3E1IB

Crystal structure of bbetad432a variant fibrinogen fragment d with the peptide ligand gly-his-arg-pro-amide
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
298
structure length
298
Chain Sequence
IPTNLRVLRSILENLRSKIQKLESDVSAQMEYCRTPCTVSCNIPVVSGKECEEIIRKGGETSEMYLIQPDSSVKPYRVYCDMNTENGGWTVIQNRQDGSVDFGRKWDPYKQGFGNVATNTDGKNYCGLPGEYWLGNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGGFTVQNEANKYQISVNKYRGTAGNALMDGASQLMGENRTMTIHNGMFFSTYDRDNDGWLTSDPRKQCSKEDGGGWWYNRCHAANPNGRYYWGGQYTWDMAKHGTADGVVWMNWKGSWYSMRKMSMKIRPFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibrinogen alpha chain
publication title Fibrinogen variant BbetaD432A has normal polymerization but does not bind knob "B".
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
total genus 86
structure length 298
sequence length 298
chains with identical sequence E
ec nomenclature
pdb deposition date 2008-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 3e1iB01
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 3e1iB02
1FICA 2J61B 2JHIF 3H32B 1FZEC 1RE4B 1FZGB 1JC9A 4JYOX 2FFDB 2JHLF 1RF0C 2J3OA 4M7FA 2H43B 1N73B 1FIBA 1FZFC 3BVHC 4ZFGA 1RE3B 2Z4EC 2Q9IC 2WNPF 2XNXB 1M1JC 2HPCC 1FZAB 1RE4C 3FIBA 1LT9B 4JZCA 2HLOB 1N86C 1LTJC 2H43C 1N73C 2J2PA 1RF1C 1FZCB 3E1IB 2JHMF 4R9JA 3HUSC 2OYIB 2HODC 2D39A 3H32C 2OYHB 1FZBB 1LWUB 1Z3SA 1FZGC 1FZEB 2FFDC 1FIDA 2J3UA 1Z3UA 1RF0B 2GY7A 2JHKF 1RE3C 1FZFB 3BVHB 2XNXC 4EPUA 2J3GA 2J0HA 2Z4EB 2Q9IB 1FZAC 2J61A 1LT9C 2FIBA 1M1JB 2HPCB 2HLOC 4NYTA 2J0YA 1N86B 2J64A 1LTJB 2J5ZA 3GHGC 1FZCC 2J3FA 3E1IC 4R9TA 1RF1B 4M7HA 1FZDA 2J60A 2OYIC 2JHHC 3HUSB 2J3FD 2J1GA 2HODB 2OYHC 1FZBC 1LWUC 2J0GA
chains in the Genus database with same CATH superfamily
1FICA 2J61B 2JHIF 3H32B 1FZEC 1RE4B 1FZGB 1JC9A 4JYOX 2FFDB 2JHLF 1RF0C 2J3OA 4M7FA 2H43B 1N73B 1FIBA 1FZFC 3BVHC 4ZFGA 1RE3B 2Z4EC 2Q9IC 2WNPF 2XNXB 1M1JC 2HPCC 1FZAB 1RE4C 3FIBA 1LT9B 4JZCA 2HLOB 1N86C 1LTJC 2H43C 1N73C 2J2PA 1RF1C 1FZCB 3E1IB 2JHMF 4R9JA 3HUSC 2OYIB 2HODC 2D39A 3H32C 2OYHB 1FZBB 1LWUB 1Z3SA 1FZGC 1FZEB 2FFDC 1FIDA 2J3UA 1Z3UA 1RF0B 3GHGB 2GY7A 2JHKF 1RE3C 1FZFB 3BVHB 2XNXC 4EPUA 2J3GA 2J0HA 2Z4EB 2Q9IB 1FZAC 2J61A 1LT9C 2FIBA 1M1JB 2HPCB 2HLOC 4NYTA 2J0YA 1N86B 2J64A 1LTJB 2J5ZA 3GHGC 1FZCC 2J3FA 3E1IC 4R9TA 1RF1B 4M7HA 1FZDA 2J60A 2OYIC 2JHHC 3HUSB 2J3FD 2J1GA 2HODB 2OYHC 1FZBC 1LWUC 2J0GA
chains in the Genus database with same CATH topology
1FICA 2J61B 2JHIF 3H32B 1FZEC 1RE4B 1FZGB 1JC9A 4JYOX 2FFDB 2JHLF 1RF0C 2J3OA 4M7FA 2H43B 1N73B 1FIBA 1FZFC 3BVHC 4ZFGA 1RE3B 2Z4EC 2Q9IC 2WNPF 2XNXB 1M1JC 2HPCC 1FZAB 1RE4C 3FIBA 1LT9B 4JZCA 2HLOB 1N86C 1LTJC 2H43C 1N73C 2J2PA 1RF1C 1FZCB 3E1IB 2JHMF 4R9JA 3HUSC 2OYIB 2HODC 2D39A 3H32C 2OYHB 1FZBB 1LWUB 1Z3SA 1FZGC 1FZEB 2FFDC 1FIDA 2J3UA 1Z3UA 1RF0B 2GY7A 2JHKF 1RE3C 1FZFB 3BVHB 2XNXC 4EPUA 2J3GA 2J0HA 2Z4EB 2Q9IB 1FZAC 2J61A 1LT9C 2FIBA 1M1JB 2HPCB 2HLOC 4NYTA 2J0YA 1N86B 2J64A 1LTJB 2J5ZA 3GHGC 1FZCC 2J3FA 3E1IC 4R9TA 1RF1B 4M7HA 1FZDA 2J60A 2OYIC 2JHHC 3HUSB 2J3FD 2J1GA 2HODB 2OYHC 1FZBC 1LWUC 