3E1IB

Crystal structure of bbetad432a variant fibrinogen fragment d with the peptide ligand gly-his-arg-pro-amide
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
298
structure length
298
Chain Sequence
IPTNLRVLRSILENLRSKIQKLESDVSAQMEYCRTPCTVSCNIPVVSGKECEEIIRKGGETSEMYLIQPDSSVKPYRVYCDMNTENGGWTVIQNRQDGSVDFGRKWDPYKQGFGNVATNTDGKNYCGLPGEYWLGNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGGFTVQNEANKYQISVNKYRGTAGNALMDGASQLMGENRTMTIHNGMFFSTYDRDNDGWLTSDPRKQCSKEDGGGWWYNRCHAANPNGRYYWGGQYTWDMAKHGTADGVVWMNWKGSWYSMRKMSMKIRPFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Blood clotting
molecule keywords Fibrinogen alpha chain
publication title Fibrinogen variant BbetaD432A has normal polymerization but does not bind knob "B".
pubmed doi rcsb
source organism Homo sapiens
total genus 86
structure length 298
sequence length 298
chains with identical sequence E
ec nomenclature
pdb deposition date 2008-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 3e1iB01
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 3e1iB02
1M1JB 2Q9IC 2J61B 2J0YA 2J0HA 2J1GA 1LWUC 2H43B 1N73C 1RF0B 2OYIC 2HPCB 2Q9IB 1FICA 2J5ZA 1Z3UA 2JHKF 1LWUB 3GHGC 1LT9C 2J0GA 1RF1B 1JC9A 2J2PA 4EPUA 4R9TA 1RE3C 2OYHB 2JHLF 1FZAC 2J61A 2D39A 2J3OA 1FZFC 2JHHC 3H32C 1N86C 2XNXC 1FZBC 1LTJC 1FZAB 1FZFB 1N73B 1FZGC 2OYIB 2FFDC 2XNXB 2JHIF 4M7HA 2Z4EC 3BVHC 2J3FA 1FZDA 1LT9B 1FIBA 2GY7A 2HLOC 2FIBA 1RE4C 3E1IC 1M1JC 4JZCA 3HUSC 4M7FA 4ZFGA 2J64A 1RE3B 2JHMF 2HODC 1FZEC 1RF0C 3FIBA 3E1IB 3H32B 2HPCC 1N86B 1FIDA 3HUSB 1FZBB 2J3GA 2WNPF 1LTJB 4R9JA 2HODB 1FZEB 1RF1C 4JYOX 1FZGB 1Z3SA 1FZCC 2FFDB 2OYHC 2Z4EB 4NYTA 3BVHB 2H43C 2J3UA 2J3FD 2HLOB 1RE4B 1FZCB 2J60A
chains in the Genus database with same CATH superfamily
1M1JB 2Q9IC 2J61B 2J0YA 2J0HA 2J1GA 1LWUC 2H43B 1N73C 1RF0B 2OYIC 2HPCB 2Q9IB 1FICA 2J5ZA 1Z3UA 2JHKF 1LWUB 3GHGC 1LT9C 2J0GA 1RF1B 1JC9A 2J2PA 4EPUA 4R9TA 1RE3C 2OYHB 2JHLF 1FZAC 2J61A 2D39A 2J3OA 1FZFC 2JHHC 3H32C 1N86C 2XNXC 1FZBC 1LTJC 1FZAB 1FZFB 1N73B 1FZGC 2OYIB 2FFDC 2XNXB 2JHIF 4M7HA 2Z4EC 3BVHC 3GHGB 2J3FA 1FZDA 1LT9B 1FIBA 2GY7A 2HLOC 2FIBA 1RE4C 3E1IC 1M1JC 4JZCA 3HUSC 4M7FA 4ZFGA 2J64A 1RE3B 2JHMF 2HODC 1FZEC 1RF0C 3FIBA 3E1IB 3H32B 2HPCC 1N86B 1FIDA 3HUSB 1FZBB 2J3GA 2WNPF 1LTJB 4R9JA 2HODB 1FZEB 1RF1C 4JYOX 1FZGB 1Z3SA 1FZCC 2FFDB 2OYHC 2Z4EB 4NYTA 3BVHB 2H43C 2J3UA 2J3FD 2HLOB 1RE4B 1FZCB 2J60A
chains in the Genus database with same CATH topology
1M1JB 2Q9IC 2J61B 2J0YA 2J0HA 2J1GA 1LWUC 2H43B 1N73C 1RF0B 2OYIC 2HPCB 2Q9IB 1FICA 2J5ZA 1Z3UA 2JHKF 1LWUB 3GHGC 1LT9C 2J0GA 1RF1B 1JC9A 2J2PA 4EPUA 4R9TA 1RE3C 2OYHB 2JHLF 1FZAC 2J61A 2D39A 2J3OA 1FZFC 2JHHC 3H32C 1N86C 2XNXC 1FZBC 1LTJC 1FZAB 1FZFB 1N73B 1FZGC 2OYIB 2FFDC 2XNXB 2JHIF 4M7HA 2Z4EC 3BVHC 2J3FA 1FZDA 1LT9B 1FIBA 2GY7A 2HLOC 2FIBA 1RE4C 3E1IC 1M1JC 4JZCA 3HUSC 4M7FA 4ZFGA 2J64A 1RE3B 2JHMF 2HODC 1FZEC 1RF0C 3FIBA 3E1IB 3H32B 2HPCC 1N86B 1FIDA 3HUSB 1FZBB 2J3GA 2WNPF 1LTJB 4R9JA 2HODB 1FZEB 1RF1C 4JYOX 1FZGB 1Z3SA 1FZCC 2FFDB 2OYHC 2Z4EB 4NYTA 3BVHB 2H43C 2J3UA 2J3FD 2HLOB 1RE4B 1FZCB 