1RF1B

Crystal structure of fragment d of gammae132a fibrinogen with the peptide ligand gly-his-arg-pro-amide
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
299
structure length
299
Chain Sequence
IPTNLRVLRSILENLRSKIQKLESDVSAQMEYCRTPCTVSCNIPVVSGKECEEIIRKGGETSEMYLIQPDSSVKPYRVYCDMNTENGGWTVIQNRQDGSVDFGRKWDPYKQGFGNVATNTDGKNYCGLPGEYWLGNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGGFTVQNEANKYQISVNKYRGTAGNALMDGASQLMGENRTMTIHNGMFFSTYDRDNDGWLTSDPRKQCSKEDGGGWWYNRCHAANPNGRYYWGGQYTWDMAKHGTDDGVVWMNWKGSWYSMRKMSMKIRPFFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Calcium-Binding Site beta2, Adjacent to the "b" Polymerization Site, Modulates Lateral Aggregation of Protofibrils during Fibrin Polymerization.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
molecule keywords Fibrinogen alpha/alpha-E chain
total genus 97
structure length 299
sequence length 299
chains with identical sequence E
ec nomenclature
pdb deposition date 2003-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1rf1B01
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 1rf1B02
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 1rf1B03
3H32B 1LTJC 1FZCA 1T3UA 2J64A 1RE3A 4R9JA 1JY2O 2H43A 1N73C 2J0GA 2J2PA 1Z3SA 2HPCC 1JY2N 1FZFC 1LT9B 2A45I 2J61B 1FICA 2Z4EA 3E1IC 1LTJB 1JC9A 2WNPF 2Z4EB 2J5ZA 1N86C 1FZGC 1FZBB 2GY7A 1RE4A 3HUSA 1M1JB 1JY3N 4JZCA 2J0YA 1LWUA 2OYIC 1RF0A 1RE4C 4ZFGA 1FZEA 3HUSB 3GHGA 2HPCB 3BVHB 1FZCC 3GHGB 1JY2P 3BVHA 2HPCA 2D39A 2JHKF 1FZEC 1FZGA 1LT9C 3GHGC 1FZBC 4M7HA 1RF0C 1M1JC 3H32A 2Z4EC 1RF1C 2J3GA 1RE3B 1RE4B 1FZFA 1FZCB 2FIBA 1JY3P 1M1JA 2J3UA 1FIDA 1RF1B 2HLOC 1FZBA 2HODB 2FFDC 1FZAA 4M7FA 4JYOX 4R9TA 2HLOB 2J61A 1LTJA 2OYHC 3HUSC 1FZDA 1FZEB 1FZAC 1LT9A 3H32C 2XNXC 2OYHB 4NYTA 2HLOA 1RF0B 1LWUB 3BVHC 2XNXB 2FFDB 2Q9IA 2H43B 1N73A 1RF1A 3E1IA 2Q9IB 4EPUA 2J0HA 1W2EA 1FIBA 3FIBA 3E1IB 2XNXA 1Z3UA 2Q9IC 2J1GA 1N73B 1N86A 2HODC 2J60A 2FFDA 1LWUC 2OYIA 1RE3C 2JHMF 2J3FD 2J3FA 1FZGB 2OYHA 2JHHC 2A45G 2JHIF 1JY3O 1FZAB 2A45H 2OYIB 2HODA 2JHLF 1N86B 1FZFB 2J3OA 2H43C
chains in the Genus database with same CATH superfamily
5C39A 4LGDE 3TGUD 1YI2P 1L0NE 1NAFA 1Z3SA 1JY2N 4I1LA 3MZWB 3FXEA 1R5SA 3NFQA 5KLVK 1GK6A 2C0WA 2D2CB 5CHXA 4WY4C 1OFCX 1N86C 2WPRA 1J1DC 2GY7A 1IFPA 4IFMA 4H13B 2C0XA 4H44C 1L0LG 1SQQJ 1PPJE 2R3CA 4N3YB 4IFFA 1DD3A 3M9BA 1HF9A 1Q82Q 2VRSA 1FZBC 3VMZA 4KHXA 1RF0C 5CCHA 3H32A 4OVNF 3SSUA 1MFTA 3W67A 5KJ7D 2O01N 4L76A 4UB6H 3HE4B 2B89A 3L74D 1SQXJ 1FZEB 2YMKA 1P84E 1S4XA 3KPEA 4RKUJ 3RBXA 3TNUB 2XNXB 1PIXA 3E1IA 4XFJA 2V4HA 1ZOYC 3H1LJ 1RHZB 2FFDA 1OZHA 1D7MA 2GUSA 2OYOA 2O01H 3V2PA 1KD1Q 4H13D 4MN4C 1SQBJ 3GF7A 2AEMA 3L72E 4WY4A 2L5GB 3V4WA 4O9BA 1AVYA 1SQQE 1BE3J 3PRJA 3CX5D 3GW6A 2J0GA 1OXZA 4OGQB 4EYYQ 3L35A 3M9HA 1R8EA 2IZ1A 2G3AA 3RL0g 2ZJSE 4DT0A 3HE4A 2WNPF 2Z4EB 3L74J 4IL6E 2WSCH 2BCCG 1MV8A 1J1DB 1JTHA 2Y9ZA 1RF0A 4GKGA 4ZFGA 3P32A 1ZR4A 2E5TA 3B5NA 1CI6B 1IFMA 1ZXGA 1BE3E 3LW5H 3L71E 2M3BA 2IZ0A 4M7HA 2W27A 1NWQA 2Z5HA 2N9YB 1FZFA 1EQ7A 1HJ0A 1SQPE 1KYOE 1LJ2A 3A7OA 1T8ZA 2O1KA 2ZVNB 1LNQA 1FDIA 3CXHD 4JPZB 1J2JB 1S3JA 4B86A 3RL0D 1S5LX 2Q9IB 2QJPC 3Q5RA 2XNXA 2FYNC 1H8AA 3V5BA 4NPEA 3PLNA 1OMIA 4Y99C 2E74C 1YITP 1JMBA 1YJNP 3CC7P 5TISH 3JC22 4JYBA 1E79H 1SQVJ 3CWBD 2H43C 1NU1G 1LT1A 5KJ7A 2DW3A 2QRXA 4RJTA 1DD4A 1WT6A 1SQQG 1L4AA 1L4AD 1U7MA 2LXCB 4D6TJ 3BCCE 3B5NC 1OIPA 3L37A 3SWKA 3AE8C 2UWJE 3H1IE 2QE7H 2NPSC 4JZCA 1URQB 1PZQA 3VP8A 1OWAA 3EWKA 1EZVI 1YJWP 4GIFA 3L72G 2Y0CA 1PPJD 1IC2A 2R5BA 1VQPP 4EOTA 1KB9D 2R44A 1EZVD 2ZYGA 3O6QA 1N7LA 2N1TC 1Q2NA 1LTTC 2M3EA 3U1CA 1NTZG 1JNMA 1L4AB 5AVUB 1LWUB 1BGYJ 2QSIA 4HKZH 1VQNP 1PPJG 1KILA 4EPUA 1L0NK 1OW7A 3A0BH 1GL2B 3H1KE 1SS1A 3FIBA 2Q9IC 5AW1B 2AEFA 2FYUG 1FZGB 4KT0J 1IFDA 1SFCC 1N86B 4I2LC 3TK1A 3WUVA 3L75D 1KB9E 1VQOP 1M8OB 2QA4P 3CCLP 2WSFJ 1VDFA 1SQQD 2A45I 2K9YA 1EXJA 1KYOD 3MUDC 1KZUB 3WU2E 1M1JB 1AFOA 5AVWB 1U7JA 1NTMG 3L75G 3IN6A 4D6TE 3OA7A 1KILE 2HPCA 2WSEH 2QM7A 5DJUB 1M90Q 1DEEG 4XE5B 1FZEC 3L70E 3G6EP 2IBZD 3CCEP 3HD7B 2SPZA 1YYCA 2I8DA 4AYCA 3C1LA 1QGKB 4HYTB 4XA4A 1JY3P 3H1HD 1H0TB 2K1AA 3ITKA 4M7FA 1K73Q 1SFCB 2YMYA 3H1HE 1PFIA 2FKWB 3CCUP 1JEKA 1FZDA 1NTMD 1BCCG 1H88A 1G2CA 1X79B 1LT9A 2PP6A 3H32C 1QVFO 2WPQA 1NTZD 1S5LE 2JEEA 1NTMJ 1GW4A 1FIBA 5CJ4A 1VQMP 2PGDA 1SQVK 2KLVA 3A2AA 2A06D 3A0BE 1FOSE 3PP5A 4U7JA 1Q90D 2KK7A 3L72D 4I7ZB 4ZKPA 2YO3A 