3H32B

Crystal structure of d-dimer from human fibrin complexed with gly-his-arg-pro-tyr-amide
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
308
structure length
308
Chain Sequence
LYIDETVNSNIPTNLRVLRSILENLRSKIQKLESDVSAQMEYCRTPCTVSCNIPVVSGKECEEIIRKGGETSEMYLIQPDSSVKPYRVYCDMNTENGGWTVIQNRQDGSVDFGRKWDPYKQGFGNVATNTDGKNYCGLPGEYWLGNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGGFTVQNEANKYQISVNKYRGTAGNALMDGASQLMGENRTMTIHNGMFFSTYDRDNDGWLTSDPRKQCSKEDGGGWWYNRCHAANPNGRYYWGGQYTWDMAKHGTDDGVVWMNWKGSWYSMRKMSMKIRPFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibrinogen alpha chain
publication title Two families of synthetic peptides that enhance fibrin turbidity and delay fibrinolysis by different mechanisms.
pubmed doi rcsb
molecule tags Blood clotting
total genus 74
structure length 308
sequence length 308
chains with identical sequence E
ec nomenclature
pdb deposition date 2009-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
B PF08702 Fib_alpha Fibrinogen alpha/beta chain family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3h32B01
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 3h32B02
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 3h32B03
2Q9IB 1LWUA 2Q9IC 3BVHA 2J61B 2FIBA 2JHHC 2JHKF 2HPCB 4M7HA 2HPCC 2J3FA 1LWUB 2OYHA 1JY2P 3E1IA 2Z4EA 2FFDB 1FZAB 2FFDC 1FZAC 1RE3A 1T3UA 1FICA 2XNXB 1FZFB 1JC9A 2OYHB 2XNXC 1FZFC 2OYHC 2Q9IA 1FZCB 2J61A 1FZCC 2J1GA 2JHMF 1FIDA 1JY3O 1FZEB 3GHGB 1FZEC 2HPCA 3GHGC 2J3OA 1FIBA 1LTJB 1LTJC 2A45I 2FFDA 1FZAA 1W2EA 2OYIB 2OYIC 2J64A 2J2PA 2XNXA 1FZFA 4JZCA 1M1JB 1Z3SA 1M1JC 1FZCA 1RF0B 1RF0C 1FZEA 2JHIF 3GHGA 2J3GA 4R9JA 2WNPF 2J5ZA 1N73B 1LTJA 1N73C 2OYIA 2H43B 1JY3N 2H43C 3H32B 1M1JA 2HLOC 3H32C 4JYOX 2A45H 1JY2O 1RF0A 2HODB 2HODC 1LT9B 4R9TA 2A45G 1LT9C 1N73A 2GY7A 1Z3UA 4ZFGA 2J0HA 2J0YA 2H43A 1RE4B 1RE4C 2HLOA 3H32A 3HUSB 3HUSC 3FIBA 2J0GA 4NYTA 1JY3P 1FZGB 1N86B 1FZGC 1N86C 2J3FD 2HODA 1RF1B 1RF1C 2HLOB 1FZBB 1LT9A 1FZBC 1LWUC 3BVHB 1FZDA 2J60A 3BVHC 2D39A 4M7FA 1JY2N 1RE4A 3HUSA 3E1IB 2J3UA 3E1IC 2JHLF 2Z4EB 1FZGA 2Z4EC 1N86A 1RF1A 1RE3B 1RE3C 4EPUA 1FZBA
chains in the Genus database with same CATH superfamily
1J1EB 2KSJA 2JHKF 2P58A 2WSSH 1VL2A 2E5TA 5APUA 3D70A 2KLVA 5APQA 4GKGA 1RHZB 1S4XA 1T2KC 1SLQA 2JEEA 2B88A 2H8PD 3H1JD 1HJ0A 2R5DA 2BCCG 2A06G 1SQXJ 3V2PA 1NGMB 1GL2B 1BSNA 1Z3SA 3F5HA 1S72P 1VQKP 2FXPA 1BCCJ 2K37A 1FJPA 5AW1B 1MZ9A 5CCHD 3V4WA 1SS1A 4BWNA 2P10A 3OW2O 1MUUA 4NYTA 4OGQD 2RKLA 4PJ0H 2D39A 3H1LD 3D6ZA 2QM8A 2K9YA 1FDIA 4LLHA 1ZLLA 1SQVG 1KFNA 3C1LA 1CI6B 3T97A 3FWLA 5B5EE 2LKMA 3MIWA 3AE8C 3O6QA 2Q9IC 1HGZA 3D71A 3CCRP 3C8VA 1JTHB 3B5NC 2E74C 3L75D 5GTIE 1N7SA 1ZP0C 1JNMA 1P84E 1HGVA 3II6A 3A2AA 1BGYE 3MHVA 5KAFH 2N1TD 1SQVK 2OYHB 1P84I 3L36A 3H25A 1IFMA 1FE6A 1VQ6P 1FZEC 2J5UA 4KHXA 1EDKA 1WMKA 2G3AA 1ZRTE 3MZWB 1KQFB 2I8DA 1M1JB 4JYBA 4WWIA 4IFDK 3CCLP 4U3FJ 5AW7B 2GA1A 3R2PA 2B89A 1PGOA 1Y47A 2CK3H 2G8YA 1GL2A 1H89A 2BEQD 2GUSA 3CCVP 3KXDA 1X9VA 2Y9ZA 2O1JA 2BCCJ 4R9TA 1ZR4A 2M3BA 1ZN5A 2OTLP 2J0HA 1T8ZA 3RL0C 1X79B 3V4QA 2Q1KA 3H1LG 2JWDA 2IYPA 1IC2A 3BCCG 2XDJA 2Y0CA 3H1ID 1XTCC 3H1KD 5E79E 2ZYDA 3LIEA 1NYHA 3MP7B 4R4MA 3H1JE 5AW4B 3A0BH 3AEFC 2QRXA 5GTHH 3TSIA 4IL6X 1CI6A 1R5SA 3AE7C 3L72G 3AE1C 1DEBA 1SQVJ 2K88A 1JTHA 1FIDA 1H8AA 2YIUC 2O01N 2AEFA 3CL3D 3TGUG 1NTKD 3VMXA 1KYOD 4WY4B 4ZNCA 3L73E 3RGUA 2J3GA 3RBXA 3RK3D 3CWBG 3RK2D 1EDIA 3P8MC 1M1JA 1NTMK 2C0XA 1HUCA 1PP9G 5KJ7D 3JSVC 2PGDA 4H44C 3V5BA 1OXZA 1M90Q 2KLUA 2N9YB 2R3SA 1SQQD 3F89A 2K9JB 2N9BA 2E5YA 3H1IG 1ZV8A 3HTKB 3L75E 4A7PA 3CC2P 3H1KG 1KTMA 2FBWC 3G71P 1D7MA 5K5GB 2W8ZA 1YJ9P 1IFIA 1BDCA 1RE3C 2NPSC 4NPDA 2WQYC 3W68A 3BCCJ 4RO0A 4C46A 2QJPB 3SWFA 2FFDB 1PGPA 3AEBC 1OFCX 2J1GA 1JY3O 1NU1G 4HYTB 2KUBA 1KB9D 1CSBA 4D6TG 4EI2A 2IPPA 1GK4A 1L0ND 1Q81Q 3NTNA 4JQ0D 4K3AA 4Y28J 1XTGB 3L72J 5KKZB 3KDPB 3V2QA 1N73B 1KORA 3IR9A 1L0LD 4I6MC 3OJAB 2CPBA 3QH9A 4WY4A 1NU1K 1NTMJ 2ZT9D 5APTA 2ZFCA 2P7JA 3BASA 2FYUE 3TGUJ 5CMZA 3AE2C 1VF5B 2FKWB 1HH0A 4NPEA 1RE4B 4DOJA 4PV1B 3BRTB 3CWBJ 1N7SD 1L4AC 1HTLC 1JY2N 3RK2B 1BCCD 1HBWA 4UB8H 3AE6C 4OGQC 2YKPA 2K9JA 3ABVC 3PTZA 3HTKA 5KTBA 1U7MA 2Z4EC 4I7ZB 3RL0g 2H89C 4LGDE 1NTKE 3L4FA 2ZXEB 2HPCC 3H1HG 2E43A 3V2RA 1LJ2A 3V6IA 2WPVB 2Q3IA 5KLIB 3RK3E 1FZCC 4JF7A 4IL6H 3KHUA 1GL2D 5B66H 4HH2A 3GHGC 4JYCA 1URQA 1R5LA 2JDIH 4EOTA 1NAYA 2N1TC 3SFEC 2Z5HA 3I55P 2FFDA 2Y9YA 