B5N D;  2I1J A;  1M1J C;  5AW5 B;  2C9N Y;  1J1E B;  3O8Z A;  2ZXE B;  1GU5 A;  1ZV8 A;  1LTG C;  1GW3 A;  2FIB A;  4I6M C;  2YO2 A;  2CPS A;  2KYV A;  3LID A;  2P2U A;  4WY4 D;  1FIB A;  3RL0 C;  1NWQ A;  1QL2 A;  1SVF A;  1DH3 A;  5AW0 B;  3V4W A;  1FZE A;  1MUU A;  2OYH C;  3A3Y B;  3EQ2 A;  3V2P A;  1MFZ A;  1FZF C;  1N7S A;  3RK2 D;  1RE3 A;  2P67 A;  3V2Q A;  1FJP A;  1RE4 C;  2Z5H A;  3P32 A;  5CJ0 A;  5CCH A;  2J0H A;  1FZF B;  2IFM A;  2WPR A;  4I2L C;  2XV5 A;  5CCG C;  3KYQ A;  4XA4 A;  4DOJ A;  3H32 C;  2HPC C;  2JJL A;  1RE4 B;  1NTM K;  3BAT A;  3L35 A;  2R3C A;  4EOT A;  1SFC A;  1NHL A;  1FZB A;  1N73 A;  3RL0 D;  1FZG A;  5KJ7 C;  1GD2 E;  2POH A;  4I1L A;  1JY3 P;  2H43 A;  2GY7 A;  1N86 C;  3I5C A;  4JZC A;  2J2P A;  5BU8 B;  2H7H A;  1CI6 B;  4C7N A;  2YKO A;  1LT9 A;  2R5D A;  3U1A A;  1N86 B;  2E43 A;  5CHX A;  5AW6 B;  1HVV A;  3M9Q A;  3TNU A;  4LLH A;  1JY3 O;  3WMM 0;  4C46 A;  3N7N A;  1KFM A;  1L4A A;  1LTA C;  2XNX A;  2GUS A;  3G3Z A;  1KIL A;  1G2C A;  2HG5 D;  4N78 D;  2YNY A;  2JHH C;  2FYZ A;  5APU A;  1SQQ K;  4GT1 A;  2J0Y A;  1T3U A;  1N2D C;  5BU5 A;  4LC1 A;  1DEB A;  2JEE A;  1IFD A;  4W80 A;  2C0W A;  1N7S B;  1SQP K;  3M9H A;  1W2E A;  3NMD A;  1T3J A;  2E42 A;  1RE3 B;  1H8A A;  3B8E B;  1LTJ A;  1FZC A;  3HUS A;  2J5Z A;  1QL1 A;  3M0D C;  1IFN A;  4DZO A;  4WBA A;  2IFN A;  1KZU B;  3L37 A;  3VP8 A;  2WSF H;  1X8Y A;  1LGH B;  1FJK A;  1JY2 O;  1HBW A;  2JHM F;  3E1I A;  1URQ C;  3T97 A;  2J60 A;  1JY3 N;  2L5G B;  3HD7 C;  2BAS A;  1N73 B;  1FZB B;  1FZD A;  4EPU A;  3EFG A;  1FZG B;  1FIC A;  2C9L Y;  2J61 A;  2HOD A;  3HE4 A;  1HGZ A;  1URQ B;  3TSI A;  2PP6 A;  2KB7 P;  2WIT A;  2H43 B;  2Z4E A;  2OAR A;  5APW A;  1KQL A;  1GL2 D;  2N9B A;  4C7N B;  2ZFC A;  3NFQ A;  2GUV A;  5APX A;  3CLQ A;  2Q9I C;  2XNX C;  2J64 A;  2WSC H;  2WTY A;  1HH0 A;  3TNU B;  2J1G A;  4IFM A;  3RK3 B;  1LWU A;  3BVH A;  3U1C A;  2Q9I B;  5AVU B;  2XNX B;  3M91 A;  2NPS C;  1JY2 N;  3HD7 D;  5KLV K;  2HYN A;  5APS A;  3OA7 A;  3HE5 B;  1KIL B;  2W6B A;  5AVQ B;  2I1K A;  4R9T A;  1Z56 A;  1HTL C;  4JYB A;  2FFD A;  2WT7 A;  2N1T A;  4M7F A;  3GHG A;  3U59 A;  1GU4 A;  2NPS B;  3V2N A;  4KHX A;  4IFF A;  1SQB