3H1JD 1N73C 4ASVA 4Y28J 4OGQD 3I5CA 3H1JG 4GT1A 5B5EH 2Z4EA 2BEZF 2KZJA 3V6IA 3FWLA 2IYPA 3KZIH 2OQQA 1ZLLA 3CI9A 3L74E 2M5AA 3WUTA 1GDTA 1G2CB 2MJZA 3AE1C 3F5HA 1KB9H 1Z56A 3A3YB 3KXDA 1HJBA 2WWWA 1J1EB 4ZMDA 2ZFCA 4C7RA 3AEAC 1Q81Q 2YKPA 2HYNA 4R4LA 3SFDC 1SQBD 2KI7B 3OAKA 4GOEA 1PV3A 2K9JA 1K05A 3H1HG 4WY4D 2E75D 3G4SP 5DJTB 4HH2A 3HTKA 2W8ZA 1NTKG 2QIWA 1L0LJ 1SQXE 1AV1A 1SVFA 3IR9A 2OYIA 2JHMF 3VMXA 1LTIC 2BEQD 1VQ5P 1JY3O 3CWBE 4I6MC 1SFCD 3MTUE 2OYIB 2J58A 3A0HH 2JHLF 1W2BO 2KB7P 5BU5A 1SQVE 1CZQA 2GUVA 1QLED 1SQBK 3WMM0 4TLFA 1KILC 2W6BA 3AEGC 2HPCC 1PGJA 3KHUA 3B8EB 1NTKK 2WITA 2WSSH 2P58A 1VF5C 2K3RA 1KQLA 3VN0A 3H25A 2WSEJ 2PAJA 3HD7D 1S1CX 3II6A 1RE4C 1Y8AA 1BE3G 2HPCB 3I55P 2QJKC 2KS1B 1YTZI 2NPSA 2ZXXA 5B5EE 1QL1A 3KQGA 1EDIA 3IFMA 5KLVG 2ZAEB 5AVSB 2OTLP 2FFDC 5AVQB 2YXQB 4WBAA 5AW7B 1DEBA 1EZVG 1KQGB 3OJAB 3KDPB 3L74G 2HLOA 2JR8A 2BCCJ 3N7NA 2Q9IA 1N73A 2IDBA 1GL2A 3PHLA 2N1TA 3HD7A 3L70G 2HG5D 2KSEA 1LTBC 3V4QA 2ZYAA 3FXDA 2G8YA 2IBZI 1K9MQ 4U3FG 1FZCA 3D70A 1RE3A 1HTLC 3Q5PA 3S4RA 4IL6H 1LT9B 3CX5E 2WPSA 3I56P 2J59M 1NTKJ 1FJKA 3BATA 1Y47A 3L71G 1LTSC 1P84I 1ZN5A 3GHGA 1S9KE 3HRNA 3B5ND 2B87B 1SQVG 5APXA 4JQ0D 5AW8B 4W7YA 1URQD 1N7SC 5GTHH 1RE4B 2WZ7A 1M1JA 4Z1MH 3SFEC 3NXSA 2KP8A 4QMAA 2JWAA 5APVA 2J61A 1L0LK 3BCCD 2Y0EA 5TJHA 3LW5J 1JMMA 3CCSP 4U3FE 1BDDA 1N8RQ 1NTMK 2E76B 5TISE 5AW5B 1N7SD 3D6YA 1N73B 3EFGA 4YTPC 1RE3C 1YIJP 3CX5I 1K8AQ 2IFNA 2YXRB 1NJIQ 5AW9B 2J3OA 2O1JA 1VQ8P 2E75B 1LTJC 5APUA 3G3ZA 3RGUA 2O01J 1AA0A 4WY4B 2J64A 1FU1A 4R9JA 1URQA 3AEDC 3L73D 5APYA 1GK4A 1KQFB 1IFIA 2KYVA 2QJYC 2QEXP 1NHLA 2KS1A 2R5DA 1OW8A 5KLVE 1FS0E 2M5AB 2WPVB 4CPGA 2W6AA 3Q5SA 3S1KA 1L0LE 2YKOA 1FZEA 4KJMA 1EC5A 3PJSK 2LKMA 2N1TD 3VTPC 3C8VA 3BVHB 2JHKF 2XV5A 3Q2YA 3CX5H 2K37A 1IJDB 2KZIA 5KAFH 4OWFA 2KIKA 5H2FE 2POHA 3JCUH 1M56D 3CMAP 1JOCA 2HLOB 1G1IA 1SQPJ 2YIUC 1SQXK 1NU1J 3WUUA 3Q3DA 4M3LA 4ZKUA 2FFDB 1RF1A 1HGZA 1OVRA 1T2KD 1ZW0A 2P7JA 2KOGA 3L71J 3E1IB 1Z3UA 4BRYA 1KILD 1M1KQ 4N78D 2NZ2A 2KSJA 2J3FA 5CBNA 2XKMA 1N7SA 2FYUK 4ASWA 2FYZA 3E1RA 3O8ZA 3CMEP 1KTMA 4TT3H 1HWTC 3CCVP 3WU2H 4GOFA 2J61B 1NGMB 2K9JB 3A5TA 1PGPA 2RMZA 3U1AA 1NTZJ 1GZLA 3HUSA 1BGYG 1PP9E 2NRGA 1NU1K 3MHVA 2NPSB 1LP1B 2FYUJ 2ZYDA 5AVYB 1X9VA 4H44B 3H6PA 1LT9C 2YO2A 3CCMP 5AW0B 3L70D 3W68A 3VYIA 4WB4A 2Y9YA 1FZBA 3H1IG 5KTBA 2KXPB 1SQBG 1ZR2A 4JYOX 5KAFE 3HTKB 5KKZB 3B71A 1T6AA 1Q7YQ 1RY3A 3JCUE 4YXWH 2KNCA 2J0HA 5AVXB 3FX0A 3NTNA 3IF4A 3L75J 4DOJA 3QWOC 3AE2C 1R5LA 5KJ7C 2WT7B 2OTJP 1PGQA 3L75E 4IFDK 5B66E 2I1KA 3RK2D 1EXIA 1JY2O 2W6JH 3H1HJ 1PP9J 4C46A 1FC2C 1QEXA 1NAYA 5BVZA 2E42A 1TU3F 1FZBB 1JY3N 1NH4A 5CJ0A 1VQ6P 2LR2A 3GMAA 1KQSO 4I7ZC 1DH3A 5E79E 3P8CE 2GA1A 1VL2A 4C7NB 2KLUA 2FYUE 4K35A 3CWBJ 3O6QB 1X8YA 2FXOA 1LGHB 2E74D 3CXHH 2FXPA 3T97B 5KLIB 2Z4EC 2J3GA 3VMYA 2XU6A 2FIBA 2J3UA 3L73J 1FIDA 2Q1KA 1RF1B 1EZVE 2HLOC 3M9QA 1IK7A 1NTKD 3HUSC 1E5WA 2XNXC 4NYTA 1ZMEC 2IPPA 3JSVC 3H1JJ 2WSFH 3AE7C 1X0TA 1AVOA 3H1LD 1UIXA 2Z5IA 3LIEA 3M06A 2OYHA 1UIIA 4GODA 4H0LB 4HJGH 2A45H 3HE5A 1FBMA 4IL6X 1FZFB 5AW2B 3BCCJ 1BGYE 3AE4C 3AE5C 5AVRB 3CCJP 3ABVC 1YJ9P 2B88A 5AVTB 2R3SA 4AQRD 3E1IC 1X22A 1NO4A 4U3FD 1L2PA 3TSIA 1KYOH 2OYIC 1RQVA 5B66H 1FDMA 2CPBA 4D6TG 2Q6QA 1JY2P 3BVHA 2N9BA 4YPCA 1FZGA 1IO4A 4DZOA 4W80A 1FOSF 1IK9A 2W83C 1RE3B 1IFNA 1T2KC 1PGOA 1FZCB 2ZXEB 2E43A 1NTME 4LLHA 2D2CD 1T3JA 4RESB 3CXHE 3UIAA 3L36A 3NMDA 1YQ3C 5CCHD 2HR3A 3M0DA 2E74B 5GTIH 3BASA 2GM4A 5E79H 1EDJA 1RF0B 1OVUA 1VQLP 5AW6B 2JKVA 1W2EA 1JB0J 1KORA 1WRGA 1N86A 3V2RA 2J60A 4OGQC 1BE3D 4PJ0H 3RBZA 1SQPK 2A45G 1EDKA 2RN0A 1BCCE 2HODA 5KAIH 2V7QJ 1JO5A 1KFMA 1KMIZ 5AVVB 2A06G 3Q1MA 2P67A 3AEFC 3VOPA 2H89C 3GF3A 3AE9C 1YTZT 4DCKA 1SQXG 1JC9A 3CWBG 4N6JA 3IAOA 3CC2P 3EQ2A 3GLMA 1FZGC 2KNCB 1SQXD 1NVOA 3B5NB 3H1LG 1DIPA 1SLQA 1FDOA 4NPFX 2OGUA 4NPDA 3VMAA 3G71P 3L70J 2WSCJ 1NYHA 1SQQK 5APSA 1VQ7P 1JUNA 3M0AA 2QVAA 2CPSA 2FYUD 1ZV8A 2IFMA 2YIUB 3KZIE 2QJPB 4W7ZA 2HODB 2Q3EA 3V2NA 5APQA 1NU1E 2BCCE 1JCDA 2WVRA 1VQKP 4L75A 2JP3A 2XDJA 2YKQA 3H1KD 4U3FJ 4UB6E 3AE6C 1PL5A 4BWNA 1YHQP 2B9BA 2I1JA 5KLIC 3T97A 1ZRTD 1BDCA 1LWUC 2C9LY 4JBZA 3HE5B 1VQ9P 2E75C 2WMMA 1XTCC 1WMKA 4LC1A 1U57A 1A02F 2PRRA 1S72P 3P8CD 4PJ0E 5CMZA 1L0ND 3RK2B 2WQYC 2AXCA 5M1BA 1FZFC 2B87A 4WVZA 2MKVA 1LTJB 1L0NG 1GD2E 1K04A 2BASA 1RE4A 4WWIA 3AEEC 2J0YA 5KAIE 3USSA 3E7KA 1KV4A 3TF5A 1OW6A 3LIDA 4ZNCA 2OTKE 1S5LH 2QG4A 2D39A 5H2FH 