4Y99C 1EXJA 2MJZA 1BDDA 2Z5IA 1PGQA 3Q5SA 4W80A 1L0LG 1KQGB 3B71A 2GM4A 1YQ4C 5C39A 4RJTA 1W5CE 4TT3H 3SWYA 2V7QJ 2NRGA 1GDTA 2PRRA 3KZIE 3CCJP 3PHLA 1NJIQ 4D6TJ 1SFCC 4H0LB 4YXDC 1P84D 1N73A 1IZNB 3A7OA 1OMIA 1BGYD 2IDBA 4MN4C 1BE3D 2Y0DA 4W7ZA 1FZGC 5CCGA 3CCQP 3B4SA 5TJHA 2J60A 2P1JA 3WUUA 2Q3EA 1DH3A 3A0HE 1RE4A 2YKOA 3MD0A 1WT6A 1USDA 3CX5H 4L75A 5KAIH 1KB9E 2JHHC 1NWQA 5CBNA 1JY2P 1KB9I 3FXEA 1FZAB 2V7QH 5KJ7A 3FGAD 4OVNF 1FZFC 4PJ0E 5KKZC 2E76C 1IK9A 5H2FH 5AVTB 4JPZB 4L74A 1GW3A 3AE3C 4PD4H 3OAKA 1A02F 3M0DA 2OYIC 4IFMA 3H1HJ 3K5BA 1ZW0A 2J5ZA 5DJUB 4LC1A 3VTPC 1VQ7P 4DT0A 2AEJA 1BGYG 1FAVA 1BCCE 3RK3C 4YXWH 2IZ0A 1NVOA 1GU4A 3CXHH 3H6PA 3AEEC 2OTJP 1SQPG 1DD4A 2IBZD 1KILB 4AYCA 2KOGA 4H13B 2R32A 3MUDA 1J1DB 3SWKA 2WWWA 5APXA 3GMAA 1AVOA 3L73D 2AXCA 2AXTH 1SQPK 2H88C 1HF9A 3E1RA 2J3FA 1J2JB 3LIDA 2IYOA 3S9OA 3USSA 2XNXB 1GZLA 2JHMF 4N6JA 1NTZD 4WY4D 1L2PA 2WPSA 2FYNC 1FZAA 1FC2C 3HE4B 4WBAA 2QSIA 3CLQA 5AVXB 3H1JG 2CPSA 3O8ZA 1BE3E 4U3FE 2WNPF 5CJ4A 2WPRA 3L74J 2J58A 2QJKC 5GTHE 1VQOP 1ZMEC 3EQ2A 3L71J 3H32B 5KLVD 3IAOA 1OX3A 2QA4P 2BCCE 3CCEP 1FU1A 1NKNA 2GY7A 3WU2E 3S1KA 4ZFGA 2ZT9C 1GMJA 3A5TA 4BRYB 5AW3B 2Q7CA 2ZJSE 3BRVB 3L73G 2FXOA 3SFDC 1NTMD 1KILA 1N7SC 2JHLF 3G4SP 4XFJA 1URQD 3L70D 4EPUA 1SQPJ 1LWUA 3FXDA 1LTGC 1J1EC 2YO2A 3GF7A 1QL2A 1AVYA 2C0WA 2WMMA 2FYUD 3L75G 2YXRB 2PP6A 3PLNA 2K1AA 4WB4A 5AW9B 1BSHA 2W90A 3BATA 1IJDB 2A45I 1H0TB 1QVFO 2XNXA 1YBKA 1GL2C 1JB0J 1S5LE 2QE7H 2QG4A 1FJKA 5GTIH 2OQQA 2E75B 2H7HA 2IBZE 2B87B 2KYVA 5CCGD 1AJYA 3HE4A 1S9KD 2H43B 2IBZI 2KI7B 1VF5D 3M9BA 1Q2NA 2HODB 1JCDA 1LT9B 2J59M 1VQ5P 4PV1D 1Y8AA 3H1JJ 1Q7YQ 3H32A 3HUSB 1OW6A 1VQ4P 1N86B 1RF1B 1VQNP 4JBZA 3CI9A 3BVHB 1SQBD 4BRYA 1NTZE 1OVVA 2ITAA 2IFMA 2OYOA 3C9IA 2KXPB 1N7LA 3EFFK 2ZVNB 2FYUG 4GT1A 3CCUP 1DIPA 5DJTB 1JC9A 2OYHC 1T3JA 1HJBA 4Z1MH 1G1IA 3SSUA 1KFMA 1OVUA 5KLVE 2WSCJ 3G9RA 1FIBA 1EXIA 3HRNA 1LTJB 3H1LJ 2HG5D 4GOFA 3VMYA 5AVRB 1W2EA 1GW4A 2KZIA 1NOHA 1URQB 1GU5A 1E79H 2K3RA 3PJSK 1M1JC 2IX7C 1RF0B 3HD7B 2Q5UA 4RKUJ 1H0TA 1NTKG 3L75J 3VP9A 1EQ7A 2QJYB 2WPQA 4H0LD 3JCUE 3VOPA 3A3YB 2YKQA 1VPCA 1NTME 3AECC 1KQLA 2B87A 3B5ND 4HJGH 1JM0A 2E42A 2PAJA 3L70E 2H43A 1AFOA 2HLOA 3GW6A 3WMM0 1AQ5A 1NTKK 4L73A 2J3FD 2HODA 5AVZB 1FZBB 1LT9A 5APSA 1LGHB 1PPJD 1SQQG 2UWJE 5CBOA 4M7FA 2D2CB 1SQXD 1MFZA 2WSCH 4GDOA 3HUSA 4UB6E 3E1IB 1N86A 2XU6A 1RF1A 1IK7A 3MTUE 3GLMA 3P32A 3VYIA 1M57D 5AVSB 3Q5RA 3BVHA 2M0BA 1VQ9P 5CCHC 4M7HA 1PZQA 1SQQK 1PP9J 3AEAC 3U1CA 1KC8Q 1S9KE 3ITKA 1HWTC 1YTZI 5APVA 3M91A 3H1IJ 3H1KJ 1G1JA 3M9HA 4WY4C 2MKVA 2WSEJ 3UIAA 3N7NA 5AVQB 2XV5A 2O3JA 2JO1A 3R4YA 1LTJA 3Q2YA 4N78D 1L0NG 2NZ2A 1S2EA 1Q86Q 3TF5A 1SQBE 1RF0A 3HD7A 1FOSF 1KILD 1EZVD 2KZJA 4L76A 1IFPA 4H13D 2JWAA 2M8RA 3M06A 5APWA 1MKMA 2O01J 1IFNA 2JR8A 3EWKA 3Q1MA 1L0NK 1OVRA 4XE5B 2RMZA 1PV3A 1VDFA 1NU1J 5AW0B 1YJNP 4EYYQ 2OGUA 1LTIC 1NAFA 2J3UA 1L0LK 1NHLA 2R44A 1USEA 3GG2A 1FZBA 4U3FD 5CHXA 2WSEH 2Q9IB 1YJWP 1BCCG 3B5NB 2E74B 4OWFA 3U1AA 1FOSE 1URQC 2P2UA 3E1IA 2QJPC 3N4XA 2FFDC 4M3LA 1CW5A 2DW3A 1SQQJ 3S4RA 1FICA 2BCCD 2A06D 4HKZH 1YYCA 2HFED 2ZVOB 1FZEB 3FX0A 1ZOYC 3Q3DA 1X0TA 3AEDC 2O01H 3I5CA 1YIJP 2ZAEB 1AA0A 4JZCA 4DCKA 1S1CX 5AVVB 1KYOH 1GK6A 2ZYAA 1YHQP 3NFQA 1N73C 3VMAA 3HE5A 1JMBA 4N3YB 5AVUB 1JY3N 2HR3A 1AQTA 2P67A 5TISH 1QVGO 4YTPC 1PPJE 3QWOC 2IZ1A 1SQXE 5CCGC 3ZDMA 2WZ7A 2LXCB 2QM7A 1VF5C 2L91A 3RL0B 1KMIZ 1RE4C 4OH8B 1SQVD 3NXSA 1CZQA 4PV1C 1L0NJ 5KAFE 1RH5B 4YPCA 3CCSP 4GODA 5L8RJ 3RK2C 1BE3G 4U3FG 3G6EP 1KD1Q 3IN6A 1K05A 3KZIH 2FXMA 1L0LJ 1FBMA 4I7ZC 4W7YA 5KJ7C 3KYQA 2XNDH 1DEEG 4ZKUA 3EFGA 1LWUB 1U7JA 2JKVA 2I1KA 2LXBA 3M0DC 2Q6QA 2YMYA 1PFIA 1KZUB 2YMKA 1M56D 1ZR2A 2Q9IA 3OA7A 5KLIC 4N78E 3B5NA 3NMDA 4TLFA 3PP5A 3A0HH 4CPGA 4DZOA 4EIJA 2J3OA 2YIUB 1YQ3C 2E75D 1KILE 1EZVE 2M3EA 2Y0EA 2QEXP 2RH0A 1N8RQ 1KB9H 4RESB 2W6AA 1FZEA 2W83C 1EZVI 1L4AD 2WT7B 3L74E 1A02J 1LTTC 1IFDA 3L71E 1S5LX 2M5AB 4H44B 3LW5J 4H0LC 2A45G 3BCCD 3A0BE 1PL5A 1Z3UA 3MUDC 2B9BA 3M9QA 4ASVA 1LTSC 5APYA 2I1JA 1JY3P 1Q90D 2RN0A 1SP4A 2IBZG 4HB1A 2A06E 1OW8A 2KNCB 2HYNA 3CC7P 5BU8B 3CC4P 1RE3B 1FDOA 2NPSB 1SQPE 3L72D 2BASA 3AEGC 2FIBA 5CJ0A 4ASWA 1JO5A 2R5BA 1FZAC 1BGYJ 2JP3A 1Q82Q 1BE3J 4DJGA 3TGUD 5BVZA 3KQGA 1SFCD 1MFTA 1QX8A 3LW5H 3M0AA 1KV4A 3HD7D 1OZHA 2PFXA 3CWBD 3Q5PA 1NTZG 3P7KA 5AW8B 1YTZT 2JHIF 2IFNA 1PP9D 2OARA 5EFWB 5AW6B 1SQVE 4IOIH 1QL1A 2KK7A 4KJMA 4XA4A 4JYOX 1JY2O 3P8CD 5B5EH 