1RF1B

Crystal structure of fragment d of gammae132a fibrinogen with the peptide ligand gly-his-arg-pro-amide
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
299
structure length
299
Chain Sequence
IPTNLRVLRSILENLRSKIQKLESDVSAQMEYCRTPCTVSCNIPVVSGKECEEIIRKGGETSEMYLIQPDSSVKPYRVYCDMNTENGGWTVIQNRQDGSVDFGRKWDPYKQGFGNVATNTDGKNYCGLPGEYWLGNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGGFTVQNEANKYQISVNKYRGTAGNALMDGASQLMGENRTMTIHNGMFFSTYDRDNDGWLTSDPRKQCSKEDGGGWWYNRCHAANPNGRYYWGGQYTWDMAKHGTDDGVVWMNWKGSWYSMRKMSMKIRPFFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Calcium-Binding Site beta2, Adjacent to the "b" Polymerization Site, Modulates Lateral Aggregation of Protofibrils during Fibrin Polymerization.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
molecule keywords Fibrinogen alpha/alpha-E chain
total genus 97
structure length 299
sequence length 299
chains with identical sequence E
ec nomenclature
pdb deposition date 2003-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1rf1B01
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 1rf1B02
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 1rf1B03
1RE3C 1N73C 2JHHC 1RE3B 2J3FA 1JY2N 1M1JB 1FZGC 1M1JC 1JY3O 1Z3UA 2OYIB 2J61B 3GHGB 2HPCB 3GHGC 2HPCC 1RE3A 2A45I 3GHGA 2HPCA 1Z3SA 2JHMF 1LTJB 2WNPF 1LT9B 4R9JA 2H43A 1FZEC 1RF1B 1LT9C 1FIBA 1LWUC 2HLOA 1RF1A 2J64A 2H43B 2A45G 4R9TA 3E1IB 3E1IA 2XNXB 2XNXC 1LWUA 2HLOC 3HUSA 4NYTA 2J5ZA 3FIBA 3H32A 3H32C 1N86A 2OYHA 2FFDC 4M7FA 4ZFGA 1FZFC 2J60A 2GY7A 3HUSC 4JYOX 1JY3P 1RE4C 1RF0B 2J1GA 1RE4B 2FFDB 1FZGA 1M1JA 1JY2O 2HODA 3BVHA 2J3OA 4M7HA 1FZDA 2Q9IC 4JZCA 1FZAA 2J0YA 1FZAB 1LTJC 2Z4EA 1JY3N 2A45H 1N73A 2J0HA 2H43C 1FZBC 2Z4EB 2Q9IB 1FZBA 1FZGB 2JHLF 2Q9IA 2J3FD 1FZCB 1FZCC 1FZEB 2Z4EC 1FZCA 1LWUB 2JHKF 2JHIF 2HLOB 1JC9A 1LT9A 1W2EA 4EPUA 1RF1C 1FIDA 2OYIC 2D39A 2OYIA 1FZFB 2OYHC 1N86C 1FZFA 2J0GA 3HUSB 1FZEA 2XNXA 2FIBA 2J2PA 3H32B 2OYHB 1N86B 2HODC 3BVHC 3E1IC 3BVHB 2J3GA 1JY2P 1RE4A 1FZBB 2HODB 1RF0A 1N73B 1RF0C 2J61A 2FFDA 1FZAC 2J3UA 1LTJA 1FICA 1T3UA
chains in the Genus database with same CATH superfamily