5CBOA 1CI6A 3H1KG 5APWA 1LTGC 2A06E 1URQC 1BCCD 3QH9A 1RF1C 1MUUA 1LTAC 3VP9A 1USEA 3TGUJ 1L0NJ 4EDFA 1GU4A 1XTGB 1FZAC 3D6ZA 2IBZG 3MIWA 4L74A 5BU8B 1KYOI 1KN7A 3BVHC 3SWFA 1VF5D 3CCRP 4JF7A 1QVGO 2AXTH 2CK3H 2V7QH 1A02J 3MGNA 2WT7A 1VQ4P 4N78E 1Y9BA 5K5GB 3H1KJ 3H1LE 4IOIH 3V2QA 5AVZB 1S9KD 3RL0C 1FE6A 3M0DC 2IYOA 1W5CE 2KUBA 3ZDMA 1MFZA 1IZNB 2L91A 3TNUA 3TGUG 2H8PD 1M7LA 2W90A 3H1JE 2YNYA 1FICA 4PV1B 3CPWO 3EFFK 4K3AA 1MZ9A 5L8RJ 3TDKA 3U59A 2ZT9C 1FJPA 3FGAD 5APTA 1LWUA 1NOHA 3GG2A 2FXMA 1G1JA 3RK2C 1OX3A 1SP4A 2IBZE 2QJYB 1SQBE 1M1JC 4BRYB 1VF5B 2JDIH 3K5BA 2C9NY 2FY8A 5CCHC 4EI2A 3AECC 3CD6P 3BRVB 3PTZA 4PD4H 2HFED 3A0HE 3S9OA 1LTJA 2XZRA 4JYCA 1GL2C 5CCGC 1KC8Q 1ZP0C 2BCCD 1NTKE 3HD7C 4R4MA 5KLVJ 1QL2A 1ZRTE 3H1ID 4D6TD 4PD4D 2E76C 2J1GA 1KILB 2D2CC 5GTHE 2WTYA 2JHHC 3L72J 2ZT9B 3AEBC 1GL2D 3C9IA 3PH0A 1H89A 2OARA 1FAVA 4PV1C 3L73G 2PFXA 2JO1A 2R32A 2J2PA 3TGUE 3H1IJ 2H7HA 3N4XA 1BCCJ 5AW4B 1CSBA 2AXTE 2IX7C 1SFCA 1NU1D 2J5ZA 2LXBA 1N2DC 3BRTB 2QM8A 1JTHB 1GW3A 3HUSB 1PP9D 4H0LD 2Q5UA 1LP1A 3D71A 3GHGB 3RK3B 4AUWA 2P2UA 1RH5B 3GHGC 1J1EC 1RQUA 2QJKB 1M57D 1IFJA 4EIJA 3P8MC 1KFNA 2M0BA 4UB8E 4R9TA 1DX7A 2OYHC 3RK3C 1BSHA 2OYHB 3M91A 3AE3C 1HUCA 2H43B 4PD4E 1NTZE 1VPCA 5AW3B 1HBWA 3CXHI 4H0LC 1PP9G 1AJYA 3G9RA 2HODC 1N7SB 1Q86Q 3B4SA 3L71D 1S2EA 1AQTA 5KKZC 2AEJA 4L73A 2FYNB 4HB1A 1KB9I 2N1TB 2Y0DA 1CW5A 1SQPD 3H32B 1T3UA 2H43A 1OVVA 3CC4P 3TYYA 2XNDH 5CCGA 2O3JA 2RKLA 4PV1D 2ITAA 3KYQA 2P10A 1P84D 3CCQP 1USDA 3MD0A 1GMJA 1NTZK 1NKNA 4H13C 2ZT9D 1HH0A 1JM0A 2K88A 3MUDA 3OW2O 2J5UA 3SWYA 4C7NA 2JJLA 1P84H 2E76D 1YQ4C 1HVVA 1FZCC 2M8RA 3R2PA 2H88C 1GTWA 1NKZB 4RO0A 3CLQA 4GDOA 1BSNA 5EFWB 4PD4I 5GTIE 4Y99B 1HGVA 1MKMA 1FZAA 4YXDC 2JWDA 5CCGD 2ZVOB 5KLVD 2RH0A 3L73E 1QX8A 3BCCG 3P7KA 3RK3D 1L4AC 2FBWC 2P1JA 2Q3IA 3R4YA 2NPSD 3MP7B 3RK3E 4DJGA 1AQ5A 4H44D 4BXLA 1JCCA 3FWNA 2E5YA 3L4FA 2J3FD 1L0LD 3CL3D 3F89A 4UB8H 2JHIF 3RL0B 1FZAB 1YBKA 1SQVD 4A7PA 1BGYD 1GU5A 1SQPG 1H0TA 4OH8B 1EDLA 2Q7CA
chains in the Genus database with same CATH topology
5CMZA 4ZKPA 2YO3A 3O8ZA 3RK2B 4LGDE 1N73C 1HWTC 1NAFA 3I5CA 1Z3SA 1JY2N 4I1LA 1FZFC 4GT1A 2J61B 3NFQA 5KLVK 2Z4EA 3A5TA 1GK6A 1LTJB 2C0WA 5CHXA 1GD2E 4WY4C 3U1AA 1N86C 2WPRA 1J1DC 2BASA 1GZLA 2GY7A 1RE4A 3HUSA 1ZLLA 3CI9A 4IFMA 2J0YA 2C0XA 1GDTA 1G2CB 2MJZA 1NU1K 2R3CA 4N3YB 4IFFA 1Z56A 2NPSB 3LIDA 3A3YB 1HJBA 2WWWA 3M9BA 5AVYB 1X9VA 2D39A 1J1EB 2ZFCA 4C7RA 1CI6A 5APWA 3H6PA 1LT9C 2VRSA 2YO2A 1FZBC 3VMZA 4KHXA 1LTGC 1RF0C 2YKPA 5CCHA 2HYNA 1URQC 3H32A 5AW0B 1RF1C 3VYIA 1MUUA 1LTAC 4WB4A 3VP9A 1FZBA 5KJ7D 3OAKA 5KTBA 3HE4B 1ZR2A 4JYOX 4WY4D 3HTKB 1GU4A 1XTGB 1FZEB 1FZAC 4HH2A 3HTKA 3KPEA 3MIWA 1RY3A 5BU8B 3BVHC 3TNUB 3SWFA 2XNXB 3E1IA 2J0HA 5AVXB 4JF7A 1SVFA 3IR9A 2FFDA 3NTNA 2OYIA 1A02J 2JHMF 3MGNA 2GUSA 2WT7A 3VMXA 2O01H 3V2PA 4DOJA 1LTIC 4N78E 1JY3O 5KJ7C 4I6MC 2WT7B 1SFCD 5AVZB 3V2QA 3MTUE 4WY4A 2J58A 1S9KD 2L5GB 3RL0C 2OYIB 2JHLF 4IFDK 2KB7P 5BU5A 2GUVA 3M0DC 1CZQA 1SQBK 3V4WA 4O9BA 3WMM0 2I1KA 3RK2D 1JY2O 1MFZA 1KILC 2W6BA 2J0GA 1OXZA 3TNUA 4C46A 2HPCC 2H8PD 3L35A 3M9HA 1M7LA 3B8EB 2YNYA 1FICA 1NTKK 2WITA 3HE4A 2WNPF 2Z4EB 1MZ9A 5BVZA 2E42A 1FZBB 1KQLA 1JY3N 2WSCH 3U59A 1FJPA 1MV8A 1NH4A 1J1DB 5CJ0A 1JTHA 5APTA 3VN0A 1LWUA 1NOHA 2PAJA 1RF0A 3HD7D 3II6A 4GKGA 1RE4C 4ZFGA 2FXMA 3P32A 1ZR4A 2HPCB 3B5NA 1DH3A 1G1JA 3RK2C 1CI6B 1IFMA 3P8CE 1SP4A 4C7NB 1YTZI 2NPSA 3LW5H 2M3BA 1QL1A 1X8YA 1LGHB 3KQGA 4M7HA 2W27A 3IFMA 1NWQA 1M1JC 2Z5HA 2Z4EC 2J3GA 3VMYA 5AVSB 2C9NY 1FZFA 2XU6A 2FIBA 5CCHC 2J3UA 1EQ7A 1RF1B 1FIDA 2HLOC 3A7OA 3M9QA 2FFDC 5AVQB 3BRVB 4WBAA 1T8ZA 2HFED 2O1KA 5AW7B 1DEBA 1LTJA 2XZRA 4JYCA 3HUSC 1GL2C 3OJAB 5CCGC 3KDPB 1E5WA 2XNXC 4NYTA 2HLOA 1J2JB 4B86A 3HD7C 3N7NA 3RL0D 2Q9IA 1N73A 2Q9IB 1GL2A 1QL2A 2IPPA 2XNXA 2J1GA 1KILB 2N1TA 3HD7A 2WSFH 1H8AA 3V5BA 2WTYA 2Z5IA 3LIEA 3M06A 2OYHA 2JHHC 2HG5D 4Y99C 1LTBC 2A45H 3HE5A 3V4QA 4JYBA 1FBMA 1GL2D 3C9IA 5AW2B 1FZFB 2H43C 5KJ7A 2OARA 1FAVA 5AVRB 1H89A 1FZCA 1WT6A 1RE3A 1L4AA 1HTLC 1L4AD 2R32A 2J2PA 3B5NC 5AVTB 1LT9B 3N4XA 2H7HA 5AW4B 4AQRD 3E1IC 1CSBA 1NO4A 3L37A 2IX7C 1SFCA 2WPSA 2J5ZA 2J59M 1N2DC 3TSIA 3BRTB 2NPSC 2QM8A 1JTHB 1FJKA 4JZCA 1GW3A 1URQB 3BATA 3VP8A 2OYIC 1LTSC 1OWAA 1FDMA 3HUSB 1ZN5A 3GHGA 2CPBA 2Q5UA 4GIFA 1S9KE 3HRNA 3B5ND 1JY2P 3GHGB 3BVHA 3RK3B 4AUWA 1IC2A 2N9BA 2P2UA 1FZGA 2R5BA 1IO4A 5APXA 3GHGC 4EOTA 1J1EC 4DZOA 4W80A 1FOSF 1IK9A 5AW8B 