2J0GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FIC A;  2J61 B;  2JHI F;  3H32 B;  1FZE C;  1RE4 B;  1FZG B;  1JC9 A;  4JYO X;  2FFD B;  2JHL F;  1RF0 C;  2J3O A;  4M7F A;  2H43 B;  1N73 B;  1FIB A;  1FZF C;  3BVH C;  4ZFG A;  1RE3 B;  2Z4E C;  2Q9I C;  2WNP F;  2XNX B;  1M1J C;  2HPC C;  1FZA B;  1RE4 C;  3FIB A;  1LT9 B;  4JZC A;  2HLO B;  1N86 C;  1LTJ C;  2H43 C;  1N73 C;  2J2P A;  1RF1 C;  1FZC B;  3E1I B;  2JHM F;  4R9J A;  3HUS C;  2OYI B;  2HOD C;  2D39 A;  3H32 C;  2OYH B;  1FZB B;  1LWU B;  1Z3S A;  1FZG C;  1FZE B;  2FFD C;  1FID A;  2J3U A;  1Z3U A;  1RF0 B;  2GY7 A;  2JHK F;  1RE3 C;  1FZF B;  3BVH B;  2XNX C;  4EPU A;  2J3G A;  2J0H A;  2Z4E B;  2Q9I B;  1FZA C;  2J61 A;  1LT9 C;  2FIB A;  1M1J B;  2HPC B;  2HLO C;  4NYT A;  2J0Y A;  1N86 B;  2J64 A;  1LTJ B;  2J5Z A;  3GHG C;  1FZC C;  2J3F A;  3E1I C;  4R9T A;  1RF1 B;  4M7H A;  1FZD A;  2J60 A;  2OYI C;  2JHH C;  3HUS B;  2J3F D;  2J1G A;  2HOD B;  2OYH C;  1FZB C;  1LWU C;  2J0G A; 
#chains in the Genus database with same CATH topology
 1FIC A;  2J61 B;  2JHI F;  3H32 B;  1FZE C;  1RE4 B;  1FZG B;  1JC9 A;  4JYO X;  2FFD B;  2JHL F;  1RF0 C;  2J3O A;  4M7F A;  2H43 B;  1N73 B;  1FIB A;  1FZF C;  3BVH C;  4ZFG A;  1RE3 B;  2Z4E C;  2Q9I C;  2WNP F;  2XNX B;  1M1J C;  2HPC C;  1FZA B;  1RE4 C;  3FIB A;  1LT9 B;  4JZC A;  2HLO B;  1N86 C;  1LTJ C;  2H43 C;  1N73 C;  2J2P A;  1RF1 C;  1FZC B;  3E1I B;  2JHM F;  4R9J A;  3HUS C;  2OYI B;  2HOD C;  2D39 A;  3H32 C;  2OYH B;  1FZB B;  1LWU B;  1Z3S A;  1FZG C;  1FZE B;  2FFD C;  1FID A;  2J3U A;  1Z3U A;  1RF0 B;  3GHG B;  2GY7 A;  2JHK F;  1RE3 C;  1FZF B;  3BVH B;  2XNX C;  4EPU A;  2J3G A;  2J0H A;  2Z4E B;  2Q9I B;  1FZA C;  2J61 A;  1LT9 C;  2FIB A;  1M1J B;  2HPC B;  2HLO C;  4NYT A;  2J0Y A;  1N86 B;  2J64 A;  1LTJ B;  2J5Z A;  3GHG C;  1FZC C;  2J3F A;  3E1I C;  4R9T A;  1RF1 B;  4M7H A;  1FZD A;  2J60 A;  2OYI C;  2JHH C;  3HUS B;  2J3F D;  2J1G A;  2HOD B;  2OYH C;  1FZB C;  1LWU C;  2J0G A; 
#chains in the Genus database with same CATH homology
 1FIC A;  2J61 B;  2JHI F;  3H32 B;  1FZE C;  1RE4 B;  1FZG B;  1JC9 A;  4JYO X;  2FFD B;  2JHL F;  1RF0 C;  2J3O A;  4M7F A;  2H43 B;  1N73 B;  1FIB A;  1FZF C;  3BVH C;  4ZFG A;  1RE3 B;  2Z4E C;  2Q9I C;  2WNP F;  2XNX B;  1M1J C;  2HPC C;  1FZA B;  1RE4 C;  3FIB A;  1LT9 B;  4JZC A;  2HLO B;  1N86 C;  1LTJ C;  2H43 C;  1N73 C;  2J2P A;  1RF1 C;  1FZC B;  3E1I B;  2JHM F;  4R9J A;  3HUS C;  2OYI B;  2HOD C;  2D39 A;  3H32 C;  2OYH B;  1FZB B;  1LWU B;  1Z3S A;  1FZG C;  1FZE B;  2FFD C;  1FID A;  2J3U A;  1Z3U A;  1RF0 B;  2GY7 A;  2JHK F;  1RE3 C;  1FZF B;  3BVH B;  2XNX C;  4EPU A;  2J3G A;  2J0H A;  2Z4E B;  2Q9I B;  1FZA C;  2J61 A;  1LT9 C;  2FIB A;  1M1J B;  2HPC B;  2HLO C;  4NYT A;  2J0Y A;  1N86 B;  2J64 A;  1LTJ B;  2J5Z A;  3GHG C;  1FZC C;  2J3F A;  3E1I C;  4R9T A;  1RF1 B;  4M7H A;  1FZD A;  2J60 A;  2OYI C;  2JHH C;  3HUS B;  2J3F D;  2J1G A;  2HOD B;  2OYH C;  1FZB C;  1LWU C;  2J0G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...