2N1TC 5CCGD 4NPFX 3CWBJ 4RJTA 3NXSA 5KLVJ 3BCCJ 1MFTA 1SQXE 1LTJB 1E5WA 2HLOA 1EDJA 1URQA 2FYNB 3T97A 3SWFA 1NOHA 2LXBA 1LP1B 1NO4A 1GU5A 2XDJA 1H0TB 1JCCA 3HD7A 3H32A 1KQSO 1N86A 5APVA 2GY7A 3H1JE 4KJMA 2K9JA 3L71G 4YPCA 3D6YA 3M9BA 3L35A 1FZGA 3L71D 2J58A 5AW6B 1ZN5A 4HH2A 4BRYB 2LXCB 3GLMA 4EIJA 1NH4A 2C0XA 2V4HA 5BU8B 2WWWA 2H88C 3MD0A 3H1IE 3H1KG 2PFXA 1KZUB 1PP9J 3NTNA 5CMZA 2OYIC 1PPJE 1QVFO 2NPSD 2AEMA 1R8EA 1IZNB 1L0LD 1PP9D 2E43A 2GUVA 1EZVD 3TF5A 5CBOA 3VMYA 1JY2P 2BEZF 1HWTC 3V4QA 1VQOP 1OFCX 1GL2C 3G9RA 3CCSP 2WT7B 1OW6A 1VQ8P 2A06E 5KLIB 1FICA 1NU1J 1EDKA 1N73C 1SQQG 4N78D 3Q5RA 5AW7B 4XE5B 1SQVJ 1JM0A 2J61B 2WZ7A 1BCCJ 2A45G 1HBWA 3L70G 3FXDA 3L70D 1GMJA 3BCCG 3TDKA 4JPZB 1W2BO 3H1LJ 4ZFGA 3PJSK 2IZ0A 3HUSC 3H1LD 5KLVD 3B5ND 3L75D 2Q9IC 5KLVG 1HJ0A 4OVNF 1GTWA 3M9QA 4IOIH 2Q9IA 3V2PA 1L0ND 2Q6QA 4PD4D 3H1HG 1JOCA 2E76D 1NGMB 4EPUA 4UB8E 4C46A 1L4AB 2P58A 3HTKB 3H1ID 2E74C 3H32B 3FWLA 3E1IC 1LTTC 1SQBJ 1Q86Q 2OARA 5CCHA 1IFJA 4CPGA 3UIAA 4WY4D 1LTJA 1T3UA 1JTHA 2JHHC 5M1BA 1FZGC 4LGDE 3V2RA 2KLVA 3VOPA 4D6TD 3GHGB 2HPCB 2W8ZA 2Y0DA 2P10A 1K9MQ 1PFIA 1LWUC 2J64A 1RF1A 2QJKB 2GA1A 4U3FJ 1LTGC 1HVVA 2RN0A 1VQ5P 1BGYG 2B87A 2QM8A 1A02F 2M3EA 1L0LG 4R4LA 4OGQD 2N9BA 1SS1A 3L72J 3CCMP 5AVWB 1VQ7P 3IR9A 2KK7A 3RL0C 1ZRTE 1IK9A 3CWBD 2WQYC 3HD7D 3L70J 1FS0E 1Q81Q 2VRSA 5AVTB 2L5GB 1W2EA 2Q3IA 2R5BA 5E79H 2IBZE 1SQVG 2J59M 4PD4I 2IPPA 1OVVA 2OYHB 3H1HE 1NTMK 2K9JB 2QG4A 1SQPD 4PD4H 3PH0A 1GZLA 2UWJE 2KNCA 4K35A 1Y9BA 1ZLLA 2RKLA 2J3FA 4DJGA 1AA0A 1R5SA 2E75B 1KFMA 1EZVG 2E75C 2KXPB 4C7RA 1NU1K 4ZNCA 1EZVE 1SQBE 1SQQK 3CXHH 1YBKA 5KKZB 5AW3B 1IFDA 2WPVB 3E1IA 2KLUA 1Q90D 2IYPA 3HE4B 2WSSH 2JKVA 4JBZA 1L4AA 3A5TA 1SQVD 2O1JA 2J60A 1OWAA 2ZT9C 2M0BA 2ZT9B 3MUDA 3B5NB 2HODA 3BVHA 3VMAA 1NU1G 2ZYGA 4EI2A 1L0NK 3VYIA 5APSA 1YI2P 5AVZB 1BDDA 4H13B 4UB6H 2KUBA 1LGHB 1CW5A 2RH0A 3V6IA 4YXWH 2Y9ZA 4Y99B 4Y99C 1N7SA 3JCUH 1EZVI 1ZW0A 3U1CA 4HJGH 3EWKA 1SQXD 1X79B 2K37A 2O1KA 2J5UA 1HUCA 3II6A 5APXA 3M06A 1RE4A 2ZXXA 3C9IA 2IBZG 2ZAEB 4WY4B 1RE3C 3GF3A 1RE3B 5GTHH 1YTZT 1VF5C 3L72E 4Z1MH 1KQLA 1RE3A 3F89A 3D70A 4U7JA 1PPJG 2V7QJ 4HYTB 1VQMP 4R9TA 2OQQA 4GDOA 2YXRB 4L73A 2MKVA 3OJAB 3EFFK 3PHLA 2FYUG 1KV4A 4EYYQ 4WVZA 2KSEA 1RE4C 3VTPC 1RE4B 2FFDB 2XKMA 1X22A 1FZDA 3B71A 2D2CC 3L73D 3TNUB 1H8AA 2I8DA 2OTKE 2XZRA 1BDCA 2HFED 2YXQB 1LWUB 2Q5UA 1BSNA 2B88A 3H1JJ 3ZDMA 2O3JA 1DIPA 4N3YB 2K88A 1FZFB 2IZ1A 1N86C 1FE6A 1IK7A 1UIIA 3WMM0 3FGAD 3BVHC 2OGUA 3BVHB 5AW4B 1PGOA 4WY4A 2GM4A 1SQXJ 1ZR4A 5KLVE 2WSFH 2FFDA 1SLQA 4AYCA 4OWFA 3RK3B 2FBWC 3RK3C 1OZHA 1KORA 5GTIH 1M7LA 3WU2E 4XFJA 1CSBA 