4EPUA

Ang1 fibrinogen-related domain (fred)
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
215
structure length
215
Chain Sequence
FRDCADVYQAGFNKSGIYTIYINNMPEPKKVFCNMDVNGGGWTVIQHREDGSLDFQRGWKEYKMGFGNPSGEYWLGNEFIFAITSQRQYMLRIELMDWEGNRAYSQYDRFHIGNEKQNYRLYLKGHTGTAGKQSSLILHGADFSTKDADNDNCMCKCALMLTGGWWFDACGPSNLNGMFYTAGQNHGKLNGIKWHYFKGPSYSLRSTTMMIRPLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords Angiopoietin-1
publication title Biochemical and structural characterization of the Ang1 fibrinogen-related domain
rcsb
source organism Homo sapiens
total genus 62
structure length 215
sequence length 215
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 4epuA01
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 4epuA02
2J0YA 2J1GA 4ZFGA 2XNXB 3HUSC 2JHHC 1N86C 1RE4C 4M7FA 2Q9IC 2J3FA 2Z4EC 1FIBA 1N86B 2J3FD 1LTJC 2JHMF 3H32C 4M7HA 1LTJB 4R9JA 2J3UA 1N73C 2XNXC 4EPUA 2JHKF 1N73B 1Z3SA 2FFDC 2JHLF 2J0GA 1FZBC 1RE3B 2H43C 2HODB 1RF1B 2FFDB 2J61A 1FZBB 2D39A 1JC9A 2H43B 2FIBA 1FICA 4JZCA 1RE3C 1FZDA 2HODC 2GY7A 1RF1C 2OYHB 1FZFC 1FZGC 2J3GA 4NYTA 1FZCC 2J3OA 2J64A 1FZFB 1FZGB 1FZEB 2HLOB 2HPCB 1FZCB 1LT9C 2J61B 3E1IC 1RF0B 1LT9B 3GHGC 1M1JB 1FIDA 3E1IB 2J0HA 2OYHC 1LWUC 1Z3UA 3HUSB 3FIBA 2OYIC 4JYOX 1RE4B 1LWUB 2Q9IB 1FZAC 2OYIB 1FZEC 2HLOC 2Z4EB 2HPCC 3BVHC 1FZAB 2JHIF 4R9TA 1RF0C 3H32B 2J5ZA 2J2PA 2J60A 3BVHB 1M1JC 2WNPF
chains in the Genus database with same CATH superfamily
2J0YA 2J1GA 4ZFGA 2XNXB 3HUSC 2JHHC 1N86C 1RE4C 4M7FA 2Q9IC 2J3FA 2Z4EC 1FIBA 1N86B 2J3FD 1LTJC 2JHMF 3H32C 4M7HA 1LTJB 4R9JA 2J3UA 1N73C 2XNXC 4EPUA 2JHKF 1N73B 1Z3SA 2FFDC 2JHLF 2J0GA 1FZBC 1RE3B 2H43C 2HODB 1RF1B 2FFDB 2J61A 1FZBB 2D39A 1JC9A 2H43B 2FIBA 1FICA 4JZCA 1RE3C 1FZDA 2HODC 2GY7A 3GHGB 1RF1C 2OYHB 1FZFC 1FZGC 2J3GA 4NYTA 1FZCC 2J3OA 2J64A 1FZFB 1FZGB 1FZEB 2HLOB 2HPCB 1FZCB 1LT9C 2J61B 3E1IC 1RF0B 1LT9B 3GHGC 1M1JB 1FIDA 3E1IB 2J0HA 2OYHC 1LWUC 1Z3UA 3HUSB 3FIBA 2OYIC 4JYOX 1RE4B 1LWUB 2Q9IB 1FZAC 2OYIB 1FZEC 2HLOC 2Z4EB 2HPCC 3BVHC 1FZAB 2JHIF 4R9TA 1RF0C 3H32B 2J5ZA 2J2PA 2J60A 3BVHB 1M1JC 2WNPF
chains in the Genus database with same CATH topology
2J0YA 2J1GA 4ZFGA 2XNXB 3HUSC 2JHHC 1N86C 1RE4C 4M7FA 2Q9IC 2J3FA 2Z4EC 1FIBA 1N86B 2J3FD 1LTJC 2JHMF 3H32C 4M7HA 1LTJB 4R9JA 2J3UA 1N73C 2XNXC 4EPUA 2JHKF 1N73B 1Z3SA 2FFDC 2JHLF 2J0GA 1FZBC 1RE3B 2H43C 2HODB 1RF1B 2FFDB 2J61A 1FZBB 2D39A 1JC9A 2H43B 2FIBA 1FICA 4JZCA 1RE3C 1FZDA 2HODC 2GY7A 1RF1C 2OYHB 1FZFC 1FZGC 2J3GA 4NYTA 1FZCC 2J3OA 2J64A 1FZFB 1FZGB 1FZEB 2HLOB 2HPCB 1FZCB 1LT9C 2J61B 3E1IC 1RF0B 1LT9B 3GHGC 1M1JB 1FIDA 3E1IB 2J0HA 2OYHC 1LWUC 1Z3UA 3HUSB 3FIBA 2OYIC 4JYOX 1RE4B 1LWUB 2Q9IB 1FZAC 2OYIB 1FZEC 2HLOC 2Z4EB 2HPCC 3BVHC 1FZAB 2JHIF 4R9TA 1RF0C 3H32B 2J5ZA 2J2PA 2J60A 3BVHB 1M1JC 2WNPF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J0Y A;  2J1G A;  4ZFG A;  2XNX B;  3HUS C;  2JHH C;  1N86 C;  1RE4 C;  4M7F A;  2Q9I C;  