2J64A

H-ficolin
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
211
structure length
211
Chain Sequence
GPRNCRELLSQGATLSGWYHLCLPEGRALPVFCDMDTEGGGWLVFQRRQDGSVDFFRSWSSYRAGFGNQESEFWLGNENLHQLTLQGNWELRVELEDFNGNRTFAHYATFRLLGEVDHYQLALGKFSEGTAGDSLSLHSGRPFTTYDADHDSSNSNCAVIVHGAWWYASCYRSNLNGRYAVSEAAAHKYGIDWASGRGVGHPYRRVRMMLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lectin
molecule keywords FICOLIN-3
publication title Structural Insights Into the Innate Immune Recognition Specificities of L- and H-Ficolins.
pubmed doi rcsb
source organism Homo sapiens
total genus 63
structure length 211
sequence length 211
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2006-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 2j64A01
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 2j64A02
4JYOX 4ZFGA 3GHGC 2FFDC 4M7HA 2J60A 2WNPF 2JHHC 2HPCB 2FIBA 1RF1B 1FZBC 1FZEC 3BVHC 2J0HA 4R9JA 4JZCA 1RE4C 1LT9C 2Q9IB 1RF0C 4R9TA 1FZAC 2Z4EC 4NYTA 2OYIB 1LTJB 1FZFB 1N86B 1LWUB 3H32C 2J3UA 1FICA 1RE3B 2J64A 2OYHB 2JHKF 2J3OA 1FZGB 2JHLF 2H43C 1M1JB 4M7FA 2HPCC 2XNXB 1FZDA 4EPUA 2J3FD 2J61B 1RF1C 2JHMF 2HODB 2J5ZA 2HLOB 3HUSB 2J0GA 2Q9IC 1FZCB 1FIBA 2D39A 2J0YA 2OYIC 1LTJC 1FZFC 1N86C 1LWUC 2JHIF 3E1IB 1RE3C 1RF0B 2OYHC 1N73B 2GY7A 1FZGC 2FFDB 2J2PA 1M1JC 2XNXC 2HODC 1Z3SA 1Z3UA 2H43B 1FZBB 2HLOC 1FZEB 3HUSC 3BVHB 2J3FA 3FIBA 2J1GA 1JC9A 1FZCC 1FIDA 1RE4B 1LT9B 2J3GA 2J61A 2Z4EB 1FZAB 3E1IC 3H32B 1N73C
chains in the Genus database with same CATH superfamily
4JYOX 4ZFGA 3GHGC 2FFDC 4M7HA 2J60A 2WNPF 2JHHC 2HPCB 2FIBA 1RF1B 1FZBC 1FZEC 3BVHC 2J0HA 4R9JA 4JZCA 1RE4C 1LT9C 2Q9IB 1RF0C 4R9TA 1FZAC 2Z4EC 4NYTA 2OYIB 1LTJB 1FZFB 1N86B 1LWUB 3H32C 2J3UA 1FICA 1RE3B 2J64A 2OYHB 2JHKF 2J3OA 1FZGB 2JHLF 2H43C 1M1JB 4M7FA 2HPCC 2XNXB 1FZDA 4EPUA 2J3FD 2J61B 1RF1C 2JHMF 2HODB 2J5ZA 2HLOB 3HUSB 2J0GA 2Q9IC 1FZCB 1FIBA 2D39A 2J0YA 2OYIC 1LTJC 1FZFC 1N86C 1LWUC 2JHIF 3E1IB 1RE3C 1RF0B 2OYHC 1N73B 2GY7A 1FZGC 3GHGB 2FFDB 2J2PA 1M1JC 2XNXC 2HODC 1Z3SA 1Z3UA 2H43B 1FZBB 2HLOC 1FZEB 3HUSC 3BVHB 2J3FA 3FIBA 2J1GA 1JC9A 1FZCC 1FIDA 1RE4B 1LT9B 2J3GA 2J61A 2Z4EB 1FZAB 3E1IC 3H32B 1N73C
chains in the Genus database with same CATH topology
4JYOX 4ZFGA 3GHGC 2FFDC 4M7HA 2J60A 2WNPF 2JHHC 2HPCB 2FIBA 1RF1B 1FZBC 1FZEC 3BVHC 2J0HA 4R9JA 4JZCA 1RE4C 1LT9C 2Q9IB 1RF0C 4R9TA 1FZAC 2Z4EC 4NYTA 2OYIB 1LTJB 1FZFB 1N86B 1LWUB 3H32C 2J3UA 1FICA 1RE3B 2J64A 2OYHB 2JHKF 2J3OA 1FZGB 2JHLF 2H43C 1M1JB 4M7FA 2HPCC 2XNXB 1FZDA 4EPUA 2J3FD 2J61B 1RF1C 2JHMF 2HODB 2J5ZA 2HLOB 3HUSB 2J0GA 2Q9IC 1FZCB 1FIBA 2D39A 2J0YA 2OYIC 1LTJC 1FZFC 1N86C 1LWUC 2JHIF 3E1IB 1RE3C 1RF0B 2OYHC 1N73B 2GY7A 1FZGC 2FFDB 2J2PA 1M1JC 2XNXC 2HODC 1Z3SA 1Z3UA 2H43B 1FZBB 2HLOC 1FZEB 3HUSC 3BVHB 2J3FA 3FIBA 2J1GA 1JC9A 1FZCC 1FIDA 1RE4B 1LT9B 2J3GA 2J61A 2Z4EB 1FZAB 3E1IC 3H32B 1N73C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JYO X;  4ZFG A;  3GHG C;  2FFD C;  4M7H A;  2J60 A;  2WNP