4W7YA 1URQD 1N7SC 1IFJA 4EIJA 3P8MC 1RE3B 1RE4B 1IFNA 1T2KC 2WZ7A 1FZCB 1KFNA 1M1JA 1N7LA 2N1TC 3NXSA 2ZXEB 2E43A 4LLHA 1LTTC 4RESB 1T3JA 2KP8A 3UIAA 4R9TA 3L36A 3NMDA 5APVA 1DX7A 5CCHD 2J61A 3U1CA 1L0LK 2OYHC 3RK3C 3M0DA 1JNMA 1JMMA 3BASA 2GM4A 1L4AB 2OYHB 5AVUB 1RF0B 1LWUB 3M91A 1HUCA 2H43B 1KILA 5AW6B 1VPCA 1NTMK 5AW3B 1HBWA 4EPUA 1L0NK 1W2EA 1GL2B 5AW5B 3FIBA 1N7SD 2Q9IC 1N73B 1WRGA 1N86A 3EFGA 1N7SB 5AW1B 3V2RA 2HODC 2J60A 1RE3C 1SQPK 1FZGB 2A45G 2N1TB 1IFDA 2IFNA 1SFCC 2HODA 1N86B 4I2LC 5AW9B 3TK1A 1CW5A 2O1JA 2J3OA 1JO5A 1KFMA 5AVVB 3H32B 1LTJC 5APUA 3G3ZA 1T3UA 4WY4B 1FU1A 2J64A 2P67A 3VOPA 4R9JA 2H43A 3TYYA 1URQA 5CCGA 1VDFA 3KYQA 1YTZT 2A45I 5APYA 1GK4A 1JC9A 4N6JA 1IFIA 2KYVA 3MD0A 3EQ2A 1NHLA 1NTZK 1NKNA 2R5DA 1FZGC 1KZUB 3B5NB 1M1JB 1AFOA 5AVWB 2W6AA 1HH0A 1SLQA 2YKOA 1FZEA 3MUDA 3SWYA 4C7NA 2JJLA 2LKMA 2N1TD 3OA7A 3VTPC 3BVHB 1HVVA 1FZCC 2HPCA 2JHKF 2WSEH 1SQQK 2QM7A 2XV5A 5APSA 2M8RA 4XE5B 3R2PA 1FZEC 1JUNA 3M0AA 1IJDB 2CPSA 3HD7B 1GTWA 1ZV8A 1YYCA 1NKZB 2IFMA 4AYCA 3CLQA 4HYTB 4XA4A 1JY3P 2POHA 4W7ZA 4Y99B 1HGVA 2HODB 1FZAA 4M7FA 1SFCB 2YMYA 1JOCA 5APQA 3V2NA 2HLOB 1PFIA 1G1IA 2FKWB 1JCDA 5CCGD 1FZDA 1SQXK 1G2CA 1H88A 1X79B 1LT9A 2PP6A 3H32C 2WPQA 3P7KA 4M3LA 3RK3D 2JEEA 2XDJA 1L4AC 2YKQA 4ZKUA 2FFDB 2P1JA 1RF1A 1HGZA 2Q3IA 2NPSD 1T2KD 2P7JA 2KOGA 1GW4A 1FIBA 3E1IB 5CJ4A 1Z3UA 1KILD 1AQ5A 4N78D 2I1JA 3T97A 1JCCA 1LWUC 3L4FA 2C9LY 2KSJA 3HE5B 3CL3D 2J3FA 1SQVK 2J3FD 1XTCC 2XKMA 2KLVA 4LC1A 2JHIF 3RL0B 1FZAB 3A2AA 1A02F 1FOSE 1N7SA 1GU5A 2FYUK 3P8CD 3PP5A 4OH8B 2Q7CA 2FYZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H32 B;  1LTJ C;  1FZC A;  1T3U A;  2J64 A;  1RE3 A;  4R9J A;  1JY2 O;  2H43 A;  1N73 C;  2J0G A;  2J2P A;  1Z3S A;  2HPC C;  1JY2 N;  1FZF C;  1LT9 B;  2A45 I;  2J61 B;  1FIC A;  2Z4E A;  3E1I C;  1LTJ B;  1JC9 A;  2WNP F;  2Z4E B;  2J5Z A;  1N86 C;  1FZG C;  1FZB B;  2GY7 A;  1RE4 A;  3HUS A;  1M1J B;  1JY3 N;  4JZC A;  2J0Y A;  1LWU A;  2OYI C;  1RF0 A;  1RE4 C;  4ZFG A;  1FZE A;  3HUS B;  3GHG A;  2HPC B;  3BVH B;  1FZC C;  3GHG B;  1JY2 P;  3BVH A;  2HPC A;  2D39 A;  2JHK F;  1FZE C;  1FZG A;  1LT9 C;  3GHG C;  1FZB C;  4M7H A;  1RF0 C;  1M1J C;  3H32 A;  2Z4E C;  1RF1 C;  2J3G A;  1RE3 B;  1RE4 B;  1FZF A;  1FZC B;  2FIB A;  1JY3 P;  1M1J A;  2J3U A;  1FID A;  1RF1 B;  2HLO C;  1FZB A;  2HOD B;  2FFD C;  1FZA A;  4M7F A;  4JYO X;  4R9T A;  2HLO B;  2J61 A;  1LTJ A;  2OYH C;  3HUS C;  1FZD A;  1FZE B;  1FZA C;  1LT9 A;  3H32 C;  2XNX C;  2OYH B;  4NYT A;  2HLO A;  1RF0 B;  1LWU B;  3BVH C;  2XNX B;  2FFD B;  2Q9I A;  2H43 B;  1N73 A;  1RF1 A;  3E1I A;  2Q9I B;  4EPU A;  2J0H A;  1W2E A;  1FIB A;  3FIB A;  3E1I B;  2XNX A;  1Z3U A;  2Q9I C;  2J1G A;  1N73 B;  1N86 A;  2HOD C;  2J60 A;  2FFD A;  1LWU C;  2OYI A;  1RE3 C;  2JHM F;  2J3F D;  2J3F A;  1FZG B;  2OYH A;  2JHH C;  2A45 G;  2JHI F;  1JY3 O;  1FZA B;  2A45 H;  2OYI B;  2HOD A;  2JHL F;  1N86 B;  1FZF B;  2J3O A;  2H43 C; 
#chains in the Genus database with same CATH topology
 5C39 A;  4LGD E;  3TGU D;  1YI2 P;  1L0N E;  1NAF A;  1Z3S A;  1JY2 N;  4I1L A;  3MZW B;  3FXE A;  1R5S A;  3NFQ A;  5KLV K;  1GK6 A;  2C0W A;  2D2C B;  5CHX A;  4WY4 C;  1OFC X;  1N86 C;  2WPR A;  1J1D C;  2GY7 A;  1IFP A;  4IFM A;  4H13 B;  2C0X A;  4H44 C;  1L0L G;  1SQQ J;  1PPJ E;  2R3C A;  4N3Y B;  4IFF A;  1DD3 A;  3M9B A;  1HF9 A;  1Q82 Q;  2VRS A;  1FZB C;  3VMZ A;  4KHX A;  1RF0 C;  5CCH A;  3H32 A;  4OVN F;  3SSU A;  1MFT A;  3W67 A;  5KJ7 D;  2O01 N;  4L76 A;  4UB6 H;  3HE4 B;  2B89 A;  3L74 D;  1SQX J;  1FZE B;  2YMK A;  1P84 E;  1S4X A;  3KPE A;  4RKU J;  3RBX A;  3TNU B;  2XNX B;  1PIX A;  3E1I A;  4XFJ A;  2V4H A;  1ZOY C;  3H1L J;  1RHZ B;  2FFD A;  1OZH A;  1D7M A;  2GUS A;  2OYO A;  2O01 H;  3V2P A;  1KD1 Q;  4H13 D;  4MN4 C;  1SQB J;  3GF7 A;  2AEM A;  3L72 E;  4WY4 A;  2L5G B;  3V4W A;  4O9B A;  1AVY A;  1SQQ E;  1BE3 J;  3PRJ A;  3CX5 D;  3GW6 A;  2J0G A;  1OXZ A;  4OGQ B;  4EYY Q;  3L35 A;  3M9H A;  1R8E A;  2IZ1 A;  2G3A A;  3RL0 g;  2ZJS E;  4DT0 A;  3HE4 A;  2WNP F;  2Z4E B;  3L74 J;  4IL6 E;  2WSC H;  2BCC G;  1MV8 A;  1J1D B;  1JTH A;  2Y9Z A;  1RF0 A;  4GKG A;  4ZFG A;  3P32 A;  1ZR4 A;  2E5T A;  3B5N A;  1CI6 B;  1IFM A;  1ZXG A;  1BE3 E;  3LW5 H;  3L71 E;  2M3B A;  2IZ0 A;  4M7H A;  2W27 A;  1NWQ A;  2Z5H A;  2N9Y B;  1FZF A;  1EQ7 A;  1HJ0 A;  1SQP E;  1KYO