2Z4EC

Crystal structure of d-dimer from human fibrin complexed with gly-his-arg-pro-tyr-amide
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
292
structure length
292
Chain Sequence
THDSSIRYLQEIYNSNNQKIVNLKEKVAQLEAQCQEPCKDTVQIHDITGKDCQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQSAIPYALRVELEDWNGRTSTADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEGNCAEQDGSGWWMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIPFNRLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Blood clotting
molecule keywords Fibrinogen alpha chain
publication title Probing the beta-chain hole of fibrinogen with synthetic peptides that differ at their amino termini
pubmed doi rcsb
total genus 89
structure length 292
sequence length 292
chains with identical sequence F
ec nomenclature
pdb deposition date 2007-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 2z4eC01
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 2z4eC02
1RF0C 2OYIB 2FIBA 2D39A 2XNXB 2J0HA 1FZGB 1FZAB 4M7FA 1FZCC 2J60A 2WNPF 1FZGC 2GY7A 1LT9C 1RE3B 2JHMF 2HPCB 1RE3C 1FIDA 1FICA 1M1JB 2HODC 4NYTA 1M1JC 1JC9A 2JHLF 2J3FD 4JZCA 4R9TA 2HLOB 2FFDB 1RF1B 2J1GA 1LWUB 2HLOC 2J2PA 2FFDC 2OYIC 2JHKF 1FIBA 1FZDA 2XNXC 2H43B 1FZAC 4EPUA 2J0YA 2J3GA 1Z3SA 2J64A 2J61A 2HPCC 1FZEB 2JHIF 3HUSB 1N73B 2J3OA 1FZFB 1RF1C 2Q9IB 1LWUC 1N73C 1FZFC 4ZFGA 3GHGC 2Q9IC 2J5ZA 4M7HA 1RE4B 3FIBA 1N86B 3BVHB 2H43C 3E1IB 2J3FA 3E1IC 1FZBB 1RF0B 1FZBC 1FZEC 2OYHB 1Z3UA 1LTJB 4R9JA 2OYHC 1LTJC 2J3UA 3HUSC 1FZCB 1LT9B 2J0GA 3H32B 2JHHC 3H32C 4JYOX 2HODB 1RE4C 2J61B 1N86C 3BVHC 2Z4EB 2Z4EC
chains in the Genus database with same CATH superfamily
1RF0C 2OYIB 2FIBA 2D39A 2XNXB 2J0HA 1FZGB 1FZAB 4M7FA 1FZCC 2J60A 2WNPF 1FZGC 2GY7A 1LT9C 1RE3B 2JHMF 2HPCB 1RE3C 1FIDA 1FICA 1M1JB 2HODC 4NYTA 1M1JC 1JC9A 2JHLF 2J3FD 4JZCA 4R9TA 2HLOB 2FFDB 1RF1B 2J1GA 1LWUB 2HLOC 2J2PA 2FFDC 2OYIC 2JHKF 1FIBA 1FZDA 2XNXC 2H43B 1FZAC 4EPUA 2J0YA 2J3GA 1Z3SA 2J64A 2J61A 2HPCC 1FZEB 2JHIF 3HUSB 1N73B 2J3OA 1FZFB 1RF1C 3GHGB 1LWUC 2Q9IB 1N73C 1FZFC 4ZFGA 3GHGC 2Q9IC 2J5ZA 4M7HA 1RE4B 3FIBA 1N86B 3BVHB 2H43C 3E1IB 2J3FA 3E1IC 1FZBB 1RF0B 1FZBC 1FZEC 2OYHB 1Z3UA 1LTJB 4R9JA 2OYHC 1LTJC 2J3UA 3HUSC 1FZCB 1LT9B 2J0GA 3H32B 2JHHC 3H32C 4JYOX 2HODB 1RE4C 2J61B 1N86C 3BVHC 2Z4EB 2Z4EC
chains in the Genus database with same CATH topology
1RF0C 2OYIB 2FIBA 2D39A 2XNXB 2J0HA 1FZGB 1FZAB 4M7FA 1FZCC 2J60A 2WNPF 1FZGC 2GY7A 1LT9C 1RE3B 2JHMF 2HPCB 1RE3C 1FIDA 1FICA 1M1JB 2HODC 4NYTA 1M1JC 1JC9A 2JHLF 2J3FD 4JZCA 4R9TA 2HLOB 2FFDB 1RF1B 2J1GA 1LWUB 2HLOC 2J2PA 2FFDC 2OYIC 2JHKF 1FIBA 1FZDA 2XNXC 2H43B 1FZAC 4EPUA 2J0YA 2J3GA 1Z3SA 2J64A 2J61A 2HPCC 1FZEB 2JHIF 3HUSB 1N73B 2J3OA 1FZFB 1RF1C 2Q9IB 1LWUC 1N73C 1FZFC 4ZFGA 3GHGC 2Q9IC 2J5ZA 4M7HA 1RE4B 3FIBA 1N86B 3BVHB 2H43C 3E1IB 2J3FA 3E1IC 1FZBB 1RF0B 1FZBC 1FZEC 2OYHB 1Z3UA 1LTJB 4R9JA 2OYHC 1LTJC 2J3UA 3HUSC 1FZCB 1LT9B 2J0GA 3H32B 2JHHC 3H32C 4JYOX 2HODB 1RE4C 2J61B 1N86C 3BVHC 2Z4EB 2Z4EC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RF0 