2OTKE 1GTWA 3D6YA 1Y9BA 3TNUB 2WT7A 2SPZA 2WITA 1NTZK 1OW7A 4ZKPA 1EDJA 5KLVG 1P84H 1KILC 3FIBA 2ZYGA 2J0GA 2D2CD 4H13C 2M5AA 1M1KQ 2HLOB 2E76D 1L4AB 1OIPA 1LWUC 3E7KA 1J1DC 1OWAA 3CX5D 3WUVA 4OGQB 1JMMA 3VN0A 1S3JA 3CMEP 2Z4EB 5KLVK 4QMAA 2KB7P 3L37A 3WUTA 3WU2H 1NTMG 1PGJA 1M7LA 3PH0A 1RQUA 1T2KD 2HPCB 4AQRD 2KNCA 2OYHA 1VQPP 1NH4A 1IFJA 3L70G 5BU5A 1R8EA 1NU1D 1X8YA 1RE3A 4D6TD 2NPSA 2XNXC 1UIIA 1FZCB 4PD4D 5AVYB 1QGKB 3GHGB 1E5WA 1NKZB 2V4HA 2N1TB 4Y99B 3H1LE 4KT0J 2W27A 2J64A 2J2PA 3BCCE 3L73J 3G3ZA 1W2BO 1LTBC 3IFMA 2C9LY 1QLED 2L5GB 4UB8E 5E79H 3V2NA 3CPWO 3H32C 2A45H 2W6BA 2AEMA 3AE9C 1LP1B 3CXHD 4C7NB 1LNQA 2FYUK 2KSEA 1SFCB 2KP8A 2LR2A 2ZXXA 1K73Q 1TU3F 2FYZA 1AV1A 1QEXA 1NTZJ 1S5LH 3L72E 1SVFA 1FZGB 3TNUA 1FZDA 4IL6E 3TK1A 3VP8A 5B66E 1KN7A 3TGUE 2E74D 5CCHA 3H1HD 5KLVJ 1L4AA 1SQBG 2J61B 2O1KA 1DD3A 3CWBE 1LT1A 1G2CB 2Z4EA 1PP9E 1T3UA 1FZFB 1GD2E 1N2DC 2E76B 3TDKA 1EC5A 3GF3A 1HVVA 4R4LA 1K04A 2HPCA 2BEZF 2FY8A 1SQBK 2C9NY 1NO4A 1T6AA 3P8CE 3TYYA 2OYIB 3H1IE 2QIWA 3CMAP 3H1KE 4IFFA 5M1BA 1FZCA 3FWNA 2YXQB 2XKMA 3GHGA 3L70J 2E75C 4R9JA 4I1LA 4C7RA 3PRJA 2N1TA 3B8EB 1VQLP 2XZRA 3W67A 2H43C 3RBZA 2HLOC 3HE5B 1YITP 3RL0D 3RK3B 3CX5E 2HODC 2FYUJ 2KS1B 1LT9C 5KAIE 3CCMP 2YNYA 2GUVA 3JC22 3CX5I 3L35A 3HUSC 2QVAA 4C7NA 1LP1A 1N86C 5AVWB 1SFCA 1RF1C 1KYOE 2WVRA 4EDFA 3BVHC 1EDLA 1NU1E 3JCUH 1MV8A 4BXLA 5H2FE 4D6TE 1KYOI 4K35A 2POHA 4PD4E 5TISE 2WSFJ 1FZGA 4NPFX 1YI2P 1DX7A 1PPJG 3L74D 3I56P 4PD4I 1SQXG 3AE5C 1NTKJ 1JCCA 1RY3A 1IO4A 3L71D 4AUWA 2YO3A 1SQQE 4ZMDA 2J61A 1FS0E 1X22A 3U59A 4UB6H 2W6JH 2FYNB 1G2CA 1SQBJ 1LTJC 3CXHE 1JEKA 4GIFA 1SQXK 3VMZA 1M8OB 1U57A 1FZFA 4B86A 1FDMA 3CXHI 1RF0C 3IF4A 3CD6P 3HD7C 3KPEA 2QJKB 2OYIA 4H44D 2WTYA 2QJYC 3AE4C 2JJLA 1SQPD 4O9BA 1JUNA 1WRGA 1ZXGA 1H88A 2WSFH 1RQVA 3MGNA 4U7JA 1PIXA 2AXTE 1ZRTD 1Z56A 1UIXA 2R3CA 4I2LC 3H1HE 2J0YA 2ZT9B 4WVZA 2VRSA 1EZVG 1LTAC 1K8AQ 3T97B 1KQSO 2KS1A 5AW2B 1L0NE 1FZBC 5AW5B 1K9MQ 3O6QB 1VQ8P 2D2CC 2NPSD 1N7SB 3L74G 1VQMP 3E1IC 4GOEA 1L0LE 2KIKA 1JOCA 3L71G
chains in the Genus database with same CATH topology
2BASA 1N7LA 2FIBA 4LGDE 1J1EB 5CJ0A 2KSJA 2JHKF 3L4FA 2ZXEB 2HPCC 1JO5A 5APUA 4GT1A 2R5BA 2E43A 3V2RA 1FZAC 2KLVA 5APQA 4GKGA 2Q3IA 1JC9A 2OYHC 1T2KC 1SLQA 1T3JA 1HJBA 1FZCC 4JF7A 2JEEA 5BVZA 3KQGA 1SFCD 1GL2D 1G1IA 2H8PD 4HH2A 3GHGC 1KFMA 3LW5H 1URQA 3M0AA 4JYCA 4EOTA 1FIBA 3HRNA 1LTJB 2N1TC 2HG5D 2Z5HA 3HD7D 3VMYA 2FFDA 5AVRB 2R5DA 1W2EA 4Y99C 1GW4A 2MJZA 2Z5IA 3V2PA 1NOHA 1URQB 1GU5A 1GL2B 1Z3SA 1M1JC 2IX7C 4W80A 3P7KA 1RF0B 5AW8B 1YTZT 2GM4A 3HD7B 2JHIF 2IFNA 2Q5UA 2OARA 5AW6B 3VP9A 1EQ7A 1QL1A 2WPQA 3SWYA 4XA4A 3VOPA 3A3YB 4JYOX 1JY2O 1GDTA 2YKQA 1VPCA 3P8CD 1FJPA 1GTWA 1KQLA 1SFCC 5AW1B 1MZ9A 3TNUB 2WT7A 1N73A 2WITA 5CCHD 3B5ND 1NTZK 3A7OA 3V4WA 4ZKPA 2E42A 2PAJA 2H43A 1AFOA 2HLOA 1MUUA 1KILC 3WMM0 3FIBA 2J0GA 4NYTA 1AQ5A 1NTKK 4W7ZA 1FZGC 5CCGA 2J3FD 2HODA 5AVZB 2HLOB 1FZBB 1LT9A 1L4AB 5APSA 1LWUC 2J60A 2D39A 1LGHB 1J1DC 2P1JA 2QM8A 4M7FA 1DH3A 1OWAA 4LLHA 1ZLLA 1RE4A 1MFZA 2WSCH 1JMMA 2YKOA 3VN0A 3HUSA 3E1IB 1KFNA 3MD0A 1CI6B 1WT6A 2Z4EB 1N86A 2XU6A 3T97A 5KLVK 1RF1A 2KB7P 3MTUE 2LKMA 3P32A 3MIWA 3VYIA 3L37A 5AVSB 2Q9IC 3BVHA 1HGZA 1M7LA 2JHHC 1JTHB 1NWQA 5CCHC 3B5NC 1T2KD 2HPCB 4M7HA 4AQRD 1N7SA 2OYHA 1JNMA 1JY2P 1HGVA 1NH4A 3II6A 1IFJA 1SQQK 3A2AA 5BU5A 3U1CA 1FZAB 1X8YA 1RE3A 5KJ7A 2N1TD 1SQVK 2OYHB 2NPSA 2XNXC 1FZFC 1FZCB 3L36A 1IK9A 5AVYB 5AVTB 1S9KE 3GHGB 1IFMA 1FZEC 1E5WA 1GW3A 1HWTC 1NKZB 1YTZI 4KHXA 2N1TB 3OAKA 5APVA 3M91A 4Y99B 1A02F 3M0DA 2OYIC 2W27A 2J64A 2J2PA 1G1JA 3M9HA 4WY4C 1M1JB 3G3ZA 3UIAA 4JYBA 1LTBC 3N7NA 3IFMA 4IFMA 5AVQB 2C9LY 2XV5A 4IFDK 5AW7B 2J5ZA 2L5GB 1LTJA 3R2PA 4N78D 4LC1A 3VTPC 1GL2A 1H89A 3V2NA 2GUSA 3H32C 2A45H 2W6BA 1RF0A 4C7NB 1FAVA 1X9VA 2FYUK 3HD7A 3RK3C 1FOSF 1KILD 1SFCB 1GU4A 2O1JA 4R9TA 2KP8A 1ZR4A 2FYZA 3H6PA 2M3BA 1ZN5A 2M8RA 2J0HA 3M06A 5APWA 1T8ZA 3RL0C 1X79B 3V4QA 1KILB 1IFNA 4AYCA 1SVFA 1FZGB 2KOGA 1L0NK 1IC2A 2XDJA 2R32A 3TNUA 4XE5B 1FZDA 1VDFA 3MUDA 1J1DB 5AW0B 3TK1A 1XTCC 3VP8A 2WWWA 5APXA 1LTIC 1NAFA 2J3UA 1L0LK 1NHLA 3LIEA 5CCHA 1SQPK 5AW4B 1FZBA 5CHXA 1L4AA 2WSEH 2Q9IB 2J61B 3B5NB 2O1KA 3U1AA 1FOSE 2J3FA 1URQC 1J2JB 3LIDA 2P2UA 3E1IA 3TSIA 1CI6A 3N4XA 1G2CB 2Z4EA 2FFDC 4M3LA 1CW5A 1T3UA 1FICA 2XNXB 1FZFB 1GD2E 1YYCA 1N2DC 1DEBA 1GZLA 2HFED 1JTHA 2JHMF 4N6JA 1FIDA 1HVVA 1FZEB 4WY4D 2HPCA 2WPSA 1H8AA 1SQBK 2C9NY 1NO4A 1FZAA 