E;  1LJ2 A;  3A7O A;  1T8Z A;  2O1K A;  2ZVN B;  1LNQ A;  1FDI A;  3CXH D;  4JPZ B;  1J2J B;  1S3J A;  4B86 A;  3RL0 D;  1S5L X;  2Q9I B;  2QJP C;  3Q5R A;  2XNX A;  2FYN C;  1H8A A;  3V5B A;  4NPE A;  3PLN A;  1OMI A;  4Y99 C;  2E74 C;  1YIT P;  1JMB A;  1YJN P;  3CC7 P;  5TIS H;  3JC2 2;  4JYB A;  1E79 H;  1SQV J;  3CWB D;  2H43 C;  1NU1 G;  1LT1 A;  5KJ7 A;  2DW3 A;  2QRX A;  4RJT A;  1DD4 A;  1WT6 A;  1SQQ G;  1L4A A;  1L4A D;  1U7M A;  2LXC B;  4D6T J;  3BCC E;  3B5N C;  1OIP A;  3L37 A;  3SWK A;  3AE8 C;  2UWJ E;  3H1I E;  2QE7 H;  2NPS C;  4JZC A;  1URQ B;  1PZQ A;  3VP8 A;  1OWA A;  3EWK A;  1EZV I;  1YJW P;  4GIF A;  3L72 G;  2Y0C A;  1PPJ D;  1IC2 A;  2R5B A;  1VQP P;  4EOT A;  1KB9 D;  2R44 A;  1EZV D;  2ZYG A;  3O6Q A;  1N7L A;  2N1T C;  1Q2N A;  1LTT C;  2M3E A;  3U1C A;  1NTZ G;  1JNM A;  1L4A B;  5AVU B;  1LWU B;  1BGY J;  2QSI A;  4HKZ H;  1VQN P;  1PPJ G;  1KIL A;  4EPU A;  1L0N K;  1OW7 A;  3A0B H;  1GL2 B;  3H1K E;  1SS1 A;  3FIB A;  2Q9I C;  5AW1 B;  2AEF A;  2FYU G;  1FZG B;  4KT0 J;  1IFD A;  1SFC C;  1N86 B;  4I2L C;  3TK1 A;  3WUV A;  3L75 D;  1KB9 E;  1VQO P;  1M8O B;  2QA4 P;  3CCL P;  2WSF J;  1VDF A;  1SQQ D;  2A45 I;  2K9Y A;  1EXJ A;  1KYO D;  3MUD C;  1KZU B;  3WU2 E;  1M1J B;  1AFO A;  5AVW B;  1U7J A;  1NTM G;  3L75 G;  3IN6 A;  4D6T E;  3OA7 A;  1KIL E;  2HPC A;  2WSE H;  2QM7 A;  5DJU B;  1M90 Q;  1DEE G;  4XE5 B;  1FZE C;  3L70 E;  3G6E P;  2IBZ D;  3CCE P;  3HD7 B;  2SPZ A;  1YYC A;  2I8D A;  4AYC A;  3C1L A;  1QGK B;  4HYT B;  4XA4 A;  1JY3 P;  3H1H D;  1H0T B;  2K1A A;  3ITK A;  4M7F A;  1K73 Q;  1SFC B;  2YMY A;  3H1H E;  1PFI A;  2FKW B;  3CCU P;  1JEK A;  1FZD A;  1NTM D;  1BCC G;  1H88 A;  1G2C A;  1X79 B;  1LT9 A;  2PP6 A;  3H32 C;  1QVF O;  2WPQ A;  1NTZ D;  1S5L E;  2JEE A;  1NTM J;  1GW4 A;  1FIB A;  5CJ4 A;  1VQM P;  2PGD A;  1SQV K;  2KLV A;  3A2A A;  2A06 D;  3A0B E;  1FOS E;  3PP5 A;  4U7J A;  1Q90 D;  2KK7 A;  3L72 D;  4I7Z B;  4ZKP A;  2YO3 A;  3H1J D;  1N73 C;  4ASV A;  4Y28 J;  4OGQ D;  3I5C A;  3H1J G;  4GT1 A;  5B5E H;  2Z4E A;  2BEZ F;  2KZJ A;  3V6I A;  3FWL A;  2IYP A;  3KZI H;  2OQQ A;  1ZLL A;  3CI9 A;  3L74 E;  2M5A A;  3WUT A;  1GDT A;  1G2C B;  2MJZ A;  3AE1 C;  3F5H A;  1KB9 H;  1Z56 A;  3A3Y B;  3KXD A;  1HJB A;  2WWW A;  1J1E B;  4ZMD A;  2ZFC A;  4C7R A;  3AEA C;  1Q81 Q;  2YKP A;  2HYN A;  4R4L A;  3SFD C;  1SQB D;  2KI7 B;  3OAK A;  4GOE A;  1PV3 A;  2K9J A;  1K05 A;  3H1H G;  4WY4 D;  2E75 D;  3G4S P;  5DJT B;  4HH2 A;  3HTK A;  2W8Z A;  1NTK G;  2QIW A;  1L0L J;  1SQX E;  1AV1 A;  1SVF A;  3IR9 A;  2OYI A;  2JHM F;  3VMX A;  1LTI C;  2BEQ D;  1VQ5 P;  1JY3 O;  3CWB E;  4I6M C;  1SFC D;  3MTU E;  2OYI B;  2J58 A;  3A0H H;  2JHL F;  1W2B O;  2KB7 P;  5BU5 A;  1SQV E;  1CZQ A;  2GUV A;  1QLE D;  1SQB K;  3WMM 0;  4TLF A;  1KIL C;  2W6B A;  3AEG C;  2HPC C;  1PGJ A;  3KHU A;  3B8E B;  1NTK K;  2WIT A;  2WSS H;  2P58 A;  1VF5 C;  2K3R A;  1KQL A;  3VN0 A;  3H25 A;  2WSE J;  2PAJ A;  3HD7 D;  1S1C X;  3II6 A;  1RE4 C;  1Y8A A;  1BE3 G;  2HPC B;  3I55 P;  2QJK C;  2KS1 B;  1YTZ I;  2NPS A;  2ZXX A;  5B5E E;  1QL1 A;  3KQG A;  1EDI A;  3IFM A;  5KLV G;  2ZAE B;  5AVS B;  2OTL P;  2FFD C;  5AVQ B;  2YXQ B;  4WBA A;  5AW7 B;  1DEB A;  1EZV G;  1KQG B;  3OJA B;  3KDP B;  3L74 G;  2HLO A;  2JR8 A;  2BCC J;  3N7N A;  2Q9I A;  1N73 A;  2IDB A;  1GL2 A;  3PHL A;  2N1T A;  3HD7 A;  3L70 G;  2HG5 D;  2KSE A;  1LTB C;  3V4Q A;  2ZYA A;  3FXD A;  2G8Y A;  2IBZ I;  1K9M Q;  4U3F G;  1FZC A;  3D70 A;  1RE3 A;  1HTL C;  3Q5P A;  3S4R A;  4IL6 H;  1LT9 B;  3CX5 E;  2WPS A;  3I56 P;  2J59 M;  1NTK J;  1FJK A;  3BAT A;  1Y47 A;  3L71 G;  1LTS C;  1P84 I;  1ZN5 A;  3GHG A;  1S9K E;  3HRN A;  3B5N D;  2B87 B;  1SQV G;  5APX A;  4JQ0 D;  5AW8 B;  4W7Y A;  1URQ D;  1N7S C;  5GTH H;  1RE4 B;  2WZ7 A;  1M1J A;  4Z1M H;  3SFE C;  3NXS A;  2KP8 A;  4QMA A;  2JWA A;  5APV A;  2J61 A;  1L0L K;  3BCC D;  2Y0E A;  5TJH A;  3LW5 J;  1JMM A;  3CCS P;  4U3F E;  1BDD A;  1N8R Q;  1NTM K;  2E76 B;  5TIS E;  5AW5 B;  1N7S D;  3D6Y A;  1N73 B;  3EFG A;  4YTP C;  1RE3 C;  1YIJ P;  3CX5 I;  1K8A Q;  2IFN A;  2YXR B;  1NJI Q;  5AW9 B;  2J3O A;  2O1J A;  1VQ8 P;  2E75 B;  1LTJ C;  5APU A;  3G3Z A;  3RGU A;  2O01 J;  1AA0 A;  4WY4 B;  2J64 A;  1FU1 A;  4R9J A;  1URQ A;  3AED C;  3L73 D;  5APY A;  1GK4 A;  1KQF B;  1IFI A;  