1LJ2A 3HE5A 3S4RA 3R4YA 2AXTE 3K5BA 1T2KD 2H43B 3Q5PA 3H1KJ 3U59A 2ZVNB 3H1LE 1KILB 3AE7C 2B87B 3IFMA 4HB1A 1LTBC 2K1AA 1NTKE 1NTZJ 2O01J 3L71J 4GOEA 3KDPB 1M1JA 1USDA 1SQVE 4PV1C 1ZOYC 2R3SA 4PV1B 2WMMA 4RO0A 3M91A 2K3RA 1FZCB 2D2CD 3T97B 1FZCC 2HLOB 2POHA 1KILD 2R5DA 3CC7P 1BCCG 2OYIA 3KYQA 4DT0A 1HJBA 2FIBA 3AE8C 4NPDA 4BRYA 2WTYA 1YQ3C 3H1IJ 3A0HH 3G71P 2HODB 2YIUC 2J61A 2ITAA 1GL2A 1FZAC 3H25A 2J3UA 1SFCA 1ZV8A 2PP6A 1PZQA 1ZRTD 3WUTA 3TGUJ 3GHGC 2HPCC 5AVSB 4PD4E 1SFCC 1NTMD 2IDBA 3I55P 5KAFH 1S5LH 4JQ0D 1T3JA 4TT3H 3G6EP 3A0BE 3V2NA 4H44C 2WSCJ 3H1JG 5CCHC 1FU1A 2KS1B 3CX5H 2N9YB 1KB9I 2R44A 1Z56A 2XV5A 3B4SA 3BCCE 1KQGB 1EDLA 4YXDC 3KXDA 1GW3A 1ZXGA 1Q82Q 1HH0A 2J0HA 3IF4A 1FZBC 5CCGA 5CHXA 1OW7A 1FBMA 1GD2E 4I1LA 3TGUE 2Q7CA 3S9OA 3MIWA 3RL0g 1J1EC 3M9HA 2E74B 2KZIA 4PJ0E 2NPSB 3MP7B 1KYOD 4WB4A 4IL6E 1Y47A 1URQB 1OMIA 3ITKA 1DEBA 5TJHA 4W80A 1RF0A 3Q1MA 2OYOA 2QJPC 2P2UA 1JNMA 1S2EA 4BWNA 2CK3H 1M1JB 1SQBG 1M1JC 3AEAC 4KHXA 2QE7H 3EFGA 2C9LY 1JUNA 3L72D 3MZWB 3P8CD 5KLVK 5C39A 3OAKA 3W67A 3BATA 2WSEH 1LT9B 1SQQE 2WITA 2E74D 1K04A 1NAFA 5BVZA 1SFCD 3Q5SA 1BE3D 3U1AA 1URQD 1QVGO 2H7HA 2XU6A 3L71E 1GK4A 2WPRA 3L74E 3VN0A 3FXEA 4RKUJ 1MFZA 4AUWA 1RHZB 2FXOA 1S5LX 3H1KD 3B5NC 3TSIA 3RK2B 1IJDB 2AEJA 1JEKA 1VL2A 2CPBA 3H1KE 1AJYA 3RL0D 2A06D 1JMBA 1MKMA 2B9BA 2K9YA 3AE2C 1FZCA 3JC22 2ZVOB 5DJUB 2V7QH 4Y28J 3AE5C 4QMAA 3V4WA 2D39A 1S72P 1FZFA 4C7NA 2QVAA 2JP3A 1JMMA 2J2PA 3MUDC 4GT1A 3CX5E 1FDMA 1QLED 1BGYE 1H88A 2FYZA 1KTMA 3L74D 1Q7YQ 1PP9E 1KMIZ 3CCLP 3F5HA 1NJIQ 3L4FA 3CCQP 2N1TD 2OYIB 3A2AA 1JB0J 1L0LK 1T6AA 1BE3E 1XTCC 1EXIA 2AXTH 3I56P 3B8EB 4ASVA 3SFEC 1X8YA 2JR8A 2L91A 1YIJP 2NPSA 4NYTA 4JYBA 1DD4A 1QGKB 3AEDC 1NTZD 1Q2NA 3HD7C 1GL2B 2QA4P 1PL5A 1R5LA 1NTKK 1YJNP 3M0DA 3H1HJ 1KQFB 4IFFA 2FYUK 4H0LC 1VQLP 4H0LB 3AEEC 2J0YA 4W7ZA 1VQKP 2Z4EB 2Q9IB 3CCEP 2AEFA 1KILA 5AVVB 2KZJA 3TYYA 2N1TB 2W6AA 1EXJA 3KQGA 2ZYAA 3A0HE 5APTA 4H44B 1FC2C 3H6PA 3HUSB 2E5TA 2IBZI 4D6TG 3SFDC 1PGJA 2O01H 3BRTB 1QL2A 3GF7A 3QWOC 1RF0C 4GODA 2G3AA 1BCCE 3IAOA 1JY2N 1IFIA 4ZKUA 4W7YA 2BCCJ 5K5GB 2A45I 3C1LA 2WNPF 1VF5D 2HYNA 5KTBA 2LR2A 2Y0EA 2M3BA 1KYOH 3CCRP 3E1IB 1S5LE 3CLQA 3LW5H 3D71A 3PTZA 3RBZA 2H89C 1L0NG 1IC2A 2FFDC 3JSVC 1FZFC 5AVQB 1IFMA 3AE6C 2ZT9D 1SQVK 2N1TA 4XA4A 1FOSE 2W6JH 1AVOA 3L36A 1AVYA 2KYVA 3AECC 4U3FG 1NU1D 4U3FD 1E79H 1JC9A 5KKZC 1FDIA 