2J60A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M1J B;  2Q9I C;  2J61 B;  2J0Y A;  2J0H A;  2J1G A;  1LWU C;  2H43 B;  1N73 C;  1RF0 B;  2OYI C;  2HPC B;  2Q9I B;  1FIC A;  2J5Z A;  1Z3U A;  2JHK F;  1LWU B;  3GHG C;  1LT9 C;  2J0G A;  1RF1 B;  1JC9 A;  2J2P A;  4EPU A;  4R9T A;  1RE3 C;  2OYH B;  2JHL F;  1FZA C;  2J61 A;  2D39 A;  2J3O A;  1FZF C;  2JHH C;  3H32 C;  1N86 C;  2XNX C;  1FZB C;  1LTJ C;  1FZA B;  1FZF B;  1N73 B;  1FZG C;  2OYI B;  2FFD C;  2XNX B;  2JHI F;  4M7H A;  2Z4E C;  3BVH C;  2J3F A;  1FZD A;  1LT9 B;  1FIB A;  2GY7 A;  2HLO C;  2FIB A;  1RE4 C;  3E1I C;  1M1J C;  4JZC A;  3HUS C;  4M7F A;  4ZFG A;  2J64 A;  1RE3 B;  2JHM F;  2HOD C;  1FZE C;  1RF0 C;  3FIB A;  3E1I B;  3H32 B;  2HPC C;  1N86 B;  1FID A;  3HUS B;  1FZB B;  2J3G A;  2WNP F;  1LTJ B;  4R9J A;  2HOD B;  1FZE B;  1RF1 C;  4JYO X;  1FZG B;  1Z3S A;  1FZC C;  2FFD B;  2OYH C;  2Z4E B;  4NYT A;  3BVH B;  2H43 C;  2J3U A;  2J3F D;  2HLO B;  1RE4 B;  1FZC B;  2J60 A; 
#chains in the Genus database with same CATH topology
 1M1J B;  2Q9I C;  2J61 B;  2J0Y A;  2J0H A;  2J1G A;  1LWU C;  2H43 B;  1N73 C;  1RF0 B;  2OYI C;  2HPC B;  2Q9I B;  1FIC A;  2J5Z A;  1Z3U A;  2JHK F;  1LWU B;  3GHG C;  1LT9 C;  2J0G A;  1RF1 B;  1JC9 A;  2J2P A;  4EPU A;  4R9T A;  1RE3 C;  2OYH B;  2JHL F;  1FZA C;  2J61 A;  2D39 A;  2J3O A;  1FZF C;  2JHH C;  3H32 C;  1N86 C;  2XNX C;  1FZB C;  1LTJ C;  1FZA B;  1FZF B;  1N73 B;  1FZG C;  2OYI B;  2FFD C;  2XNX B;  2JHI F;  4M7H A;  2Z4E C;  3BVH C;  3GHG B;  2J3F A;  1FZD A;  1LT9 B;  1FIB A;  2GY7 A;  2HLO C;  2FIB A;  1RE4 C;  3E1I C;  1M1J C;  4JZC A;  3HUS C;  4M7F A;  4ZFG A;  2J64 A;  1RE3 B;  2JHM F;  2HOD C;  1FZE C;  1RF0 C;  3FIB A;  3E1I B;  3H32 B;  2HPC C;  1N86 B;  1FID A;  3HUS B;  1FZB B;  2J3G A;  2WNP F;  1LTJ B;  4R9J A;  2HOD B;  1FZE B;  1RF1 C;  4JYO X;  1FZG B;  1Z3S A;  1FZC C;  2FFD B;  2OYH C;  2Z4E B;  4NYT A;  3BVH B;  2H43 C;  2J3U A;  2J3F D;  2HLO B;  1RE4 B;  1FZC B;  2J60 A; 
#chains in the Genus database with same CATH homology
 1M1J B;  2Q9I C;  2J61 B;  2J0Y A;  2J0H A;  2J1G A;  1LWU C;  2H43 B;  1N73 C;  1RF0 B;  2OYI C;  2HPC B;  2Q9I B;  1FIC A;  2J5Z A;  1Z3U A;  2JHK F;  1LWU B;  3GHG C;  1LT9 C;  2J0G A;  1RF1 B;  1JC9 A;  2J2P A;  4EPU A;  4R9T A;  1RE3 C;  2OYH B;  2JHL F;  1FZA C;  2J61 A;  2D39 A;  2J3O A;  1FZF C;  2JHH C;  3H32 C;  1N86 C;  2XNX C;  1FZB C;  1LTJ C;  1FZA B;  1FZF B;  1N73 B;  1FZG C;  2OYI B;  2FFD C;  2XNX B;  2JHI F;  4M7H A;  2Z4E C;  3BVH C;  2J3F A;  1FZD A;  1LT9 B;  1FIB A;  2GY7 A;  2HLO C;  2FIB A;  1RE4 C;  3E1I C;  1M1J C;  4JZC A;  3HUS C;  4M7F A;  4ZFG A;  2J64 A;  1RE3 B;  2JHM F;  2HOD C;  1FZE C;  1RF0 C;  3FIB A;  3E1I B;  3H32 B;  2HPC C;  1N86 B;  1FID A;  3HUS B;  1FZB B;  2J3G A;  2WNP F;  1LTJ B;  4R9J A;  2HOD B;  1FZE B;  1RF1 C;  4JYO X;  1FZG B;  1Z3S A;  1FZC C;  2FFD B;  2OYH C;  2Z4E B;  4NYT A;  3BVH B;  2H43 C;  2J3U A;  2J3F D;  2HLO B;  1RE4 B;  1FZC B;  2J60 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...