F;  2JHH C;  2HPC B;  2FIB A;  1RF1 B;  1FZB C;  1FZE C;  3BVH C;  2J0H A;  4R9J A;  4JZC A;  1RE4 C;  1LT9 C;  2Q9I B;  1RF0 C;  4R9T A;  1FZA C;  2Z4E C;  4NYT A;  2OYI B;  1LTJ B;  1FZF B;  1N86 B;  1LWU B;  3H32 C;  2J3U A;  1FIC A;  1RE3 B;  2J64 A;  2OYH B;  2JHK F;  2J3O A;  1FZG B;  2JHL F;  2H43 C;  1M1J B;  4M7F A;  2HPC C;  2XNX B;  1FZD A;  4EPU A;  2J3F D;  2J61 B;  1RF1 C;  2JHM F;  2HOD B;  2J5Z A;  2HLO B;  3HUS B;  2J0G A;  2Q9I C;  1FZC B;  1FIB A;  2D39 A;  2J0Y A;  2OYI C;  1LTJ C;  1FZF C;  1N86 C;  1LWU C;  2JHI F;  3E1I B;  1RE3 C;  1RF0 B;  2OYH C;  1N73 B;  2GY7 A;  1FZG C;  2FFD B;  2J2P A;  1M1J C;  2XNX C;  2HOD C;  1Z3S A;  1Z3U A;  2H43 B;  1FZB B;  2HLO C;  1FZE B;  3HUS C;  3BVH B;  2J3F A;  3FIB A;  2J1G A;  1JC9 A;  1FZC C;  1FID A;  1RE4 B;  1LT9 B;  2J3G A;  2J61 A;  2Z4E B;  1FZA B;  3E1I C;  3H32 B;  1N73 C; 
#chains in the Genus database with same CATH topology
 4JYO X;  4ZFG A;  3GHG C;  2FFD C;  4M7H A;  2J60 A;  2WNP F;  2JHH C;  2HPC B;  2FIB A;  1RF1 B;  1FZB C;  1FZE C;  3BVH C;  2J0H A;  4R9J A;  4JZC A;  1RE4 C;  1LT9 C;  2Q9I B;  1RF0 C;  4R9T A;  1FZA C;  2Z4E C;  4NYT A;  2OYI B;  1LTJ B;  1FZF B;  1N86 B;  1LWU B;  3H32 C;  2J3U A;  1FIC A;  1RE3 B;  2J64 A;  2OYH B;  2JHK F;  2J3O A;  1FZG B;  2JHL F;  2H43 C;  1M1J B;  4M7F A;  2HPC C;  2XNX B;  1FZD A;  4EPU A;  2J3F D;  2J61 B;  1RF1 C;  2JHM F;  2HOD B;  2J5Z A;  2HLO B;  3HUS B;  2J0G A;  2Q9I C;  1FZC B;  1FIB A;  2D39 A;  2J0Y A;  2OYI C;  1LTJ C;  1FZF C;  1N86 C;  1LWU C;  2JHI F;  3E1I B;  1RE3 C;  1RF0 B;  2OYH C;  1N73 B;  2GY7 A;  1FZG C;  3GHG B;  2FFD B;  2J2P A;  1M1J C;  2XNX C;  2HOD C;  1Z3S A;  1Z3U A;  2H43 B;  1FZB B;  2HLO C;  1FZE B;  3HUS C;  3BVH B;  2J3F A;  3FIB A;  2J1G A;  1JC9 A;  1FZC C;  1FID A;  1RE4 B;  1LT9 B;  2J3G A;  2J61 A;  2Z4E B;  1FZA B;  3E1I C;  3H32 B;  1N73 C; 
#chains in the Genus database with same CATH homology
 4JYO X;  4ZFG A;  3GHG C;  2FFD C;  4M7H A;  2J60 A;  2WNP F;  2JHH C;  2HPC B;  2FIB A;  1RF1 B;  1FZB C;  1FZE C;  3BVH C;  2J0H A;  4R9J A;  4JZC A;  1RE4 C;  1LT9 C;  2Q9I B;  1RF0 C;  4R9T A;  1FZA C;  2Z4E C;  4NYT A;  2OYI B;  1LTJ B;  1FZF B;  1N86 B;  1LWU B;  3H32 C;  2J3U A;  1FIC A;  1RE3 B;  2J64 A;  2OYH B;  2JHK F;  2J3O A;  1FZG B;  2JHL F;  2H43 C;  1M1J B;  4M7F A;  2HPC C;  2XNX B;  1FZD A;  4EPU A;  2J3F D;  2J61 B;  1RF1 C;  2JHM F;  2HOD B;  2J5Z A;  2HLO B;  3HUS B;  2J0G A;  2Q9I C;  1FZC B;  1FIB A;  2D39 A;  2J0Y A;  2OYI C;  1LTJ C;  1FZF C;  1N86 C;  1LWU C;  2JHI F;  3E1I B;  1RE3 C;  1RF0 B;  2OYH C;  1N73 B;  2GY7 A;  1FZG C;  2FFD B;  2J2P A;  1M1J C;  2XNX C;  2HOD C;  1Z3S A;  1Z3U A;  2H43 B;  1FZB B;  2HLO C;  1FZE B;  3HUS C;  3BVH B;  2J3F A;  3FIB A;  2J1G A;  1JC9 A;  1FZC C;  1FID A;  1RE4 B;  1LT9 B;  2J3G A;  2J61 A;  2Z4E B;  1FZA B;  3E1I C;  3H32 B;  1N73 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...