5APUA 1FJPA 2A06G 1ZMEC 3CD6P 2E76C 1AQ5A 4H44D 3H1LG 2Q3EA 3L75G 3HE4A 2W27A 2HG5D 1PIXA 2Q1KA 4IL6H 2BASA 2IFMA 2E75D 3ABVC 5E79E 1S3JA 3SWYA 1N73B 1KYOI 2P7JA 1YJWP 3OA7A 3GG2A 1JTHB 3V5BA 5APYA 1HTLC 1JY3O 3PP5A 1X0TA 3H1IG 1YYCA 1NYHA 2M5AB 3VP9A 2C9NY 2YKPA 2IBZD 1NTKG 2YO3A 1Z3SA 3L74G 1IFPA 2OTJP 2JJLA 1U7MA 1NU1E 1RY3A 4HKZH 2QJYB 2HLOC 3L37A 4MN4C 2J5ZA 5H2FE 3TGUG 2Y0CA 3B5NA 1LTIC 2QSIA 4UB6E 4ZKPA 4WWIA 2KOGA 4JF7A 1T2KC 5L8RJ 3CCJP 3CX5D 1NTZG 1N73A 2YKOA 3FX0A 2YO2A 1G2CB 2IX7C 1FDOA 4DCKA 1N8RQ 1MV8A 1G2CA 3C8VA 4H13C 3LIEA 1NTMG 5KJ7D 4DZOA 1ZR2A 4TLFA 1FZEA 1NWQA 2C0WA 2IYOA 1CI6A 5GTHE 1FJKA 3A7OA 3R2PA 4A7PA 3H1JD 4EDFA 2IFNA 3G3ZA 3KPEA 1L4AD 3VP8A 5CCGC 4GOFA 2W83C 2YNYA 2M5AA 1PPJD 4I7ZB 2QIWA 1M8OB 1K73Q 3CCVP 4YTPC 1Z3UA 3HE5B 1NVOA 3L72G 1IFNA 5TISH 3WUUA 3GHGA 2HPCA 3RL0B 4R9JA 2H43A 1LT9C 1OW8A 2YKQA 3WUVA 1HF9A 5CJ4A 1KB9D 1DD3A 1DEEG 1JCDA 2FYNC 1QL1A 2H8PD 1N7SB 1DH3A 4I6MC 2QM7A 1VQNP 1WRGA 2OTLP 1AFOA 2NPSC 2JWAA 1BSHA 2KNCB 5CCHD 3GW6A 1OXZA 3P32A 3V2QA 2PAJA 2J3OA 3SSUA 1U7JA 1SQPE 3AE3C 3IN6A 4PV1D 4GKGA 1LTJC 2Z5HA 1GDTA 4N78E 5B5EH 1N7LA 3I5CA 1FZGB 1LNQA 2J3FD 1L0LJ 2ZJSE 1VQ4P 1OVRA 5AVYB 3E7KA 1RF1C 1FIDA 3MGNA 1KN7A 1KILC 4AQRD 1MZ9A 2O01N 2OYHC 1LP1A 4H13D 3P8MC 2KP8A 1PGQA 1GK6A 2PRRA 1USEA 1KB9E 5KAIH 5BU5A 4B86A 2SPZA 2YMYA 3FWNA 2Z5IA 5DJTB 3AE4C 1L2PA 3P7KA 2I1JA 2G8YA 5B66H 2WT7A 1N2DC 1FIBA 1FZEC 2KSJA 4N6JA 1KYOE 1J1DC 1RQVA 1J1DB 3CPWO 3CI9A 1P84H 3L75J 2E5YA 3L73J 3QH9A 1LWUA 1CI6B 3WU2H 5APWA 1N7SD 4M7FA 1M90Q 2WPSA 5KLIC 3PRJA 1G1IA 3MHVA 1OIPA 4K3AA 1D7MA 1FZAA 1NKZB 3TGUD 2Z4EA 3Q3DA 2A45H 1M1KQ 2H43C 1LTAC 3CXHI 1YHQP 3S1KA 4WBAA 1S9KE 5B5EE 2XNDH 4DOJA 5TISE 2JHKF 1GW4A 1SQBK 3RK2D 4L75A 1VF5B 1SQXK 1RQUA 2GUSA 1H0TA 4L74A 1WMKA 1G1JA 1P84D 3L73G 1L4AC 1K8AQ 3VMZA 1DX7A 3O8ZA 3USSA 4RESB 5AW2B 4WY4C 2WSFJ 2I1KA 3LIDA 2ZYDA 2M8RA 1NTME 2DW3A 1SQQD 1M57D 2P1JA 1SQXG 3BASA 1BGYJ 1L0NE 1A02J 2QEXP 1LT1A 1OVUA 1LTSC 3AEGC 2LKMA 2RMZA 1URQC 2FY8A 2OYHA 2BCCD 3CX5I 2P67A 1JY3P 2D2CB 4NPEA 4LLHA 4KT0J 4IL6X 5AW0B 1HGVA 2ZFCA 1FOSF 4L76A 3BCCD 2W90A 1WT6A 3TNUA 4D6TJ 1BGYD 3CL3D 2HR3A 3CXHD 4LC1A 3L74J 2R32A 1NHLA 3L70E 1S1CX 5CJ0A 2J0GA 3KZIE 3Q2YA 1SQBD 3RGUA 2KIKA 3N4XA 2W6BA 1VPCA 3RBXA 3HTKA 3LW5J 5KAFE 3L73E 5AW9B 1S4XA 1FZBB 1P84E 1P84I 3KHUA 3L75E 2FXPA 1KD1Q 1YTZI 2FKWB 1QX8A 1VQ6P 1NKNA 1VDFA 