3P8CE 3TYYA 3HE4B 2OYIB 3CL3D 2O01H 3I5CA 3VMXA 4JZCA 4WY4B 4IFFA 1FZCA 4WBAA 3CLQA 5AVXB 2XKMA 5AVVB 2CPSA 3GHGA 1GK6A 2J3GA 3O8ZA 4R9JA 4I1LA 4C7RA 2WNPF 5CJ4A 2WPRA 3NFQA 2N1TA 2J58A 1N73C 3HE5A 3RK3D 3RK2D 3B8EB 4N3YB 2XZRA 3EQ2A 5AVUB 1JY3N 3P8MC 2H43C 3H32B 1M1JA 1NTMK 2C0XA 2P67A 2HLOC 1HUCA 3HE5B 3RL0D 3RK3B 5KJ7D 5CCGC 2HODC 1LT9C 1FU1A 2WZ7A 1NKNA 3V5BA 2GY7A 2QM7A 1OXZA 2YNYA 4ZFGA 2GUVA 3RL0B 3L35A 1RE4C 3A5TA 3HUSC 2N9BA 4OH8B 1ZV8A 3HTKB 3NXSA 4C7NA 5AW3B 1CZQA 2Q7CA 1N86C 5AVWB 1SFCA 3BRVB 1RF1C 3BVHC 1MV8A 3RK2C 1KILA 1N7SC 2POHA 1IFIA 2FXMA 2JHLF 1FZGA 1FBMA 1URQD 1RE3C 4W7YA 4EPUA 5KJ7C 1DX7A 2NPSC 1LWUA 3KYQA 1LTGC 1J1EC 4ZKUA 2YO2A 1JCCA 1RY3A 1QL2A 3EFGA 1IO4A 1LWUB 4C46A 3SWFA 2C0WA 2FFDB 2I1KA 4AUWA 2YO3A 3M0DC 2YMYA 1PFIA 1KZUB 1ZR2A 2Q9IA 3OA7A 2J61A 4N78E 3B5NA 2J1GA 3NMDA 3PP5A 1JY3O 4DZOA 4EIJA 2PP6A 2J3OA 4WB4A 3U59A 5AW9B 3BATA 4HYTB 1G2CA 1IJDB 1LTJC 4GIFA 1CSBA 2A45I 1SQXK 3VMZA 2IPPA 1GK4A 2XNXA 4B86A 1FZFA 1GL2C 1FJKA 1FDMA 4RESB 1RF0C 3NTNA 2W6AA 1FZEA 3HD7C 3KPEA 2H7HA 1L4AD 1XTGB 2KYVA 3KDPB 2WT7B 3V2QA 1N73B 3IR9A 5CCGD 3HE4A 2OYIA 1A02J 1LTTC 1IFDA 2WTYA 4I6MC 1S9KD 3OJAB 2CPBA 2H43B 2JJLA 4WY4A 4O9BA 1NU1K 1JUNA 3M9BA 1WRGA 1H88A 2WSFH 5APTA 3MGNA 2ZFCA 2HODB 1JCDA 1Z56A 2P7JA 3BASA 1LT9B 2J59M 2R3CA 2A45G 4I2LC 5CMZA 1Z3UA 3M9QA 2FKWB 1LTSC 1HH0A 2J0YA 1RE4B 3H32A 3HUSB 2VRSA 5APYA 2I1JA 4DOJA 1JY3P 1LTAC 1N86B 3BRTB 1RF1B 1N7SD 5AW2B 1FZBC 1SP4A 1L4AC 3CI9A 5AW5B 3BVHB 1HTLC 1JY2N 3RK2B 1HBWA 2NPSD 1N7SB 2YKPA 2HYNA 3E1IC 5BU8B 3HTKA 5KTBA 2Z4EC 1RE3B 1JOCA 2IFMA 3C9IA 2NPSB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q9I B;  1LWU A;  2Q9I C;  3BVH A;  2J61 B;  2FIB A;  2JHH C;  2JHK F;  2HPC B;  4M7H A;  2HPC C;  2J3F A;  1LWU B;  2OYH A;  1JY2 P;  3E1I A;  2Z4E A;  2FFD B;  1FZA B;  2FFD C;  1FZA C;  1RE3 A;  1T3U A;  1FIC A;  2XNX B;  1FZF B;  1JC9 A;  2OYH B;  2XNX C;  1FZF C;  2OYH C;  2Q9I A;  1FZC B;  2J61 A;  1FZC C;  2J1G A;  2JHM F;  1FID A;  1JY3 O;  1FZE B;  3GHG B;  1FZE C;  2HPC A;  3GHG C;  2J3O A;  1FIB A;  1LTJ B;  1LTJ C;  2A45 I;  2FFD A;  1FZA A;  1W2E A;  2OYI B;  2OYI C;  2J64 A;  2J2P A;  2XNX A;  1FZF A;  4JZC A;  1M1J B;  1Z3S A;  1M1J C;  1FZC A;  1RF0 B;  1RF0 C;  1FZE A;  2JHI F;  3GHG A;  2J3G A;  4R9J A;  2WNP F;  2J5Z A;  1N73 B;  1LTJ A;  1N73 C;  2OYI A;  2H43 B;  1JY3 N;  2H43 C;  3H32 B;  1M1J A;  2HLO C;  3H32 C;  4JYO X;  2A45 H;  1JY2 O;  1RF0 A;  2HOD B;  2HOD C;  1LT9 B;  4R9T A;  2A45 G;  1LT9 C;  1N73 A;  2GY7 A;  1Z3U A;  4ZFG A;  2J0H A;  2J0Y A;  2H43 A;  1RE4 B;  1RE4 C;  2HLO A;  3H32 A;  3HUS B;  3HUS C;  3FIB A;  2J0G A;  4NYT A;  1JY3 P;  1FZG B;  1N86 B;  1FZG C;  1N86 C;  2J3F D;  2HOD A;  1RF1 B;  1RF1 C;  2HLO B;  1FZB B;  1LT9 A;  1FZB C;  1LWU C;  3BVH B;  1FZD A;  2J60 A;  3BVH C;  2D39 A;  4M7F A;  1JY2 N;  1RE4 A;  3HUS A;  3E1I B;  2J3U A;  3E1I C;  2JHL F;  2Z4E B;  1FZG A;  2Z4E C;  1N86 A;  1RF1 A;  1RE3 B;  1RE3 C;  4EPU A;  1FZB A; 
#chains in the Genus database with same CATH topology
 1J1E B;  2KSJ A;  2JHK F;  2P58 A;  2WSS H;  1VL2 A;  2E5T A;  5APU A;  3D70 A;  2KLV A;  5APQ A;  4GKG A;  1RHZ B;  1S4X A;  1T2K C;  1SLQ A;  2JEE A;  2B88 A;  2H8P D;  3H1J D;  1HJ0 A;  2R5D A;  2BCC G;  2A06 G;  1SQX J;  3V2P A;  1NGM B;  1GL2 B;  1BSN A;  1Z3S A;  3F5H A;  1S72 P;  1VQK P;  2FXP A;  1BCC J;  2K37 A;  1FJP A;  5AW1 B;  1MZ9 A;  5CCH D;  3V4W A;  1SS1 A;  4BWN A;  2P10 A;  3OW2 O;  1MUU A;  4NYT A;  4OGQ D;  2RKL A;  4PJ0 H;  2D39 A;  3H1L D;  3D6Z A;  2QM8 A;  2K9Y A;  1FDI A;  4LLH A;  1ZLL A;  1SQV G;  1KFN A;  3C1L A;  1CI6 B;  3T97 A;  3FWL A;  5B5E E;  2LKM A;  3MIW A;  3AE8 C;  3O6Q A;  2Q9I C;  1HGZ A;  3D71 A;  3CCR P;  3C8V A;  1JTH B;  3B5N C;  2E74 C;  3L75 D;  5GTI E;  1N7S A;  1ZP0 C;  1JNM A;  1P84 E;  1HGV A;  3II6 A;  3A2A A;  1BGY E;  3MHV A;  5KAF H;  2N1T D;  1SQV K;  2OYH B;  1P84 I;  3L36 A;  3H25 A;  1IFM A;  1FE6 A;  1VQ6 P;  1FZE C;  2J5U A;  4KHX A;  1EDK A;  1WMK A;  2G3A A;  1ZRT E;  3MZW B;  1KQF B;  2I8D A;  1M1J B;  4JYB A;  4WWI A;  4IFD K;  3CCL P;  4U3F J;  5AW7 B;  2GA1 A;  3R2P A;  2B89 A;  1PGO A;  1Y47 A;  2CK3 H;  2G8Y A;  1GL2 A;  1H89 A;  2BEQ D;  2GUS A;  3CCV P;  3KXD A;  1X9V A;  2Y9Z A;  2O1J A;  2BCC J;  4R9T A;  1ZR4 A;  2M3B A;  1ZN5 A;  2OTL P;  2J0H A;  1T8Z A;  3RL0 C;  1X79 B;  3V4Q A;  2Q1K