2KYV A;  2QJY C;  2QEX P;  1NHL A;  2KS1 A;  2R5D A;  1OW8 A;  5KLV E;  1FS0 E;  2M5A B;  2WPV B;  4CPG A;  2W6A A;  3Q5S A;  3S1K A;  1L0L E;  2YKO A;  1FZE A;  4KJM A;  1EC5 A;  3PJS K;  2LKM A;  2N1T D;  3VTP C;  3C8V A;  3BVH B;  2JHK F;  2XV5 A;  3Q2Y A;  3CX5 H;  2K37 A;  1IJD B;  2KZI A;  5KAF H;  4OWF A;  2KIK A;  5H2F E;  2POH A;  3JCU H;  1M56 D;  3CMA P;  1JOC A;  2HLO B;  1G1I A;  1SQP J;  2YIU C;  1SQX K;  1NU1 J;  3WUU A;  3Q3D A;  4M3L A;  4ZKU A;  2FFD B;  1RF1 A;  1HGZ A;  1OVR A;  1T2K D;  1ZW0 A;  2P7J A;  2KOG A;  3L71 J;  3E1I B;  1Z3U A;  4BRY A;  1KIL D;  1M1K Q;  4N78 D;  2NZ2 A;  2KSJ A;  2J3F A;  5CBN A;  2XKM A;  1N7S A;  2FYU K;  4ASW A;  2FYZ A;  3E1R A;  3O8Z A;  3CME P;  1KTM A;  4TT3 H;  1HWT C;  3CCV P;  3WU2 H;  4GOF A;  2J61 B;  1NGM B;  2K9J B;  3A5T A;  1PGP A;  2RMZ A;  3U1A A;  1NTZ J;  1GZL A;  3HUS A;  1BGY G;  1PP9 E;  2NRG A;  1NU1 K;  3MHV A;  2NPS B;  1LP1 B;  2FYU J;  2ZYD A;  5AVY B;  1X9V A;  4H44 B;  3H6P A;  1LT9 C;  2YO2 A;  3CCM P;  5AW0 B;  3L70 D;  3W68 A;  3VYI A;  4WB4 A;  2Y9Y A;  1FZB A;  3H1I G;  5KTB A;  2KXP B;  1SQB G;  1ZR2 A;  4JYO X;  5KAF E;  3HTK B;  5KKZ B;  3B71 A;  1T6A A;  1Q7Y Q;  1RY3 A;  3JCU E;  4YXW H;  2KNC A;  2J0H A;  5AVX B;  3FX0 A;  3NTN A;  3IF4 A;  3L75 J;  4DOJ A;  3QWO C;  3AE2 C;  1R5L A;  5KJ7 C;  2WT7 B;  2OTJ P;  1PGQ A;  3L75 E;  4IFD K;  5B66 E;  2I1K A;  3RK2 D;  1EXI A;  1JY2 O;  2W6J H;  3H1H J;  1PP9 J;  4C46 A;  1FC2 C;  1QEX A;  1NAY A;  5BVZ A;  2E42 A;  1TU3 F;  1FZB B;  1JY3 N;  1NH4 A;  5CJ0 A;  1VQ6 P;  2LR2 A;  3GMA A;  1KQS O;  4I7Z C;  1DH3 A;  5E79 E;  3P8C E;  2GA1 A;  1VL2 A;  4C7N B;  2KLU A;  2FYU E;  4K35 A;  3CWB J;  3O6Q B;  1X8Y A;  2FXO A;  1LGH B;  2E74 D;  3CXH H;  2FXP A;  3T97 B;  5KLI B;  2Z4E C;  2J3G A;  3VMY A;  2XU6 A;  2FIB A;  2J3U A;  3L73 J;  1FID A;  2Q1K A;  1RF1 B;  1EZV E;  2HLO C;  3M9Q A;  1IK7 A;  1NTK D;  3HUS C;  1E5W A;  2XNX C;  4NYT A;  1ZME C;  2IPP A;  3JSV C;  3H1J J;  2WSF H;  3AE7 C;  1X0T A;  1AVO A;  3H1L D;  1UIX A;  2Z5I A;  3LIE A;  3M06 A;  2OYH A;  1UII A;  4GOD A;  4H0L B;  4HJG H;  2A45 H;  3HE5 A;  1FBM A;  4IL6 X;  1FZF B;  5AW2 B;  3BCC J;  1BGY E;  3AE4 C;  3AE5 C;  5AVR B;  3CCJ P;  3ABV C;  1YJ9 P;  2B88 A;  5AVT B;  2R3S A;  4AQR D;  3E1I C;  1X22 A;  1NO4 A;  4U3F D;  1L2P A;  3TSI A;  1KYO H;  2OYI C;  1RQV A;  5B66 H;  1FDM A;  2CPB A;  4D6T G;  2Q6Q A;  1JY2 P;  3BVH A;  2N9B A;  4YPC A;  1FZG A;  1IO4 A;  4DZO A;  4W80 A;  1FOS F;  1IK9 A;  2W83 C;  1RE3 B;  1IFN A;  1T2K C;  1PGO A;  1FZC B;  2ZXE B;  2E43 A;  1NTM E;  4LLH A;  2D2C D;  1T3J A;  4RES B;  3CXH E;  3UIA A;  3L36 A;  3NMD A;  1YQ3 C;  5CCH D;  2HR3 A;  3M0D A;  2E74 B;  5GTI H;  3BAS A;  2GM4 A;  5E79 H;  1EDJ A;  1RF0 B;  1OVU A;  1VQL P;  5AW6 B;  2JKV A;  1W2E A;  1JB0 J;  1KOR A;  1WRG A;  1N86 A;  3V2R A;  2J60 A;  4OGQ C;  1BE3 D;  4PJ0 H;  3RBZ A;  1SQP K;  2A45 G;  1EDK A;  2RN0 A;  1BCC E;  2HOD A;  5KAI H;  2V7Q J;  1JO5 A;  1KFM A;  1KMI Z;  5AVV B;  2A06 G;  3Q1M A;  2P67 A;  3AEF C;  3VOP A;  2H89 C;  3GF3 A;  3AE9 C;  1YTZ T;  4DCK A;  1SQX G;  1JC9 A;  3CWB G;  4N6J A;  3IAO A;  3CC2 P;  3EQ2 A;  3GLM A;  1FZG C;  2KNC B;  1SQX D;  1NVO A;  3B5N B;  3H1L G;  1DIP A;  1SLQ A;  1FDO A;  4NPF X;  2OGU A;  4NPD A;  3VMA A;  3G71 P;  3L70 J;  2WSC J;  1NYH A;  1SQQ K;  5APS A;  1VQ7 P;  1JUN A;  3M0A A;  2QVA A;  2CPS A;  2FYU D;  1ZV8 A;  2IFM A;  2YIU B;  3KZI E;  2QJP B;  4W7Z A;  2HOD B;  2Q3E A;  3V2N A;  5APQ A;  1NU1 E;  2BCC E;  1JCD A;  2WVR A;  1VQK P;  4L75 A;  2JP3 A;  2XDJ A;  2YKQ A;  3H1K D;  4U3F J;  4UB6 E;  3AE6 C;  1PL5 A;  4BWN A;  1YHQ P;  2B9B A;  2I1J A;  5KLI C;  3T97 A;  1ZRT D;  1BDC A;  1LWU C;  2C9L Y;  4JBZ A;  3HE5 B;  1VQ9 P;  2E75 C;  2WMM A;  1XTC C;  1WMK A;  4LC1 A;  1U57 A;  1A02 F;  2PRR A;  1S72 P;  3P8C D;  4PJ0 E;  5CMZ A;  1L0N D;  3RK2 B;  2WQY C;  2AXC A;  5M1B A;  1FZF C;  2B87 A;  4WVZ A;  2MKV A;  1LTJ B;  1L0N G;  1GD2 E;  1K04 A;  2BAS A;  1RE4 A;  4WWI A;  3AEE C;  2J0Y A;  5KAI E;  3USS A;  3E7K A;  1KV4 A;  3TF5 A;  1OW6 A;  3LID A;  4ZNC A;  2OTK E;  1S5L H;  2QG4 A;  2D39 A;  5H2F H;  5CBO A;  1CI6 A;  3H1K G;  5APW A;  1LTG C;  2A06 E;  1URQ C;  1BCC D;  3QH9 A;  1RF1 C;  1MUU A;  1LTA C;  3VP9 A;  1USE A;  3TGU J;  1L0N J;  4EDF A;  1GU4 A;  1XTG B;  1FZA C;  