5AVUB 2FYUJ 1L0NJ 4U3FE 1MUUA 4M3LA 2JHMF 1RF1B 1PV3A 2QJKC 5AW5B 5KJ7C 3JCUE 3N7NA 2R3CA 3G4SP 3HUSA 2CPSA 3OW2O 3FIBA 3CC2P 3NFQA 2JDIH 4BXLA 1J2JB 1EDIA 2YMKA 2QJPB 2E42A 1XTGB 4JYOX 3M0AA 4ZMDA 1BE3J 1EQ7A 4I2LC 1W5CE 3GMAA 3AEBC 3P8CE 3HRNA 1VQ9P 4H0LD 1JY3N 1K05A 1SP4A 3W68A 1VQPP 2KI7B 1FAVA 3H1HD 1L0LE 1FZBA 1M56D 3RK2C 2NZ2A 1FZEB 2FYUE 1TU3F 2E76B 2WPQA 4IFDK 1KB9H 5KAIE 1LT9A 4UB8H 1S9KD 1H89A 1NTKD 2KS1A 1PP9G 1T8ZA 4JYCA 5CBNA 2JWDA 1NTZK 1RH5B 5EFWB 1HGZA 3HD7B 3CWBE 2JO1A 1YQ4C 1SQPK 2YIUB 2HODC 3O6QA 4IFMA 3M0DC 3CWBG 2QJYC 3SWKA 1GU4A 3CMAP 1CZQA 1ZP0C 3CMEP 4OGQC 1AQTA 4OGQB 4GIFA 1AV1A 3RK3D 3VMXA 1OX3A 4O9BA 5AW8B 3A0BH 1SFCB 4ASWA 1GL2D 4D6TE 1KC8Q 2FXMA 1QEXA 5B66E 1KFNA 1SQPG 4OH8B 2WSCH 3EQ2A 1IO4A 4R4MA 2XNXB 1SVFA 2XNXC 1JO5A 1J1EB 3E1RA 3AE9C 1N7SC 2MJZA 3H32C 5GTIE 4C7NB 3CCUP 5AVRB 2QRXA 1SQQJ 1RF0B 2J1GA 5AW1B 1PGPA 3A3YB 2B89A 1JY2O 4M7HA 3KZIH 4JZCA 3O6QB 1FZAB 2JEEA 5KJ7A 2AXCA 3TK1A 5AVXB 3AEFC 2PGDA 2WVRA 1BE3G 2JHLF 1BCCD 2BCCE 2BEQD 3AE1C 2Y9YA 4EOTA 2Z4EC 4I7ZC 2JHIF 5APQA 1YJ9P 1NTZE 1EC5A 3NMDA 1Y8AA 4PJ0H 1NTMJ 3D6ZA 1NTKJ 1SQPJ 1X9VA 1YITP 3PLNA 2FYUD 1KILE 3BRVB 2XNXA 2NRGA 1N86B 1U57A 1UIXA 3MTUE 5H2FH 2BCCG 2ZXEB 2J3GA 3CC4P 2KB7P 1NAYA 3CXHE 2WSEJ 3RK3E
chains in the Genus database with same CATH topology
2N1TC 1RE3C 5CCGD 1RE3B 3L4FA 1YTZT 3NXSA 2N1TD 2OYIB 3A2AA 3P7KA 2I1JA 2WT7A 1KQLA 1RE3A 1L0LK 1LTJB 1XTCC 1E5WA 1N2DC 1FIBA 1FZEC 2HLOA 2KSJA 4N6JA 3B8EB 1J1DC 1URQA 3T97A 1J1DB 3SWFA 1NOHA 3CI9A 4HYTB 4R9TA 1X8YA 1LWUA 1NO4A 2NPSA 3OJAB 1GU5A 2XDJA 1CI6B 4NYTA 1JCCA 5APWA 4JYBA 3HD7A 1N7SD 3HD7C 1GL2B 3H32A 4M7FA 1N86A 5APVA 2WPSA 1NTKK 2GY7A 3M0DA 1G1IA 1RE4C 3VTPC 1RE4B 3M9BA 3L35A 1FZGA 4IFFA 2FFDB 2XKMA 2J58A 2FYUK 5AW6B 1FZDA 1ZN5A 4HH2A 1FZAA 2J0YA 1NKZB 2Z4EA 3TNUB 2A45H 4W7ZA 1H8AA 4EIJA 2XZRA 2H43C 2Z4EB 1LTAC 2Q9IB 1NH4A 2C0XA 5BU8B 4WBAA 1S9KE 1KILA 2WWWA 5AVVB 2HFED 3MD0A 4DOJA 1LWUB 3TYYA 2N1TB 2JHKF 2Q5UA 1GW4A 2W6AA 1SQBK 1KZUB 3KQGA 3RK2D 3NTNA 4N3YB 5CMZA 2OYIC 5APTA 1SQXK 1FZFB 2GUSA 1N86C 2NPSD 3H6PA 3HUSB 1G1JA 1L4AC 3WMM0 2E43A 2GUVA 3BVHC 2O01H 3BVHB 3VMYA 5AW4B 3VMZA 3BRTB 1JY2P 3O8ZA 1DX7A 1QL2A 4WY4A 4RESB 5AW2B 2GM4A 1HWTC 3V4QA 4WY4C 1ZR4A 2I1KA 1RF0C 3LIDA 1GL2C 2WSFH 2FFDA 1SLQA 2WT7B 4AYCA 2M8RA 1FICA 3RK3B 3RK3C 1N73C 1JY2N 4N78D 1IFIA 5AW7B 4ZKUA 1M7LA 2P1JA 4W7YA 1CSBA 4XE5B 