A;  3H1L G;  2JWD A;  2IYP A;  1IC2 A;  3BCC G;  2XDJ A;  2Y0C A;  3H1I D;  1XTC C;  3H1K D;  5E79 E;  2ZYD A;  3LIE A;  1NYH A;  3MP7 B;  4R4M A;  3H1J E;  5AW4 B;  3A0B H;  3AEF C;  2QRX A;  5GTH H;  3TSI A;  4IL6 X;  1CI6 A;  1R5S A;  3AE7 C;  3L72 G;  3AE1 C;  1DEB A;  1SQV J;  2K88 A;  1JTH A;  1FID A;  1H8A A;  2YIU C;  2O01 N;  2AEF A;  3CL3 D;  3TGU G;  1NTK D;  3VMX A;  1KYO D;  4WY4 B;  4ZNC A;  3L73 E;  3RGU A;  2J3G A;  3RBX A;  3RK3 D;  3CWB G;  3RK2 D;  1EDI A;  3P8M C;  1M1J A;  1NTM K;  2C0X A;  1HUC A;  1PP9 G;  5KJ7 D;  3JSV C;  2PGD A;  4H44 C;  3V5B A;  1OXZ A;  1M90 Q;  2KLU A;  2N9Y B;  2R3S A;  1SQQ D;  3F89 A;  2K9J B;  2N9B A;  2E5Y A;  3H1I G;  1ZV8 A;  3HTK B;  3L75 E;  4A7P A;  3CC2 P;  3H1K G;  1KTM A;  2FBW C;  3G71 P;  1D7M A;  5K5G B;  2W8Z A;  1YJ9 P;  1IFI A;  1BDC A;  1RE3 C;  2NPS C;  4NPD A;  2WQY C;  3W68 A;  3BCC J;  4RO0 A;  4C46 A;  2QJP B;  3SWF A;  2FFD B;  1PGP A;  3AEB C;  1OFC X;  2J1G A;  1JY3 O;  1NU1 G;  4HYT B;  2KUB A;  1KB9 D;  1CSB A;  4D6T G;  4EI2 A;  2IPP A;  1GK4 A;  1L0N D;  1Q81 Q;  3NTN A;  4JQ0 D;  4K3A A;  4Y28 J;  1XTG B;  3L72 J;  5KKZ B;  3KDP B;  3V2Q A;  1N73 B;  1KOR A;  3IR9 A;  1L0L D;  4I6M C;  3OJA B;  2CPB A;  3QH9 A;  4WY4 A;  1NU1 K;  1NTM J;  2ZT9 D;  5APT A;  2ZFC A;  2P7J A;  3BAS A;  2FYU E;  3TGU J;  5CMZ A;  3AE2 C;  1VF5 B;  2FKW B;  1HH0 A;  4NPE A;  1RE4 B;  4DOJ A;  4PV1 B;  3BRT B;  3CWB J;  1N7S D;  1L4A C;  1HTL C;  1JY2 N;  3RK2 B;  1BCC D;  1HBW A;  4UB8 H;  3AE6 C;  4OGQ C;  2YKP A;  2K9J A;  3ABV C;  3PTZ A;  3HTK A;  5KTB A;  1U7M A;  2Z4E C;  4I7Z B;  3RL0 g;  2H89 C;  4LGD E;  1NTK E;  3L4F A;  2ZXE B;  2HPC C;  3H1H G;  2E43 A;  3V2R A;  1LJ2 A;  3V6I A;  2WPV B;  2Q3I A;  5KLI B;  3RK3 E;  1FZC C;  4JF7 A;  4IL6 H;  3KHU A;  1GL2 D;  5B66 H;  4HH2 A;  3GHG C;  4JYC A;  1URQ A;  1R5L A;  2JDI H;  4EOT A;  1NAY A;  2N1T C;  3SFE C;  2Z5H A;  3I55 P;  2FFD A;  2Y9Y A;  4Y99 C;  1EXJ A;  2MJZ A;  1BDD A;  2Z5I A;  1PGQ A;  3Q5S A;  4W80 A;  1L0L G;  1KQG B;  3B71 A;  2GM4 A;  1YQ4 C;  5C39 A;  4RJT A;  1W5C E;  4TT3 H;  3SWY A;  2V7Q J;  2NRG A;  1GDT A;  2PRR A;  3KZI E;  3CCJ P;  3PHL A;  1NJI Q;  4D6T J;  1SFC C;  4H0L B;  4YXD C;  1P84 D;  1N73 A;  1IZN B;  3A7O A;  1OMI A;  1BGY D;  2IDB A;  4MN4 C;  1BE3 D;  2Y0D A;  4W7Z A;  1FZG C;  5CCG A;  3CCQ P;  3B4S A;  5TJH A;  2J60 A;  2P1J A;  3WUU A;  2Q3E A;  1DH3 A;  3A0H E;  1RE4 A;  2YKO A;  3MD0 A;  1WT6 A;  1USD A;  3CX5 H;  4L75 A;  5KAI H;  1KB9 E;  2JHH C;  1NWQ A;  5CBN A;  1JY2 P;  1KB9 I;  3FXE A;  1FZA B;  2V7Q H;  5KJ7 A;  3FGA D;  4OVN F;  1FZF C;  4PJ0 E;  5KKZ C;  2E76 C;  1IK9 A;  5H2F H;  5AVT B;  4JPZ B;  4L74 A;  1GW3 A;  3AE3 C;  4PD4 H;  3OAK A;  1A02 F;  3M0D A;  2OYI C;  4IFM A;  3H1H J;  3K5B A;  1ZW0 A;  2J5Z A;  5DJU B;  4LC1 A;  3VTP C;  1VQ7 P;  4DT0 A;  2AEJ A;  1BGY G;  1FAV A;  1BCC E;  3RK3 C;  4YXW H;  2IZ0 A;  1NVO A;  1GU4 A;  3CXH H;  3H6P A;  3AEE C;  2OTJ P;  1SQP G;  1DD4 A;  2IBZ D;  1KIL B;  4AYC A;  2KOG A;  4H13 B;  2R32 A;  3MUD A;  1J1D B;  3SWK A;  2WWW A;  5APX A;  3GMA A;  1AVO A;  3L73 D;  2AXC A;  2AXT H;  1SQP K;  2H88 C;  1HF9 A;  3E1R A;  2J3F A;  1J2J B;  3LID A;  2IYO A;  3S9O A;  3USS A;  2XNX B;  1GZL A;  2JHM F;  4N6J A;  1NTZ D;  4WY4 D;  1L2P A;  2WPS A;  2FYN C;  1FZA A;  1FC2 C;  3HE4 B;  4WBA A;  2QSI A;  3CLQ A;  5AVX B;  3H1J G;  2CPS A;  3O8Z A;  1BE3 E;  4U3F E;  2WNP F;  5CJ4 A;  2WPR A;  3L74 J;  2J58 A;  2QJK C;  5GTH E;  1VQO P;  1ZME C;  3EQ2 A;  3L71 J;  3H32 B;  5KLV D;  3IAO A;  1OX3 A;  2QA4 P;  2BCC E;  3CCE P;  1FU1 A;  1NKN A;  2GY7 A;  3WU2 E;  3S1K A;  4ZFG A;  2ZT9 C;  1GMJ A;  3A5T A;  4BRY B;  5AW3 B;  2Q7C A;  2ZJS E;  3BRV B;  3L73 G;  2FXO A;  3SFD C;  1NTM D;  1KIL A;  1N7S C;  2JHL F;  3G4S P;  4XFJ A;  1URQ D;  3L70 D;  4EPU A;  1SQP J;  1LWU A;  3FXD A;  1LTG C;  1J1E C;  2YO2 A;  3GF7 A;  1QL2 A;  1AVY A;  2C0W A;  2WMM A;  2FYU D;  3L75 G;  2YXR B;  2PP6 A;  3PLN A;  2K1A A;  4WB4 A;  5AW9 B;  1BSH A;  2W90 A;  3BAT A;  1IJD B;  2A45 I;  1H0T B;  1QVF O;  2XNX A;  1YBK A;  1GL2 C;  1JB0 J;  1S5L E;  2QE7 H;  2QG4 A;  1FJK A;  5GTI H;  2OQQ A;  2E75 B;  2H7H A;  2IBZ E;  2B87 B;  2KYV A;  5CCG D;  1AJY A;  3HE4 A;  1S9K D;  2H43 B;  2IBZ I;  2KI7 B;  1VF5 D;  3M9B A;  1Q2N A;  2HOD B;  1JCD A;  1LT9 B;  2J59 M;  1VQ5 P;  