K;  3OAK A;  2A45 H;  1J1D B;  2HLO A;  3A2A A;  3KDP B;  1RF0 A;  1FZA A;  4JF7 A;  5AVV B;  1G1J A;  1RF1 A;  1AFO A;  3TYY A;  2J3F A;  1LTJ B;  3HUS B;  2A45 G;  3SWY A;  1T2K C;  2KSJ A;  2LKM A;  2R5B A;  3VN0 A;  1FU1 A;  1YTZ T;  3B5N A;  2YMY A;  4ZKP A;  1GTW A;  1ZR2 A;  1GL2 A;  2Z4E C;  1Z3U A;  1S9K E;  3HRN A;  5AW8 B;  4EIJ A;  3R2P A;  2J61 B;  2HOD B;  3HE4 B;  1FDM A;  2Z4E B;  3PP5 A;  4WY4 A;  1NKN A;  1GDT A;  1XTC C;  3IFM A;  3P7K A;  5CCG D;  1JO5 A;  5AVT B;  2JHK F;  1OXZ A;  2XKM A;  1E5W A;  3VMY A;  1WRG A;  1FZE C;  1Z3S A;  5CMZ A;  3VOP A;  5APY A;  1T2K D;  1AQ5 A;  1A02 F;  2MJZ A;  2WWW A;  5APV A;  5AW3 B;  5KJ7 D;  1IO4 A;  1N7S C;  1SQX K;  2XU6 A;  1LWU B;  1FZE B;  3BVH B;  1RE3 C;  1M1J A;  2OYI A;  1VPC A;  2WSE H;  3M9B A;  1ZR4 A;  1JY2 P;  2HFE D;  5CCH C;  1IK9 A;  3LIE A;  2YKP A;  1NKZ B;  3BRV B;  3MTU E;  1DX7 A;  2J3G A;  2KOG A;  3IR9 A;  2N1T B;  5APQ A;  2WT7 B;  2R32 A;  2W27 A;  3BAS A;  4AQR D;  1FOS E;  1NU1 K;  1SFC C;  3KPE A;  1FZB C;  1N73 C;  1FZG C;  4OH8 B;  1LTI C;  1JTH A;  2C0X A;  2OYH A;  2QM8 A;  3NTN A;  1XTG B;  1FZA B;  3M0A A;  2PAJ A;  1RF1 B;  3H6P A;  1X9V A;  1SFC B;  3MUD A;  2H43 C;  1FZF A;  1N7S D;  5AVR B;  4ZFG A;  4C7R A;  3B5N B;  1NTZ K;  3M06 A;  1LT9 C;  5CCH D;  1GW4 A;  3MGN A;  5CCG A;  1LTB C;  3H32 A;  2HPC A;  5AVS B;  3VMX A;  4XE5 B;  3RK3 C;  5AW4 B;  1HJB A;  1JCD A;  1LT9 B;  3HTK A;  1L4A C;  4WY4 B;  5KJ7 A;  3CL3 D;  1CI6 A;  3KQG A;  1KIL C;  2P7J A;  5AW7 B;  4R9J A;  4JYC A;  2IPP A;  5AW9 B;  1URQ D;  1N86 A;  1X79 B;  1L4A B;  2OYI C;  2J3O A;  1EQ7 A;  5BVZ A;  2YO3 A;  1GZL A;  3RK2 B;  1G2C B;  1J1D C;  3VP9 A;  4ZKU A;  1M1J B;  2OYI B;  1NO4 A;  4GIF A;  1LTJ C;  1SQV K;  1FZC C;  3HUS C;  2Q3I A;  2M3B A;  3N4X A;  4JYO X;  1HWT C;  1PFI A;  3CI9 A;  4AYC A;  2J3U A;  4RES B;  2XDJ A;  3RK3 D;  2KP8 A;  2FYU K;  3E1I C;  1FZC B;  1L4A D;  5AVZ B;  3RL0 B;  4WB4 A;  4O9B A;  1GK4 A;  1JUN A;  1FAV A;  2O1J A;  1YTZ I;  2JHL F;  1LTT C;  1KIL D;  2VRS A;  3BRT B;  1JTH B;  1M7L A;  2OYH B;  4GKG A;  2Q5U A;  3VMZ A;  2P1J A;  2H8P D;  2HOD C;  2M8R A;  1IFI A;  1JMM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...