3HE5A 2J61B 3BASA 1A02J 2A45I 2WZ7A 1T2KD 2WNPF 2HYNA 5KTBA 2H43B 3U59A 1LTSC 2A45G 1HBWA 2M3BA 1KILB 3E1IB 2LKMA 3CLQA 3IFMA 3LW5H 1LTBC 1URQC 1IC2A 2OYHA 2FFDC 4ZFGA 1FZFC 2P67A 3HUSC 5AVQB 1IFMA 1JY3P 3KDPB 1M1JA 3B5ND 4LLHA 2Q9IC 1SQVK 2N1TA 5AW0B 1HGVA 4XA4A 1GTWA 1FOSE 2ZFCA 3M9QA 1FOSF 3L36A 3M91A 2KYVA 2Q9IA 1FZCB 3V2PA 1FZCC 1WT6A 3TNUA 1JOCA 2HLOB 3CL3D 2POHA 1JC9A 1KILD 4EPUA 4LC1A 5APUA 1FJPA 2R5DA 4C46A 2R32A 1AQ5A 2OYIA 1L4AB 3HTKB 1NHLA 5CJ0A 3KYQA 2J0GA 3HE4A 2W27A 2HG5D 1HJBA 2FIBA 3N4XA 3H32B 2W6BA 1VPCA 2BASA 3HTKA 2IFMA 3E1IC 1LTTC 2WTYA 5AW9B 1FZBB 2OARA 3SWYA 2HODB 1N73B 2P7JA 5CCHA 1IFJA 2J61A 3OA7A 3UIAA 1GL2A 1FZAC 2J3UA 1JTHB 3V5BA 4WY4D 1LTJA 1T3UA 1JTHA 1SFCA 1YTZI 1ZV8A 2FKWB 2PP6A 5APYA 2JHHC 1HTLC 1FZGC 4LGDE 1JY3O 3V2RA 1NKNA 3PP5A 1YYCA 2KLVA 3VOPA 3VP9A 2C9NY 1VDFA 5AVUB 2YKPA 3GHGB 2HPCB 3GHGC 2HPCC 5AVSB 1MUUA 1SFCC 2YO3A 4M3LA 1Z3SA 2JHMF 1RF1B 5AW5B 1PFIA 5KJ7C 1LWUC 2J64A 1RF1A 2JJLA 3N7NA 1LTGC 1T3JA 1HVVA 1RY3A 2R3CA 3V2NA 2HLOC 3HUSA 3L37A 2CPSA 2J5ZA 3FIBA 3NFQA 2QM8A 5CCHC 1J2JB 1FU1A 3B5NA 1A02F 1LTIC 2E42A 1XTGB 4JYOX 3M0AA 4ZKPA 1Z56A 2XV5A 2KOGA 2N9BA 4JF7A 1EQ7A 4I2LC 3P8CE 5AVWB 3HRNA 1T2KC 3IR9A 3RL0C 1GW3A 1JY3N 1SP4A 1HH0A 2YKOA 1N73A 2J0HA 1FAVA 1FZBC 1IK9A 1FZBA 5CCGA 2YO2A 1G2CB 3RK2C 2IX7C 5CHXA 3HD7D 1FBMA 1GD2E 4I1LA 2Q7CA 1FZEB 3MIWA 2VRSA 2WPQA 4IFDK 5AVTB 2L5GB 1MV8A 1G2CA 1J1EC 1LT9A 1W2EA 1S9KD 2Q3IA 3LIEA 3M9HA 1H89A 2R5BA 5KJ7D 4DZOA 1ZR2A 1T8ZA 4JYCA 2J59M 1NTZK 2NPSB 1FZEA 1NWQA 1HGZA 3HD7B 2C0WA 2IPPA 1CI6A 2OYHB 4WB4A 1SQPK 1NTMK 1FJKA 1URQB 3A7OA 3R2PA 2HODC 4IFMA 1DEBA 3M0DC 2IFNA 4W80A 1GU4A 3G3ZA 3KPEA 1GZLA 1CZQA 1L4AD 1RF0A 3VP8A 5CCGC 1ZLLA 2YNYA 4GIFA 2J3FA 2P2UA 3RK3D 3VMXA 1JNMA 4O9BA 5AW8B 1M1JB 1SFCB 1M1JC 1KFMA 4KHXA 1GL2D 1Z3UA 3HE5B 4C7RA 3EFGA 2C9LY 1JUNA 1NU1K 3P8CD 1IFNA 5KLVK 3OAKA 2FXMA 3GHGA 2HPCA 3BATA 3RL0B 2WSEH 1LT9B 2WITA 2H43A 4R9JA 1LT9C 1SQQK 1KFNA 2YKQA 1NAFA 4OH8B 5AW3B 1IFDA 5BVZA 2WSCH 3EQ2A 5CJ4A 1SFCD 1IO4A 3E1IA 2XNXB 1SVFA 1JCDA 2XNXC 3U1AA 1URQD 1JO5A 1J1EB 3HE4B 1QL1A 2H7HA 2XU6A 1GK4A 2H8PD 1N7SB 2WPRA 3VN0A 1L4AA 1N7SC 2MJZA 1DH3A 4I6MC 2QM7A 3A5TA 3H32C 1WRGA 4C7NB 1AFOA 1MFZA 5AVRB 2O1JA 2J60A 4AUWA 1OWAA 2NPSC 5CCHD 1RF0B 2J1GA 5AW1B 3A3YB 3MUDA 1JY2O 1OXZA 3P32A 3B5NB 2HODA 2PAJA 3V2QA 3BVHA 2J3OA 4M7HA 3B5NC 3TSIA 3RK2B 4JZCA 1IJDB 