4PV1 D;  1Y8A A;  3H1J J;  1Q7Y Q;  3H32 A;  3HUS B;  1OW6 A;  1VQ4 P;  1N86 B;  1RF1 B;  1VQN P;  4JBZ A;  3CI9 A;  3BVH B;  1SQB D;  4BRY A;  1NTZ E;  1OVV A;  2ITA A;  2IFM A;  2OYO A;  3C9I A;  2KXP B;  1N7L A;  3EFF K;  2ZVN B;  2FYU G;  4GT1 A;  3CCU P;  1DIP A;  5DJT B;  1JC9 A;  2OYH C;  1T3J A;  1HJB A;  4Z1M H;  1G1I A;  3SSU A;  1KFM A;  1OVU A;  5KLV E;  2WSC J;  3G9R A;  1FIB A;  1EXI A;  3HRN A;  1LTJ B;  3H1L J;  2HG5 D;  4GOF A;  3VMY A;  5AVR B;  1W2E A;  1GW4 A;  2KZI A;  1NOH A;  1URQ B;  1GU5 A;  1E79 H;  2K3R A;  3PJS K;  1M1J C;  2IX7 C;  1RF0 B;  3HD7 B;  2Q5U A;  4RKU J;  1H0T A;  1NTK G;  3L75 J;  3VP9 A;  1EQ7 A;  2QJY B;  2WPQ A;  4H0L D;  3JCU E;  3VOP A;  3A3Y B;  2YKQ A;  1VPC A;  1NTM E;  3AEC C;  1KQL A;  2B87 A;  3B5N D;  4HJG H;  1JM0 A;  2E42 A;  2PAJ A;  3L70 E;  2H43 A;  1AFO A;  2HLO A;  3GW6 A;  3WMM 0;  1AQ5 A;  1NTK K;  4L73 A;  2J3F D;  2HOD A;  5AVZ B;  1FZB B;  1LT9 A;  5APS A;  1LGH B;  1PPJ D;  1SQQ G;  2UWJ E;  5CBO A;  4M7F A;  2D2C B;  1SQX D;  1MFZ A;  2WSC H;  4GDO A;  3HUS A;  4UB6 E;  3E1I B;  1N86 A;  2XU6 A;  1RF1 A;  1IK7 A;  3MTU E;  3GLM A;  3P32 A;  3VYI A;  1M57 D;  5AVS B;  3Q5R A;  3BVH A;  2M0B A;  1VQ9 P;  5CCH C;  4M7H A;  1PZQ A;  1SQQ K;  1PP9 J;  3AEA C;  3U1C A;  1KC8 Q;  1S9K E;  3ITK A;  1HWT C;  1YTZ I;  5APV A;  3M91 A;  3H1I J;  3H1K J;  1G1J A;  3M9H A;  4WY4 C;  2MKV A;  2WSE J;  3UIA A;  3N7N A;  5AVQ B;  2XV5 A;  2O3J A;  2JO1 A;  3R4Y A;  1LTJ A;  3Q2Y A;  4N78 D;  1L0N G;  2NZ2 A;  1S2E A;  1Q86 Q;  3TF5 A;  1SQB E;  1RF0 A;  3HD7 A;  1FOS F;  1KIL D;  1EZV D;  2KZJ A;  4L76 A;  1IFP A;  4H13 D;  2JWA A;  2M8R A;  3M06 A;  5APW A;  1MKM A;  2O01 J;  1IFN A;  2JR8 A;  3EWK A;  3Q1M A;  1L0N K;  1OVR A;  4XE5 B;  2RMZ A;  1PV3 A;  1VDF A;  1NU1 J;  5AW0 B;  1YJN P;  4EYY Q;  2OGU A;  1LTI C;  1NAF A;  2J3U A;  1L0L K;  1NHL A;  2R44 A;  1USE A;  3GG2 A;  1FZB A;  4U3F D;  5CHX A;  2WSE H;  2Q9I B;  1YJW P;  1BCC G;  3B5N B;  2E74 B;  4OWF A;  3U1A A;  1FOS E;  1URQ C;  2P2U A;  3E1I A;  2QJP C;  3N4X A;  2FFD C;  4M3L A;  1CW5 A;  2DW3 A;  1SQQ J;  3S4R A;  1FIC A;  2BCC D;  2A06 D;  4HKZ H;  1YYC A;  2HFE D;  2ZVO B;  1FZE B;  3FX0 A;  1ZOY C;  3Q3D A;  1X0T A;  3AED C;  2O01 H;  3I5C A;  1YIJ P;  2ZAE B;  1AA0 A;  4JZC A;  4DCK A;  1S1C X;  5AVV B;  1KYO H;  1GK6 A;  2ZYA A;  1YHQ P;  3NFQ A;  1N73 C;  3VMA A;  3HE5 A;  1JMB A;  4N3Y B;  5AVU B;  1JY3 N;  2HR3 A;  1AQT A;  2P67 A;  5TIS H;  1QVG O;  4YTP C;  1PPJ E;  3QWO C;  2IZ1 A;  1SQX E;  5CCG C;  3ZDM A;  2WZ7 A;  2LXC B;  2QM7 A;  1VF5 C;  2L91 A;  3RL0 B;  1KMI Z;  1RE4 C;  4OH8 B;  1SQV D;  3NXS A;  1CZQ A;  4PV1 C;  1L0N J;  5KAF E;  1RH5 B;  4YPC A;  3CCS P;  4GOD A;  5L8R J;  3RK2 C;  1BE3 G;  4U3F G;  3G6E P;  1KD1 Q;  3IN6 A;  1K05 A;  3KZI H;  2FXM A;  1L0L J;  1FBM A;  4I7Z C;  4W7Y A;  5KJ7 C;  3KYQ A;  2XND H;  1DEE G;  4ZKU A;  3EFG A;  1LWU B;  1U7J A;  2JKV A;  2I1K A;  2LXB A;  3M0D C;  2Q6Q A;  2YMY A;  1PFI A;  1KZU B;  2YMK A;  1M56 D;  1ZR2 A;  2Q9I A;  3OA7 A;  5KLI C;  4N78 E;  3B5N A;  3NMD A;  4TLF A;  3PP5 A;  3A0H H;  4CPG A;  4DZO A;  4EIJ A;  2J3O A;  2YIU B;  1YQ3 C;  2E75 D;  1KIL E;  1EZV E;  2M3E A;  2Y0E A;  2QEX P;  2RH0 A;  1N8R Q;  1KB9 H;  4RES B;  2W6A A;  1FZE A;  2W83 C;  1EZV I;  1L4A D;  2WT7 B;  3L74 E;  1A02 J;  1LTT C;  1IFD A;  3L71 E;  1S5L X;  2M5A B;  4H44 B;  3LW5 J;  4H0L C;  2A45 G;  3BCC D;  3A0B E;  1PL5 A;  1Z3U A;  3MUD C;  2B9B A;  3M9Q A;  4ASV A;  1LTS C;  5APY A;  2I1J A;  1JY3 P;  1Q90 D;  2RN0 A;  1SP4 A;  2IBZ G;  4HB1 A;  2A06 E;  1OW8 A;  2KNC B;  2HYN A;  3CC7 P;  5BU8 B;  3CC4 P;  1RE3 B;  1FDO A;  2NPS B;  1SQP E;  3L72 D;  2BAS A;  3AEG C;  2FIB A;  5CJ0 A;  4ASW A;  1JO5 A;  2R5B A;  1FZA C;  1BGY J;  2JP3 A;  1Q82 Q;  1BE3 J;  4DJG A;  3TGU D;  5BVZ A;  3KQG A;  1SFC D;  1MFT A;  1QX8 A;  3LW5 H;  3M0A A;  1KV4 A;  3HD7 D;  1OZH A;  2PFX A;  3CWB D;  3Q5P A;  1NTZ G;  3P7K A;  5AW8 B;  1YTZ T;  2JHI F;  2IFN A;  1PP9 D;  2OAR A;  5EFW B;  5AW6 B;  1SQV E;  4IOI H;  1QL1 A;  2KK7 A;  4KJM A;  4XA4 A;  4JYO X;  1JY2 O;  3P8C D;  5B5E H;  2OTK E;  1GTW A;  3D6Y A;  1Y9B A;  3TNU B;  2WT7 A;  2SPZ A;  2WIT A;  1NTZ K;  1OW7 A;  4ZKP A;  1EDJ A;  5KLV G;  1P84 H;  1KIL C;  3FIB A;  2ZYG A;  2J0G A;  2D2C D;  4H13 C;  2M5A A;  1M1K Q;  2HLO B;  2E76 D;  1L4A