2J64A

H-ficolin
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
211
structure length
211
Chain Sequence
GPRNCRELLSQGATLSGWYHLCLPEGRALPVFCDMDTEGGGWLVFQRRQDGSVDFFRSWSSYRAGFGNQESEFWLGNENLHQLTLQGNWELRVELEDFNGNRTFAHYATFRLLGEVDHYQLALGKFSEGTAGDSLSLHSGRPFTTYDADHDSSNSNCAVIVHGAWWYASCYRSNLNGRYAVSEAAAHKYGIDWASGRGVGHPYRRVRMMLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FICOLIN-3
publication title Structural Insights Into the Innate Immune Recognition Specificities of L- and H-Ficolins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lectin
total genus 63
structure length 211
sequence length 211
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2006-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 2j64A01
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 2j64A02
2XNXB 1FZGC 2H43B 1RF1C 3BVHC 1RF0B 2J61A 1LT9B 1FICA 1N73B 1FZEB 1FZBB 1FIBA 1RE3C 2GY7A 1FZFC 3H32C 2J3FD 2J64A 1N86C 1FZGB 2Z4EC 1RF1B 2HODB 1LTJC 2JHIF 2J0HA 2OYHC 2J5ZA 4R9TA 1FZFB 2J61B 3E1IC 3H32B 4NYTA 1LTJB 1Z3SA 1FZCC 2HPCC 2OYHB 2JHMF 1LWUC 2J3OA 3FIBA 1JC9A 1RE4C 3BVHB 2FIBA 2J60A 1FZCB 2HPCB 1M1JC 2JHHC 2J3FA 1FZAC 2OYIC 1RE3B 2J0YA 2J3GA 1N86B 1RE4B 2Z4EB 1Z3UA 2J2PA 2WNPF 2XNXC 4JZCA 2Q9IC 2J1GA 1RF0C 1LT9C 3HUSC 1FZEC 3E1IB 4EPUA 2HLOC 3GHGC 2FFDC 2D39A 2HODC 2Q9IB 1LWUB 4R9JA 1FIDA 3HUSB 2J3UA 4M7HA 2HLOB 1FZDA 2JHKF 2J0GA 4M7FA 2H43C 2FFDB 2JHLF 1M1JB 4ZFGA 4JYOX 1FZAB 2OYIB 1N73C 1FZBC
chains in the Genus database with same CATH superfamily
2XNXB 1FZGC 2H43B 1RF1C 3BVHC 1RF0B 2J61A 1LT9B 1FICA 1N73B 1FZEB 1FZBB 1FIBA 1RE3C 2GY7A 1FZFC 3GHGB 2J3FD 3H32C 2J64A 1N86C 1FZGB 2Z4EC 1RF1B 2HODB 1LTJC 2JHIF 2J0HA 2OYHC 2J5ZA 4R9TA 1FZFB 2J61B 3E1IC 3H32B 4NYTA 1LTJB 1Z3SA 1FZCC 2HPCC 2OYHB 2JHMF 1LWUC 2J3OA 3FIBA 1JC9A 1RE4C 3BVHB 2FIBA 2J60A 1FZCB 2HPCB 1M1JC 2JHHC 2J3FA 1FZAC 2OYIC 1RE3B 2J0YA 2J3GA 1N86B 1RE4B 2Z4EB 1Z3UA 2J2PA 2WNPF 2XNXC 4JZCA 2Q9IC 2J1GA 1RF0C 1LT9C 3HUSC 1FZEC 3E1IB 4EPUA 2HLOC 3GHGC 2FFDC 2D39A 2HODC 2Q9IB 1LWUB 4R9JA 1FIDA 3HUSB 2J3UA 4M7HA 2HLOB 1FZDA 2JHKF 2J0GA 4M7FA 2H43C 2FFDB 2JHLF 1M1JB 4ZFGA 4JYOX 1FZAB 2OYIB 1N73C 1FZBC
chains in the Genus database with same CATH topology
2XNXB 1FZGC 2H43B 1RF1C 3BVHC 1RF0B 2J61A 1LT9B 1FICA 1N73B 1FZEB 1FZBB 1FIBA 1RE3C 2GY7A 1FZFC 3H32C 2J3FD 2J64A 1N86C 1FZGB 2Z4EC 1RF1B 2HODB 1LTJC 2JHIF 2J0HA 2OYHC 2J5ZA 4R9TA 1FZFB 2J61B 3E1IC 3H32B 4NYTA 1LTJB 1Z3SA 1FZCC 2HPCC 2OYHB 2JHMF 1LWUC 2J3OA 3FIBA 1JC9A 1RE4C 3BVHB 2FIBA 2J60A 1FZCB 2HPCB 1M1JC 2JHHC 2J3FA 1FZAC 2OYIC 1RE3B 2J0YA 2J3GA 1N86B 1RE4B 2Z4EB 1Z3UA 2J2PA 2WNPF 2XNXC 4JZCA 2Q9IC 2J1GA 1RF0C 1LT9C 3HUSC 1FZEC 3E1IB 4EPUA 2HLOC 3GHGC 2FFDC 2D39A 2HODC 2Q9IB 1LWUB 4R9JA 1FIDA 3HUSB 2J3UA 4M7HA 2HLOB 1FZDA 2JHKF 2J0GA 4M7FA 2H43C 2FFDB 2JHLF 1M1JB 4ZFGA 4JYOX 1FZAB 2OYIB 1N73C 1FZBC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XNX B;  1FZG C;  2H43 B;  1RF1 C;  3BVH C;  1RF0 B;  2J61 A;  1LT9 