3D6Z A;  2IBZ G;  3MIW A;  4L74 A;  5BU8 B;  1KYO I;  1KN7 A;  3BVH C;  3SWF A;  1VF5 D;  3CCR P;  4JF7 A;  1QVG O;  2AXT H;  2CK3 H;  2V7Q H;  1A02 J;  3MGN A;  2WT7 A;  1VQ4 P;  4N78 E;  1Y9B A;  5K5G B;  3H1K J;  3H1L E;  4IOI H;  3V2Q A;  5AVZ B;  1S9K D;  3RL0 C;  1FE6 A;  3M0D C;  2IYO A;  1W5C E;  2KUB A;  3ZDM A;  1MFZ A;  1IZN B;  2L91 A;  3TNU A;  3TGU G;  2H8P D;  1M7L A;  2W90 A;  3H1J E;  2YNY A;  1FIC A;  4PV1 B;  3CPW O;  3EFF K;  4K3A A;  1MZ9 A;  5L8R J;  3TDK A;  3U59 A;  2ZT9 C;  1FJP A;  3FGA D;  5APT A;  1LWU A;  1NOH A;  3GG2 A;  2FXM A;  1G1J A;  3RK2 C;  1OX3 A;  1SP4 A;  2IBZ E;  2QJY B;  1SQB E;  1M1J C;  4BRY B;  1VF5 B;  2JDI H;  3K5B A;  2C9N Y;  2FY8 A;  5CCH C;  4EI2 A;  3AEC C;  3CD6 P;  3BRV B;  3PTZ A;  4PD4 H;  2HFE D;  3A0H E;  3S9O A;  1LTJ A;  2XZR A;  4JYC A;  1GL2 C;  5CCG C;  1KC8 Q;  1ZP0 C;  2BCC D;  1NTK E;  3HD7 C;  4R4M A;  5KLV J;  1QL2 A;  1ZRT E;  3H1I D;  4D6T D;  4PD4 D;  2E76 C;  2J1G A;  1KIL B;  2D2C C;  5GTH E;  2WTY A;  2JHH C;  3L72 J;  2ZT9 B;  3AEB C;  1GL2 D;  3C9I A;  3PH0 A;  1H89 A;  2OAR A;  1FAV A;  4PV1 C;  3L73 G;  2PFX A;  2JO1 A;  2R32 A;  2J2P A;  3TGU E;  3H1I J;  2H7H A;  3N4X A;  1BCC J;  5AW4 B;  1CSB A;  2AXT E;  2IX7 C;  1SFC A;  1NU1 D;  2J5Z A;  2LXB A;  1N2D C;  3BRT B;  2QM8 A;  1JTH B;  1GW3 A;  3HUS B;  1PP9 D;  4H0L D;  2Q5U A;  1LP1 A;  3D71 A;  3GHG B;  3RK3 B;  4AUW A;  2P2U A;  1RH5 B;  3GHG C;  1J1E C;  1RQU A;  2QJK B;  1M57 D;  1IFJ A;  4EIJ A;  3P8M C;  1KFN A;  2M0B A;  4UB8 E;  4R9T A;  1DX7 A;  2OYH C;  3RK3 C;  1BSH A;  2OYH B;  3M91 A;  3AE3 C;  1HUC A;  2H43 B;  4PD4 E;  1NTZ E;  1VPC A;  5AW3 B;  1HBW A;  3CXH I;  4H0L C;  1PP9 G;  1AJY A;  3G9R A;  2HOD C;  1N7S B;  1Q86 Q;  3B4S A;  3L71 D;  1S2E A;  1AQT A;  5KKZ C;  2AEJ A;  4L73 A;  2FYN B;  4HB1 A;  1KB9 I;  2N1T B;  2Y0D A;  1CW5 A;  1SQP D;  3H32 B;  1T3U A;  2H43 A;  1OVV A;  3CC4 P;  3TYY A;  2XND H;  5CCG A;  2O3J A;  2RKL A;  4PV1 D;  2ITA A;  3KYQ A;  2P10 A;  1P84 D;  3CCQ P;  1USD A;  3MD0 A;  1GMJ A;  1NTZ K;  1NKN A;  4H13 C;  2ZT9 D;  1HH0 A;  1JM0 A;  2K88 A;  3MUD A;  3OW2 O;  2J5U A;  3SWY A;  4C7N A;  2JJL A;  1P84 H;  2E76 D;  1YQ4 C;  1HVV A;  1FZC C;  2M8R A;  3R2P A;  2H88 C;  1GTW A;  1NKZ B;  4RO0 A;  3CLQ A;  4GDO A;  1BSN A;  5EFW B;  4PD4 I;  5GTI E;  4Y99 B;  1HGV A;  1MKM A;  1FZA A;  4YXD C;  2JWD A;  5CCG D;  2ZVO B;  5KLV D;  2RH0 A;  3L73 E;  1QX8 A;  3BCC G;  3P7K A;  3RK3 D;  1L4A C;  2FBW C;  2P1J A;  2Q3I A;  3R4Y A;  2NPS D;  3MP7 B;  3RK3 E;  4DJG A;  1AQ5 A;  4H44 D;  4BXL A;  1JCC A;  3FWN A;  2E5Y A;  3L4F A;  2J3F D;  1L0L D;  3CL3 D;  3F89 A;  4UB8 H;  2JHI F;  3RL0 B;  1FZA B;  1YBK A;  1SQV D;  4A7P A;  1BGY D;  1GU5 A;  1SQP G;  1H0T A;  4OH8 B;  1EDL A;  2Q7C A; 
#chains in the Genus database with same CATH homology
 5CMZ A;  4ZKP A;  2YO3 A;  3O8Z A;  3RK2 B;  4LGD E;  1N73 C;  1HWT C;  1NAF A;  3I5C A;  1Z3S A;  1JY2 N;  4I1L A;  1FZF C;  4GT1 A;  2J61 B;  3NFQ A;  5KLV K;  2Z4E A;  3A5T A;  1GK6 A;  1LTJ B;  2C0W A;  5CHX A;  1GD2 E;  4WY4 C;  3U1A A;  1N86 C;  2WPR A;  1J1D C;  2BAS A;  1GZL A;  2GY7 A;  1RE4 A;  3HUS A;  1ZLL A;  3CI9 A;  4IFM A;  2J0Y A;  2C0X A;  1GDT A;  1G2C B;  2MJZ A;  1NU1 K;  2R3C A;  4N3Y B;  4IFF A;  1Z56 A;  2NPS B;  3LID A;  3A3Y B;  1HJB A;  2WWW A;  3M9B A;  5AVY B;  1X9V A;  2D39 A;  1J1E B;  2ZFC A;  4C7R A;  1CI6 A;  5APW A;  3H6P A;  1LT9 C;  2VRS A;  2YO2 A;  1FZB C;  3VMZ A;  4KHX A;  1LTG C;  1RF0 C;  2YKP A;  5CCH A;  2HYN A;  1URQ C;  3H32 A;  5AW0 B;  1RF1 C;  3VYI A;  1MUU A;  1LTA C;  4WB4 A;  3VP9 A;  1FZB A;  5KJ7 D;  3OAK A;  5KTB A;  3HE4 B;  1ZR2 A;  4JYO X;  4WY4 D;  3HTK B;  1GU4 A;  1XTG B;  1FZE B;  1FZA C;  4HH2 A;  3HTK A;  3KPE A;  3MIW A;  1RY3 A;  5BU8 B;  3BVH C;  3TNU B;  3SWF A;  2XNX B;  3E1I A;  2J0H A;  5AVX B;  4JF7 A;  1SVF A;  3IR9 A;  2FFD A;  3NTN A;  2OYI A;  1A02 J;  2JHM F;  3MGN A;  2GUS A;  2WT7 A;  3VMX A;  2O01 H;  3V2P A;  4DOJ A;  1LTI C;  4N78 E;  1JY3 O;  5KJ7 C;  4I6M C;  2WT7 B;  1SFC D;  5AVZ B;  3V2Q A;  3MTU E;  4WY4 A;  2J58 A;  1S9K D;  2L5G B;  3RL0 C;  2OYI B;  2JHL F;  4IFD K;  2KB7 P;  5BU5 A;  2GUV A;  3M0D C;  1CZQ A;  1SQB K;  3V4W A;  4O9B A;  3WMM 0;  2I1K A;  3RK2 D;  1JY2 O;  1MFZ A;  1KIL C;  2W6B A;  2J0G A;  1OXZ A;  3TNU A;  4C46 A;  2HPC C;  2H8P D;  