B;  1OIP A;  1LWU C;  3E7K A;  1J1D C;  1OWA A;  3CX5 D;  3WUV A;  4OGQ B;  1JMM A;  3VN0 A;  1S3J A;  3CME P;  2Z4E B;  5KLV K;  4QMA A;  2KB7 P;  3L37 A;  3WUT A;  3WU2 H;  1NTM G;  1PGJ A;  1M7L A;  3PH0 A;  1RQU A;  1T2K D;  2HPC B;  4AQR D;  2KNC A;  2OYH A;  1VQP P;  1NH4 A;  1IFJ A;  3L70 G;  5BU5 A;  1R8E A;  1NU1 D;  1X8Y A;  1RE3 A;  4D6T D;  2NPS A;  2XNX C;  1UII A;  1FZC B;  4PD4 D;  5AVY B;  1QGK B;  3GHG B;  1E5W A;  1NKZ B;  2V4H A;  2N1T B;  4Y99 B;  3H1L E;  4KT0 J;  2W27 A;  2J64 A;  2J2P A;  3BCC E;  3L73 J;  3G3Z A;  1W2B O;  1LTB C;  3IFM A;  2C9L Y;  1QLE D;  2L5G B;  4UB8 E;  5E79 H;  3V2N A;  3CPW O;  3H32 C;  2A45 H;  2W6B A;  2AEM A;  3AE9 C;  1LP1 B;  3CXH D;  4C7N B;  1LNQ A;  2FYU K;  2KSE A;  1SFC B;  2KP8 A;  2LR2 A;  2ZXX A;  1K73 Q;  1TU3 F;  2FYZ A;  1AV1 A;  1QEX A;  1NTZ J;  1S5L H;  3L72 E;  1SVF A;  1FZG B;  3TNU A;  1FZD A;  4IL6 E;  3TK1 A;  3VP8 A;  5B66 E;  1KN7 A;  3TGU E;  2E74 D;  5CCH A;  3H1H D;  5KLV J;  1L4A A;  1SQB G;  2J61 B;  2O1K A;  1DD3 A;  3CWB E;  1LT1 A;  1G2C B;  2Z4E A;  1PP9 E;  1T3U A;  1FZF B;  1GD2 E;  1N2D C;  2E76 B;  3TDK A;  1EC5 A;  3GF3 A;  1HVV A;  4R4L A;  1K04 A;  2HPC A;  2BEZ F;  2FY8 A;  1SQB K;  2C9N Y;  1NO4 A;  1T6A A;  3P8C E;  3TYY A;  2OYI B;  3H1I E;  2QIW A;  3CMA P;  3H1K E;  4IFF A;  5M1B A;  1FZC A;  3FWN A;  2YXQ B;  2XKM A;  3GHG A;  3L70 J;  2E75 C;  4R9J A;  4I1L A;  4C7R A;  3PRJ A;  2N1T A;  3B8E B;  1VQL P;  2XZR A;  3W67 A;  2H43 C;  3RBZ A;  2HLO C;  3HE5 B;  1YIT P;  3RL0 D;  3RK3 B;  3CX5 E;  2HOD C;  2FYU J;  2KS1 B;  1LT9 C;  5KAI E;  3CCM P;  2YNY A;  2GUV A;  3JC2 2;  3CX5 I;  3L35 A;  3HUS C;  2QVA A;  4C7N A;  1LP1 A;  1N86 C;  5AVW B;  1SFC A;  1RF1 C;  1KYO E;  2WVR A;  4EDF A;  3BVH C;  1EDL A;  1NU1 E;  3JCU H;  1MV8 A;  4BXL A;  5H2F E;  4D6T E;  1KYO I;  4K35 A;  2POH A;  4PD4 E;  5TIS E;  2WSF J;  1FZG A;  4NPF X;  1YI2 P;  1DX7 A;  1PPJ G;  3L74 D;  3I56 P;  4PD4 I;  1SQX G;  3AE5 C;  1NTK J;  1JCC A;  1RY3 A;  1IO4 A;  3L71 D;  4AUW A;  2YO3 A;  1SQQ E;  4ZMD A;  2J61 A;  1FS0 E;  1X22 A;  3U59 A;  4UB6 H;  2W6J H;  2FYN B;  1G2C A;  1SQB J;  1LTJ C;  3CXH E;  1JEK A;  4GIF A;  1SQX K;  3VMZ A;  1M8O B;  1U57 A;  1FZF A;  4B86 A;  1FDM A;  3CXH I;  1RF0 C;  3IF4 A;  3CD6 P;  3HD7 C;  3KPE A;  2QJK B;  2OYI A;  4H44 D;  2WTY A;  2QJY C;  3AE4 C;  2JJL A;  1SQP D;  4O9B A;  1JUN A;  1WRG A;  1ZXG A;  1H88 A;  2WSF H;  1RQV A;  3MGN A;  4U7J A;  1PIX A;  2AXT E;  1ZRT D;  1Z56 A;  1UIX A;  2R3C A;  4I2L C;  3H1H E;  2J0Y A;  2ZT9 B;  4WVZ A;  2VRS A;  1EZV G;  1LTA C;  1K8A Q;  3T97 B;  1KQS O;  2KS1 A;  5AW2 B;  1L0N E;  1FZB C;  5AW5 B;  1K9M Q;  3O6Q B;  1VQ8 P;  2D2C C;  2NPS D;  1N7S B;  3L74 G;  1VQM P;  3E1I C;  4GOE A;  1L0L E;  2KIK A;  1JOC A;  3L71 G; 
#chains in the Genus database with same CATH homology
 2BAS A;  1N7L A;  2FIB A;  4LGD E;  1J1E B;  5CJ0 A;  2KSJ A;  2JHK F;  3L4F A;  2ZXE B;  2HPC C;  1JO5 A;  5APU A;  4GT1 A;  2R5B A;  2E43 A;  3V2R A;  1FZA C;  2KLV A;  5APQ A;  4GKG A;  2Q3I A;  1JC9 A;  2OYH C;  1T2K C;  1SLQ A;  1T3J A;  1HJB A;  1FZC C;  4JF7 A;  2JEE A;  5BVZ A;  3KQG A;  1SFC D;  1GL2 D;  1G1I A;  2H8P D;  4HH2 A;  3GHG C;  1KFM A;  3LW5 H;  1URQ A;  3M0A A;  4JYC A;  4EOT A;  1FIB A;  3HRN A;  1LTJ B;  2N1T C;  2HG5 D;  2Z5H A;  3HD7 D;  3VMY A;  2FFD A;  5AVR B;  2R5D A;  1W2E A;  4Y99 C;  1GW4 A;  2MJZ A;  2Z5I A;  3V2P A;  1NOH A;  1URQ B;  1GU5 A;  1GL2 B;  1Z3S A;  1M1J C;  2IX7 C;  4W80 A;  3P7K A;  1RF0 B;  5AW8 B;  1YTZ T;  2GM4 A;  3HD7 B;  2JHI F;  2IFN A;  2Q5U A;  2OAR A;  5AW6 B;  3VP9 A;  1EQ7 A;  1QL1 A;  2WPQ A;  3SWY A;  4XA4 A;  3VOP A;  3A3Y B;  4JYO X;  1JY2 O;  1GDT A;  2YKQ A;  1VPC A;  3P8C D;  1FJP A;  1GTW A;  1KQL A;  1SFC C;  5AW1 B;  1MZ9 A;  3TNU B;  2WT7 A;  1N73 A;  2WIT A;  5CCH D;  3B5N D;  1NTZ K;  3A7O A;  3V4W A;  4ZKP A;  2E42 A;  2PAJ A;  2H43 A;  1AFO A;  2HLO A;  1MUU A;  1KIL C;  3WMM 0;  3FIB A;  2J0G A;  4NYT A;  1AQ5 A;  1NTK K;  4W7Z A;  1FZG C;  5CCG A;  2J3F D;  2HOD A;  5AVZ B;  2HLO B;  1FZB B;  1LT9 A;  1L4A B;  5APS A;  1LWU C;  2J60 A;  2D39 A;  1LGH B;  1J1D C;  2P1J A;  2QM8 A;  4M7F A;  1DH3 A;  1OWA A;  4LLH A;  1ZLL A;  1RE4 A;  1MFZ A;  2WSC H;  1JMM A;  2YKO A;  3VN0 A;  3HUS A;  3E1I B;  1KFN A;  3MD0 A;  1CI6 B;  1WT6 A;  2Z4E B;  1N86 A;  2XU6 A;  