4GKGA 1FZAB 1LTJC 2Z5HA 1GDTA 2JEEA 4N78E 2CPBA 1L0NK 3TK1A 3VYIA 5KJ7A 5AVXB 1N7LA 3I5CA 5APSA 1FZGB 2JHLF 3RL0D 2J3FD 5AVZB 1LGHB 4EOTA 2Z4EC 1FZCA 2JHIF 5AVYB 1CW5A 5APQA 3MGNA 1RF1C 1FIDA 1KILC 3NMDA 4AQRD 1MZ9A 4Y99B 4Y99C 3V4WA 1N7SA 2D39A 1X9VA 2OYHC 1FZFA 4C7NA 3U1CA 3BRVB 2XNXA 1JMMA 3P8MC 2J2PA 2KP8A 1N86B 3MTUE 1GK6A 1X79B 2O1KA 1HUCA 4GT1A 2ZXEB 3II6A 5APXA 3M06A 2J3GA 1RE4A 1FDMA 2KB7P 5BU5A 1H88A 4B86A 2FYZA 3C9IA 2YMYA 2Z5IA 4WY4B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RE3 C;  1N73 C;  2JHH C;  1RE3 B;  2J3F A;  1JY2 N;  1M1J B;  1FZG C;  1M1J C;  1JY3 O;  1Z3U A;  2OYI B;  2J61 B;  3GHG B;  2HPC B;  3GHG C;  2HPC C;  1RE3 A;  2A45 I;  3GHG A;  2HPC A;  1Z3S A;  2JHM F;  1LTJ B;  2WNP F;  1LT9 B;  4R9J A;  2H43 A;  1FZE C;  1RF1 B;  1LT9 C;  1FIB A;  1LWU C;  2HLO A;  1RF1 A;  2J64 A;  2H43 B;  2A45 G;  4R9T A;  3E1I B;  3E1I A;  2XNX B;  2XNX C;  1LWU A;  2HLO C;  3HUS A;  4NYT A;  2J5Z A;  3FIB A;  3H32 A;  3H32 C;  1N86 A;  2OYH A;  2FFD C;  4M7F A;  4ZFG A;  1FZF C;  2J60 A;  2GY7 A;  3HUS C;  4JYO X;  1JY3 P;  1RE4 C;  1RF0 B;  2J1G A;  1RE4 B;  2FFD B;  1FZG A;  1M1J A;  1JY2 O;  2HOD A;  3BVH A;  2J3O A;  4M7H A;  1FZD A;  2Q9I C;  4JZC A;  1FZA A;  2J0Y A;  1FZA B;  1LTJ C;  2Z4E A;  1JY3 N;  2A45 H;  1N73 A;  2J0H A;  2H43 C;  1FZB C;  2Z4E B;  2Q9I B;  1FZB A;  1FZG B;  2JHL F;  2Q9I A;  2J3F D;  1FZC B;  1FZC C;  1FZE B;  2Z4E C;  1FZC A;  1LWU B;  2JHK F;  2JHI F;  2HLO B;  1JC9 A;  1LT9 A;  1W2E A;  4EPU A;  1RF1 C;  1FID A;  2OYI C;  2D39 A;  2OYI A;  1FZF B;  2OYH C;  1N86 C;  1FZF A;  2J0G A;  3HUS B;  1FZE A;  2XNX A;  2FIB A;  2J2P A;  3H32 B;  2OYH B;  1N86 B;  2HOD C;  3BVH C;  3E1I C;  3BVH B;  2J3G A;  1JY2 P;  1RE4 A;  1FZB B;  2HOD B;  1RF0 A;  1N73 B;  1RF0 C;  2J61 A;  2FFD A;  1FZA C;  2J3U A;  1LTJ A;  1FIC A;  1T3U A; 
#chains in the Genus database with same CATH topology
 2N1T C;  5CCG D;  4NPF X;  3CWB J;  4RJT A;  3NXS A;  5KLV J;  3BCC J;  1MFT A;  1SQX E;  1LTJ B;  1E5W A;  2HLO A;  1EDJ A;  1URQ A;  2FYN B;  3T97 A;  3SWF A;  1NOH A;  2LXB A;  1LP1 B;  1NO4 A;  1GU5 A;  2XDJ A;  1H0T B;  1JCC A;  3HD7 A;  3H32 A;  1KQS O;  1N86 A;  5APV A;  2GY7 A;  3H1J E;  4KJM A;  2K9J A;  3L71 G;  4YPC A;  3D6Y A;  3M9B A;  3L35 A;  1FZG A;  3L71 D;  2J58 A;  5AW6 B;  1ZN5 A;  4HH2 A;  4BRY B;  2LXC B;  