2J3F A;  2Z4E C;  1FIB A;  1N86 B;  2J3F D;  1LTJ C;  2JHM F;  3H32 C;  4M7H A;  1LTJ B;  4R9J A;  2J3U A;  1N73 C;  2XNX C;  4EPU A;  2JHK F;  1N73 B;  1Z3S A;  2FFD C;  2JHL F;  2J0G A;  1FZB C;  1RE3 B;  2H43 C;  2HOD B;  1RF1 B;  2FFD B;  2J61 A;  1FZB B;  2D39 A;  1JC9 A;  2H43 B;  2FIB A;  1FIC A;  4JZC A;  1RE3 C;  1FZD A;  2HOD C;  2GY7 A;  1RF1 C;  2OYH B;  1FZF C;  1FZG C;  2J3G A;  4NYT A;  1FZC C;  2J3O A;  2J64 A;  1FZF B;  1FZG B;  1FZE B;  2HLO B;  2HPC B;  1FZC B;  1LT9 C;  2J61 B;  3E1I C;  1RF0 B;  1LT9 B;  3GHG C;  1M1J B;  1FID A;  3E1I B;  2J0H A;  2OYH C;  1LWU C;  1Z3U A;  3HUS B;  3FIB A;  2OYI C;  4JYO X;  1RE4 B;  1LWU B;  2Q9I B;  1FZA C;  2OYI B;  1FZE C;  2HLO C;  2Z4E B;  2HPC C;  3BVH C;  1FZA B;  2JHI F;  4R9T A;  1RF0 C;  3H32 B;  2J5Z A;  2J2P A;  2J60 A;  3BVH B;  1M1J C;  2WNP F; 
#chains in the Genus database with same CATH topology
 2J0Y A;  2J1G A;  4ZFG A;  2XNX B;  3HUS C;  2JHH C;  1N86 C;  1RE4 C;  4M7F A;  2Q9I C;  2J3F A;  2Z4E C;  1FIB A;  1N86 B;  2J3F D;  1LTJ C;  2JHM F;  3H32 C;  4M7H A;  1LTJ B;  4R9J A;  2J3U A;  1N73 C;  2XNX C;  4EPU A;  2JHK F;  1N73 B;  1Z3S A;  2FFD C;  2JHL F;  2J0G A;  1FZB C;  1RE3 B;  2H43 C;  2HOD B;  1RF1 B;  2FFD B;  2J61 A;  1FZB B;  2D39 A;  1JC9 A;  2H43 B;  2FIB A;  1FIC A;  4JZC A;  1RE3 C;  1FZD A;  2HOD C;  2GY7 A;  3GHG B;  1RF1 C;  2OYH B;  1FZF C;  1FZG C;  2J3G A;  4NYT A;  1FZC C;  2J3O A;  2J64 A;  1FZF B;  1FZG B;  1FZE B;  2HLO B;  2HPC B;  1FZC B;  1LT9 C;  2J61 B;  3E1I C;  1RF0 B;  1LT9 B;  3GHG C;  1M1J B;  1FID A;  3E1I B;  2J0H A;  2OYH C;  1LWU C;  1Z3U A;  3HUS B;  3FIB A;  2OYI C;  4JYO X;  1RE4 B;  1LWU B;  2Q9I B;  1FZA C;  2OYI B;  1FZE C;  2HLO C;  2Z4E B;  2HPC C;  3BVH C;  1FZA B;  2JHI F;  4R9T A;  1RF0 C;  3H32 B;  2J5Z A;  2J2P A;  2J60 A;  3BVH B;  1M1J C;  2WNP F; 
#chains in the Genus database with same CATH homology
 2J0Y A;  2J1G A;  4ZFG A;  2XNX B;  3HUS C;  2JHH C;  1N86 C;  1RE4 C;  4M7F A;  2Q9I C;  2J3F A;  2Z4E C;  1FIB A;  1N86 B;  2J3F D;  1LTJ C;  2JHM F;  3H32 C;  4M7H A;  1LTJ B;  4R9J A;  2J3U A;  1N73 C;  2XNX C;  4EPU A;  2JHK F;  1N73 B;  1Z3S A;  2FFD C;  2JHL F;  2J0G A;  1FZB C;  1RE3 B;  2H43 C;  2HOD B;  1RF1 B;  2FFD B;  2J61 A;  1FZB B;  2D39 A;  1JC9 A;  2H43 B;  2FIB A;  1FIC A;  4JZC A;  1RE3 C;  1FZD A;  2HOD C;  2GY7 A;  1RF1 C;  2OYH B;  1FZF C;  1FZG C;  2J3G A;  4NYT A;  1FZC C;  2J3O A;  2J64 A;  1FZF B;  1FZG B;  1FZE B;  2HLO B;  2HPC B;  1FZC B;  1LT9 C;  2J61 B;  3E1I C;  1RF0 B;  1LT9 B;  3GHG C;  1M1J B;  1FID A;  3E1I B;  2J0H A;  2OYH C;  1LWU C;  1Z3U A;  3HUS B;  3FIB A;  2OYI C;  4JYO X;  1RE4 B;  1LWU B;  2Q9I B;  1FZA C;  2OYI B;  1FZE C;  2HLO C;  2Z4E B;  2HPC C;  3BVH C;  1FZA B;  2JHI F;  4R9T A;  1RF0 C;  3H32 B;  2J5Z A;  2J2P A;  2J60 A;  3BVH B;  1M1J C;  2WNP F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...