C;  2OYI B;  2FIB A;  2D39 A;  2XNX B;  2J0H A;  1FZG B;  1FZA B;  4M7F A;  1FZC C;  2J60 A;  2WNP F;  1FZG C;  2GY7 A;  1LT9 C;  1RE3 B;  2JHM F;  2HPC B;  1RE3 C;  1FID A;  1FIC A;  1M1J B;  2HOD C;  4NYT A;  1M1J C;  1JC9 A;  2JHL F;  2J3F D;  4JZC A;  4R9T A;  2HLO B;  2FFD B;  1RF1 B;  2J1G A;  1LWU B;  2HLO C;  2J2P A;  2FFD C;  2OYI C;  2JHK F;  1FIB A;  1FZD A;  2XNX C;  2H43 B;  1FZA C;  4EPU A;  2J0Y A;  2J3G A;  1Z3S A;  2J64 A;  2J61 A;  2HPC C;  1FZE B;  2JHI F;  3HUS B;  1N73 B;  2J3O A;  1FZF B;  1RF1 C;  2Q9I B;  1LWU C;  1N73 C;  1FZF C;  4ZFG A;  3GHG C;  2Q9I C;  2J5Z A;  4M7H A;  1RE4 B;  3FIB A;  1N86 B;  3BVH B;  2H43 C;  3E1I B;  2J3F A;  3E1I C;  1FZB B;  1RF0 B;  1FZB C;  1FZE C;  2OYH B;  1Z3U A;  1LTJ B;  4R9J A;  2OYH C;  1LTJ C;  2J3U A;  3HUS C;  1FZC B;  1LT9 B;  2J0G A;  3H32 B;  2JHH C;  3H32 C;  4JYO X;  2HOD B;  1RE4 C;  2J61 B;  1N86 C;  3BVH C;  2Z4E B;  2Z4E C; 
#chains in the Genus database with same CATH topology
 1RF0 C;  2OYI B;  2FIB A;  2D39 A;  2XNX B;  2J0H A;  1FZG B;  1FZA B;  4M7F A;  1FZC C;  2J60 A;  2WNP F;  1FZG C;  2GY7 A;  1LT9 C;  1RE3 B;  2JHM F;  2HPC B;  1RE3 C;  1FID A;  1FIC A;  1M1J B;  2HOD C;  4NYT A;  1M1J C;  1JC9 A;  2JHL F;  2J3F D;  4JZC A;  4R9T A;  2HLO B;  2FFD B;  1RF1 B;  2J1G A;  1LWU B;  2HLO C;  2J2P A;  2FFD C;  2OYI C;  2JHK F;  1FIB A;  1FZD A;  2XNX C;  2H43 B;  1FZA C;  4EPU A;  2J0Y A;  2J3G A;  1Z3S A;  2J64 A;  2J61 A;  2HPC C;  1FZE B;  2JHI F;  3HUS B;  1N73 B;  2J3O A;  1FZF B;  1RF1 C;  3GHG B;  1LWU C;  2Q9I B;  1N73 C;  1FZF C;  4ZFG A;  3GHG C;  2Q9I C;  2J5Z A;  4M7H A;  1RE4 B;  3FIB A;  1N86 B;  3BVH B;  2H43 C;  3E1I B;  2J3F A;  3E1I C;  1FZB B;  1RF0 B;  1FZB C;  1FZE C;  2OYH B;  1Z3U A;  1LTJ B;  4R9J A;  2OYH C;  1LTJ C;  2J3U A;  3HUS C;  1FZC B;  1LT9 B;  2J0G A;  3H32 B;  2JHH C;  3H32 C;  4JYO X;  2HOD B;  1RE4 C;  2J61 B;  1N86 C;  3BVH C;  2Z4E B;  2Z4E C; 
#chains in the Genus database with same CATH homology
 1RF0 C;  2OYI B;  2FIB A;  2D39 A;  2XNX B;  2J0H A;  1FZG B;  1FZA B;  4M7F A;  1FZC C;  2J60 A;  2WNP F;  1FZG C;  2GY7 A;  1LT9 C;  1RE3 B;  2JHM F;  2HPC B;  1RE3 C;  1FID A;  1FIC A;  1M1J B;  2HOD C;  4NYT A;  1M1J C;  1JC9 A;  2JHL F;  2J3F D;  4JZC A;  4R9T A;  2HLO B;  2FFD B;  1RF1 B;  2J1G A;  1LWU B;  2HLO C;  2J2P A;  2FFD C;  2OYI C;  2JHK F;  1FIB A;  1FZD A;  2XNX C;  2H43 B;  1FZA C;  4EPU A;  2J0Y A;  2J3G A;  1Z3S A;  2J64 A;  2J61 A;  2HPC C;  1FZE B;  2JHI F;  3HUS B;  1N73 B;  2J3O A;  1FZF B;  1RF1 C;  2Q9I B;  1LWU C;  1N73 C;  1FZF C;  4ZFG A;  3GHG C;  2Q9I C;  2J5Z A;  4M7H A;  1RE4 B;  3FIB A;  1N86 B;  3BVH B;  2H43 C;  3E1I B;  2J3F A;  3E1I C;  1FZB B;  1RF0 B;  1FZB C;  1FZE C;  2OYH B;  1Z3U A;  1LTJ B;  4R9J A;  2OYH C;  1LTJ C;  2J3U A;  3HUS C;  1FZC B;  1LT9 B;  2J0G A;  3H32 B;  2JHH C;  3H32 C;  4JYO X;  2HOD B;  1RE4 C;  2J61 B;  1N86 C;  3BVH C;  2Z4E B;  2Z4E C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...