3T97 A;  5KLV K;  1RF1 A;  2KB7 P;  3MTU E;  2LKM A;  3P32 A;  3MIW A;  3VYI A;  3L37 A;  5AVS B;  2Q9I C;  3BVH A;  1HGZ A;  1M7L A;  2JHH C;  1JTH B;  1NWQ A;  5CCH C;  3B5N C;  1T2K D;  2HPC B;  4M7H A;  4AQR D;  1N7S A;  2OYH A;  1JNM A;  1JY2 P;  1HGV A;  1NH4 A;  3II6 A;  1IFJ A;  1SQQ K;  3A2A A;  5BU5 A;  3U1C A;  1FZA B;  1X8Y A;  1RE3 A;  5KJ7 A;  2N1T D;  1SQV K;  2OYH B;  2NPS A;  2XNX C;  1FZF C;  1FZC B;  3L36 A;  1IK9 A;  5AVY B;  5AVT B;  1S9K E;  3GHG B;  1IFM A;  1FZE C;  1E5W A;  1GW3 A;  1HWT C;  1NKZ B;  1YTZ I;  4KHX A;  2N1T B;  3OAK A;  5APV A;  3M91 A;  4Y99 B;  1A02 F;  3M0D A;  2OYI C;  2W27 A;  2J64 A;  2J2P A;  1G1J A;  3M9H A;  4WY4 C;  1M1J B;  3G3Z A;  3UIA A;  4JYB A;  1LTB C;  3N7N A;  3IFM A;  4IFM A;  5AVQ B;  2C9L Y;  2XV5 A;  4IFD K;  5AW7 B;  2J5Z A;  2L5G B;  1LTJ A;  3R2P A;  4N78 D;  4LC1 A;  3VTP C;  1GL2 A;  1H89 A;  3V2N A;  2GUS A;  3H32 C;  2A45 H;  2W6B A;  1RF0 A;  4C7N B;  1FAV A;  1X9V A;  2FYU K;  3HD7 A;  3RK3 C;  1FOS F;  1KIL D;  1SFC B;  1GU4 A;  2O1J A;  4R9T A;  2KP8 A;  1ZR4 A;  2FYZ A;  3H6P A;  2M3B A;  1ZN5 A;  2M8R A;  2J0H A;  3M06 A;  5APW A;  1T8Z A;  3RL0 C;  1X79 B;  3V4Q A;  1KIL B;  1IFN A;  4AYC A;  1SVF A;  1FZG B;  2KOG A;  1L0N K;  1IC2 A;  2XDJ A;  2R32 A;  3TNU A;  4XE5 B;  1FZD A;  1VDF A;  3MUD A;  1J1D B;  5AW0 B;  3TK1 A;  1XTC C;  3VP8 A;  2WWW A;  5APX A;  1LTI C;  1NAF A;  2J3U A;  1L0L K;  1NHL A;  3LIE A;  5CCH A;  1SQP K;  5AW4 B;  1FZB A;  5CHX A;  1L4A A;  2WSE H;  2Q9I B;  2J61 B;  3B5N B;  2O1K A;  3U1A A;  1FOS E;  2J3F A;  1URQ C;  1J2J B;  3LID A;  2P2U A;  3E1I A;  3TSI A;  1CI6 A;  3N4X A;  1G2C B;  2Z4E A;  2FFD C;  4M3L A;  1CW5 A;  1T3U A;  1FIC A;  2XNX B;  1FZF B;  1GD2 E;  1YYC A;  1N2D C;  1DEB A;  1GZL A;  2HFE D;  1JTH A;  2JHM F;  4N6J A;  1FID A;  1HVV A;  1FZE B;  4WY4 D;  2HPC A;  2WPS A;  1H8A A;  1SQB K;  2C9N Y;  1NO4 A;  1FZA A;  3P8C E;  3TYY A;  3HE4 B;  2OYI B;  3CL3 D;  2O01 H;  3I5C A;  3VMX A;  4JZC A;  4WY4 B;  4IFF A;  1FZC A;  4WBA A;  3CLQ A;  5AVX B;  2XKM A;  5AVV B;  2CPS A;  3GHG A;  1GK6 A;  2J3G A;  3O8Z A;  4R9J A;  4I1L A;  4C7R A;  2WNP F;  5CJ4 A;  2WPR A;  3NFQ A;  2N1T A;  2J58 A;  1N73 C;  3HE5 A;  3RK3 D;  3RK2 D;  3B8E B;  4N3Y B;  2XZR A;  3EQ2 A;  5AVU B;  1JY3 N;  3P8M C;  2H43 C;  3H32 B;  1M1J A;  1NTM K;  2C0X A;  2P67 A;  2HLO C;  1HUC A;  3HE5 B;  3RL0 D;  3RK3 B;  5KJ7 D;  5CCG C;  2HOD C;  1LT9 C;  1FU1 A;  2WZ7 A;  1NKN A;  3V5B A;  2GY7 A;  2QM7 A;  1OXZ A;  2YNY A;  4ZFG A;  2GUV A;  3RL0 B;  3L35 A;  1RE4 C;  3A5T A;  3HUS C;  2N9B A;  4OH8 B;  1ZV8 A;  3HTK B;  3NXS A;  4C7N A;  5AW3 B;  1CZQ A;  2Q7C A;  1N86 C;  5AVW B;  1SFC A;  3BRV B;  1RF1 C;  3BVH C;  1MV8 A;  3RK2 C;  1KIL A;  1N7S C;  2POH A;  1IFI A;  2FXM A;  2JHL F;  1FZG A;  1FBM A;  1URQ D;  1RE3 C;  4W7Y A;  4EPU A;  5KJ7 C;  1DX7 A;  2NPS C;  1LWU A;  3KYQ A;  1LTG C;  1J1E C;  4ZKU A;  2YO2 A;  1JCC A;  1RY3 A;  1QL2 A;  3EFG A;  1IO4 A;  1LWU B;  4C46 A;  3SWF A;  2C0W A;  2FFD B;  2I1K A;  4AUW A;  2YO3 A;  3M0D C;  2YMY A;  1PFI A;  1KZU B;  1ZR2 A;  2Q9I A;  3OA7 A;  2J61 A;  4N78 E;  3B5N A;  2J1G A;  3NMD A;  3PP5 A;  1JY3 O;  4DZO A;  4EIJ A;  2PP6 A;  2J3O A;  4WB4 A;  3U59 A;  5AW9 B;  3BAT A;  4HYT B;  1G2C A;  1IJD B;  1LTJ C;  4GIF A;  1CSB A;  2A45 I;  1SQX K;  3VMZ A;  2IPP A;  1GK4 A;  2XNX A;  4B86 A;  1FZF A;  1GL2 C;  1FJK A;  1FDM A;  4RES B;  1RF0 C;  3NTN A;  2W6A A;  1FZE A;  3HD7 C;  3KPE A;  2H7H A;  1L4A D;  1XTG B;  2KYV A;  3KDP B;  2WT7 B;  3V2Q A;  1N73 B;  3IR9 A;  5CCG D;  3HE4 A;  2OYI A;  1A02 J;  1LTT C;  1IFD A;  2WTY A;  4I6M C;  1S9K D;  3OJA B;  2CPB A;  2H43 B;  2JJL A;  4WY4 A;  4O9B A;  1NU1 K;  1JUN A;  3M9B A;  1WRG A;  1H88 A;  2WSF H;  5APT A;  3MGN A;  2ZFC A;  2HOD B;  1JCD A;  1Z56 A;  2P7J A;  3BAS A;  1LT9 B;  2J59 M;  2R3C A;  2A45 G;  4I2L C;  5CMZ A;  1Z3U A;  3M9Q A;  2FKW B;  1LTS C;  1HH0 A;  2J0Y A;  1RE4 B;  3H32 A;  3HUS B;  2VRS A;  5APY A;  2I1J A;  4DOJ A;  1JY3 P;  1LTA C;  1N86 B;  3BRT B;  1RF1 B;  1N7S D;  5AW2 B;  1FZB C;  1SP4 A;  1L4A C;  3CI9 A;  5AW5 B;  3BVH B;  1HTL C;  1JY2 N;  3RK2 B;  1HBW A;  2NPS D;  1N7S B;  2YKP A;  2HYN A;  3E1I C;  5BU8 B;  3HTK A;  5KTB A;  2Z4E C;  1RE3 B;  1JOC A;  2IFM A;  3C9I A;  2NPS B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...