B;  1FIC A;  1N73 B;  1FZE B;  1FZB B;  1FIB A;  1RE3 C;  2GY7 A;  1FZF C;  3H32 C;  2J3F D;  2J64 A;  1N86 C;  1FZG B;  2Z4E C;  1RF1 B;  2HOD B;  1LTJ C;  2JHI F;  2J0H A;  2OYH C;  2J5Z A;  4R9T A;  1FZF B;  2J61 B;  3E1I C;  3H32 B;  4NYT A;  1LTJ B;  1Z3S A;  1FZC C;  2HPC C;  2OYH B;  2JHM F;  1LWU C;  2J3O A;  3FIB A;  1JC9 A;  1RE4 C;  3BVH B;  2FIB A;  2J60 A;  1FZC B;  2HPC B;  1M1J C;  2JHH C;  2J3F A;  1FZA C;  2OYI C;  1RE3 B;  2J0Y A;  2J3G A;  1N86 B;  1RE4 B;  2Z4E B;  1Z3U A;  2J2P A;  2WNP F;  2XNX C;  4JZC A;  2Q9I C;  2J1G A;  1RF0 C;  1LT9 C;  3HUS C;  1FZE C;  3E1I B;  4EPU A;  2HLO C;  3GHG C;  2FFD C;  2D39 A;  2HOD C;  2Q9I B;  1LWU B;  4R9J A;  1FID A;  3HUS B;  2J3U A;  4M7H A;  2HLO B;  1FZD A;  2JHK F;  2J0G A;  4M7F A;  2H43 C;  2FFD B;  2JHL F;  1M1J B;  4ZFG A;  4JYO X;  1FZA B;  2OYI B;  1N73 C;  1FZB C; 
#chains in the Genus database with same CATH topology
 2XNX B;  1FZG C;  2H43 B;  1RF1 C;  3BVH C;  1RF0 B;  2J61 A;  1LT9 B;  1FIC A;  1N73 B;  1FZE B;  1FZB B;  1FIB A;  1RE3 C;  2GY7 A;  1FZF C;  3GHG B;  2J3F D;  3H32 C;  2J64 A;  1N86 C;  1FZG B;  2Z4E C;  1RF1 B;  2HOD B;  1LTJ C;  2JHI F;  2J0H A;  2OYH C;  2J5Z A;  4R9T A;  1FZF B;  2J61 B;  3E1I C;  3H32 B;  4NYT A;  1LTJ B;  1Z3S A;  1FZC C;  2HPC C;  2OYH B;  2JHM F;  1LWU C;  2J3O A;  3FIB A;  1JC9 A;  1RE4 C;  3BVH B;  2FIB A;  2J60 A;  1FZC B;  2HPC B;  1M1J C;  2JHH C;  2J3F A;  1FZA C;  2OYI C;  1RE3 B;  2J0Y A;  2J3G A;  1N86 B;  1RE4 B;  2Z4E B;  1Z3U A;  2J2P A;  2WNP F;  2XNX C;  4JZC A;  2Q9I C;  2J1G A;  1RF0 C;  1LT9 C;  3HUS C;  1FZE C;  3E1I B;  4EPU A;  2HLO C;  3GHG C;  2FFD C;  2D39 A;  2HOD C;  2Q9I B;  1LWU B;  4R9J A;  1FID A;  3HUS B;  2J3U A;  4M7H A;  2HLO B;  1FZD A;  2JHK F;  2J0G A;  4M7F A;  2H43 C;  2FFD B;  2JHL F;  1M1J B;  4ZFG A;  4JYO X;  1FZA B;  2OYI B;  1N73 C;  1FZB C; 
#chains in the Genus database with same CATH homology
 2XNX B;  1FZG C;  2H43 B;  1RF1 C;  3BVH C;  1RF0 B;  2J61 A;  1LT9 B;  1FIC A;  1N73 B;  1FZE B;  1FZB B;  1FIB A;  1RE3 C;  2GY7 A;  1FZF C;  3H32 C;  2J3F D;  2J64 A;  1N86 C;  1FZG B;  2Z4E C;  1RF1 B;  2HOD B;  1LTJ C;  2JHI F;  2J0H A;  2OYH C;  2J5Z A;  4R9T A;  1FZF B;  2J61 B;  3E1I C;  3H32 B;  4NYT A;  1LTJ B;  1Z3S A;  1FZC C;  2HPC C;  2OYH B;  2JHM F;  1LWU C;  2J3O A;  3FIB A;  1JC9 A;  1RE4 C;  3BVH B;  2FIB A;  2J60 A;  1FZC B;  2HPC B;  1M1J C;  2JHH C;  2J3F A;  1FZA C;  2OYI C;  1RE3 B;  2J0Y A;  2J3G A;  1N86 B;  1RE4 B;  2Z4E B;  1Z3U A;  2J2P A;  2WNP F;  2XNX C;  4JZC A;  2Q9I C;  2J1G A;  1RF0 C;  1LT9 C;  3HUS C;  1FZE C;  3E1I B;  4EPU A;  2HLO C;  3GHG C;  2FFD C;  2D39 A;  2HOD C;  2Q9I B;  1LWU B;  4R9J A;  1FID A;  3HUS B;  2J3U A;  4M7H A;  2HLO B;  1FZD A;  2JHK F;  2J0G A;  4M7F A;  2H43 C;  2FFD B;  2JHL F;  1M1J B;  4ZFG A;  4JYO X;  1FZA B;  2OYI B;  1N73 C;  1FZB C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...