3L35 A;  3M9H A;  1M7L A;  3B8E B;  2YNY A;  1FIC A;  1NTK K;  2WIT A;  3HE4 A;  2WNP F;  2Z4E B;  1MZ9 A;  5BVZ A;  2E42 A;  1FZB B;  1KQL A;  1JY3 N;  2WSC H;  3U59 A;  1FJP A;  1MV8 A;  1NH4 A;  1J1D B;  5CJ0 A;  1JTH A;  5APT A;  3VN0 A;  1LWU A;  1NOH A;  2PAJ A;  1RF0 A;  3HD7 D;  3II6 A;  4GKG A;  1RE4 C;  4ZFG A;  2FXM A;  3P32 A;  1ZR4 A;  2HPC B;  3B5N A;  1DH3 A;  1G1J A;  3RK2 C;  1CI6 B;  1IFM A;  3P8C E;  1SP4 A;  4C7N B;  1YTZ I;  2NPS A;  3LW5 H;  2M3B A;  1QL1 A;  1X8Y A;  1LGH B;  3KQG A;  4M7H A;  2W27 A;  3IFM A;  1NWQ A;  1M1J C;  2Z5H A;  2Z4E C;  2J3G A;  3VMY A;  5AVS B;  2C9N Y;  1FZF A;  2XU6 A;  2FIB A;  5CCH C;  2J3U A;  1EQ7 A;  1RF1 B;  1FID A;  2HLO C;  3A7O A;  3M9Q A;  2FFD C;  5AVQ B;  3BRV B;  4WBA A;  1T8Z A;  2HFE D;  2O1K A;  5AW7 B;  1DEB A;  1LTJ A;  2XZR A;  4JYC A;  3HUS C;  1GL2 C;  3OJA B;  5CCG C;  3KDP B;  1E5W A;  2XNX C;  4NYT A;  2HLO A;  1J2J B;  4B86 A;  3HD7 C;  3N7N A;  3RL0 D;  2Q9I A;  1N73 A;  2Q9I B;  1GL2 A;  1QL2 A;  2IPP A;  2XNX A;  2J1G A;  1KIL B;  2N1T A;  3HD7 A;  2WSF H;  1H8A A;  3V5B A;  2WTY A;  2Z5I A;  3LIE A;  3M06 A;  2OYH A;  2JHH C;  2HG5 D;  4Y99 C;  1LTB C;  2A45 H;  3HE5 A;  3V4Q A;  4JYB A;  1FBM A;  1GL2 D;  3C9I A;  5AW2 B;  1FZF B;  2H43 C;  5KJ7 A;  2OAR A;  1FAV A;  5AVR B;  1H89 A;  1FZC A;  1WT6 A;  1RE3 A;  1L4A A;  1HTL C;  1L4A D;  2R32 A;  2J2P A;  3B5N C;  5AVT B;  1LT9 B;  3N4X A;  2H7H A;  5AW4 B;  4AQR D;  3E1I C;  1CSB A;  1NO4 A;  3L37 A;  2IX7 C;  1SFC A;  2WPS A;  2J5Z A;  2J59 M;  1N2D C;  3TSI A;  3BRT B;  2NPS C;  2QM8 A;  1JTH B;  1FJK A;  4JZC A;  1GW3 A;  1URQ B;  3BAT A;  3VP8 A;  2OYI C;  1LTS C;  1OWA A;  1FDM A;  3HUS B;  1ZN5 A;  3GHG A;  2CPB A;  2Q5U A;  4GIF A;  1S9K E;  3HRN A;  3B5N D;  1JY2 P;  3GHG B;  3BVH A;  3RK3 B;  4AUW A;  1IC2 A;  2N9B A;  2P2U A;  1FZG A;  2R5B A;  1IO4 A;  5APX A;  3GHG C;  4EOT A;  1J1E C;  4DZO A;  4W80 A;  1FOS F;  1IK9 A;  5AW8 B;  4W7Y A;  1URQ D;  1N7S C;  1IFJ A;  4EIJ A;  3P8M C;  1RE3 B;  1RE4 B;  1IFN A;  1T2K C;  2WZ7 A;  1FZC B;  1KFN A;  1M1J A;  1N7L A;  2N1T C;  3NXS A;  2ZXE B;  2E43 A;  4LLH A;  1LTT C;  4RES B;  1T3J A;  2KP8 A;  3UIA A;  4R9T A;  3L36 A;  3NMD A;  5APV A;  1DX7 A;  5CCH D;  2J61 A;  3U1C A;  1L0L K;  2OYH C;  3RK3 C;  3M0D A;  1JNM A;  1JMM A;  3BAS A;  2GM4 A;  1L4A B;  2OYH B;  5AVU B;  1RF0 B;  1LWU B;  3M91 A;  1HUC A;  2H43 B;  1KIL A;  5AW6 B;  1VPC A;  1NTM K;  5AW3 B;  1HBW A;  4EPU A;  1L0N K;  1W2E A;  1GL2 B;  5AW5 B;  3FIB A;  1N7S D;  2Q9I C;  1N73 B;  1WRG A;  1N86 A;  3EFG A;  1N7S B;  5AW1 B;  3V2R A;  2HOD C;  2J60 A;  1RE3 C;  1SQP K;  1FZG B;  2A45 G;  2N1T B;  1IFD A;  2IFN A;  1SFC C;  2HOD A;  1N86 B;  4I2L C;  5AW9 B;  3TK1 A;  1CW5 A;  2O1J A;  2J3O A;  1JO5 A;  1KFM A;  5AVV B;  3H32 B;  1LTJ C;  5APU A;  3G3Z A;  1T3U A;  4WY4 B;  1FU1 A;  2J64 A;  2P67 A;  3VOP A;  4R9J A;  2H43 A;  3TYY A;  1URQ A;  5CCG A;  1VDF A;  3KYQ A;  1YTZ T;  2A45 I;  5APY A;  1GK4 A;  1JC9 A;  4N6J A;  1IFI A;  2KYV A;  3MD0 A;  3EQ2 A;  1NHL A;  1NTZ K;  1NKN A;  2R5D A;  1FZG C;  1KZU B;  3B5N B;  1M1J B;  1AFO A;  5AVW B;  2W6A A;  1HH0 A;  1SLQ A;  2YKO A;  1FZE A;  3MUD A;  3SWY A;  4C7N A;  2JJL A;  2LKM A;  2N1T D;  3OA7 A;  3VTP C;  3BVH B;  1HVV A;  1FZC C;  2HPC A;  2JHK F;  2WSE H;  1SQQ K;  2QM7 A;  2XV5 A;  5APS A;  2M8R A;  4XE5 B;  3R2P A;  1FZE C;  1JUN A;  3M0A A;  1IJD B;  2CPS A;  3HD7 B;  1GTW A;  1ZV8 A;  1YYC A;  1NKZ B;  2IFM A;  4AYC A;  3CLQ A;  4HYT B;  4XA4 A;  1JY3 P;  2POH A;  4W7Z A;  4Y99 B;  1HGV A;  2HOD B;  1FZA A;  4M7F A;  1SFC B;  2YMY A;  1JOC A;  5APQ A;  3V2N A;  2HLO B;  1PFI A;  1G1I A;  2FKW B;  1JCD A;  5CCG D;  1FZD A;  1SQX K;  1G2C A;  1H88 A;  1X79 B;  1LT9 A;  2PP6 A;  3H32 C;  2WPQ A;  3P7K A;  4M3L A;  3RK3 D;  2JEE A;  2XDJ A;  1L4A C;  2YKQ A;  4ZKU A;  2FFD B;  2P1J A;  1RF1 A;  1HGZ A;  2Q3I A;  2NPS D;  1T2K D;  2P7J A;  2KOG A;  1GW4 A;  1FIB A;  3E1I B;  5CJ4 A;  1Z3U A;  1KIL D;  1AQ5 A;  4N78 D;  2I1J A;  3T97 A;  1JCC A;  1LWU C;  3L4F A;  2C9L Y;  2KSJ A;  3HE5 B;  3CL3 D;  2J3F A;  1SQV K;  2J3F D;  1XTC C;  2XKM A;  2KLV A;  4LC1 A;  2JHI F;  3RL0 B;  1FZA B;  3A2A A;  1A02 F;  1FOS E;  1N7S A;  1GU5 A;  2FYU K;  3P8C D;  3PP5 A;  4OH8 B;  2Q7C A;  2FYZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...