3GLM A;  4EIJ A;  1NH4 A;  2C0X A;  2V4H A;  5BU8 B;  2WWW A;  2H88 C;  3MD0 A;  3H1I E;  3H1K G;  2PFX A;  1KZU B;  1PP9 J;  3NTN A;  5CMZ A;  2OYI C;  1PPJ E;  1QVF O;  2NPS D;  2AEM A;  1R8E A;  1IZN B;  1L0L D;  1PP9 D;  2E43 A;  2GUV A;  1EZV D;  3TF5 A;  5CBO A;  3VMY A;  1JY2 P;  2BEZ F;  1HWT C;  3V4Q A;  1VQO P;  1OFC X;  1GL2 C;  3G9R A;  3CCS P;  2WT7 B;  1OW6 A;  1VQ8 P;  2A06 E;  5KLI B;  1FIC A;  1NU1 J;  1EDK A;  1N73 C;  1SQQ G;  4N78 D;  3Q5R A;  5AW7 B;  4XE5 B;  1SQV J;  1JM0 A;  2J61 B;  2WZ7 A;  1BCC J;  2A45 G;  1HBW A;  3L70 G;  3FXD A;  3L70 D;  1GMJ A;  3BCC G;  3TDK A;  4JPZ B;  1W2B O;  3H1L J;  4ZFG A;  3PJS K;  2IZ0 A;  3HUS C;  3H1L D;  5KLV D;  3B5N D;  3L75 D;  2Q9I C;  5KLV G;  1HJ0 A;  4OVN F;  1GTW A;  3M9Q A;  4IOI H;  2Q9I A;  3V2P A;  1L0N D;  2Q6Q A;  4PD4 D;  3H1H G;  1JOC A;  2E76 D;  1NGM B;  4EPU A;  4UB8 E;  4C46 A;  1L4A B;  2P58 A;  3HTK B;  3H1I D;  2E74 C;  3H32 B;  3FWL A;  3E1I C;  1LTT C;  1SQB J;  1Q86 Q;  2OAR A;  5CCH A;  1IFJ A;  4CPG A;  3UIA A;  4WY4 D;  1LTJ A;  1T3U A;  1JTH A;  2JHH C;  5M1B A;  1FZG C;  4LGD E;  3V2R A;  2KLV A;  3VOP A;  4D6T D;  3GHG B;  2HPC B;  2W8Z A;  2Y0D A;  2P10 A;  1K9M Q;  1PFI A;  1LWU C;  2J64 A;  1RF1 A;  2QJK B;  2GA1 A;  4U3F J;  1LTG C;  1HVV A;  2RN0 A;  1VQ5 P;  1BGY G;  2B87 A;  2QM8 A;  1A02 F;  2M3E A;  1L0L G;  4R4L A;  4OGQ D;  2N9B A;  1SS1 A;  3L72 J;  3CCM P;  5AVW B;  1VQ7 P;  3IR9 A;  2KK7 A;  3RL0 C;  1ZRT E;  1IK9 A;  3CWB D;  2WQY C;  3HD7 D;  3L70 J;  1FS0 E;  1Q81 Q;  2VRS A;  5AVT B;  2L5G B;  1W2E A;  2Q3I A;  2R5B A;  5E79 H;  2IBZ E;  1SQV G;  2J59 M;  4PD4 I;  2IPP A;  1OVV A;  2OYH B;  3H1H E;  1NTM K;  2K9J B;  2QG4 A;  1SQP D;  4PD4 H;  3PH0 A;  1GZL A;  2UWJ E;  2KNC A;  4K35 A;  1Y9B A;  1ZLL A;  2RKL A;  2J3F A;  4DJG A;  1AA0 A;  1R5S A;  2E75 B;  1KFM A;  1EZV G;  2E75 C;  2KXP B;  4C7R A;  1NU1 K;  4ZNC A;  1EZV E;  1SQB E;  1SQQ K;  3CXH H;  1YBK A;  5KKZ B;  5AW3 B;  1IFD A;  2WPV B;  3E1I A;  2KLU A;  1Q90 D;  2IYP A;  3HE4 B;  2WSS H;  2JKV A;  4JBZ A;  1L4A A;  3A5T A;  1SQV D;  2O1J A;  2J60 A;  1OWA A;  2ZT9 C;  2M0B A;  2ZT9 B;  3MUD A;  3B5N B;  2HOD A;  3BVH A;  3VMA A;  1NU1 G;  2ZYG A;  4EI2 A;  1L0N K;  3VYI A;  5APS A;  1YI2 P;  5AVZ B;  1BDD A;  4H13 B;  4UB6 H;  2KUB A;  1LGH B;  1CW5 A;  2RH0 A;  3V6I A;  4YXW H;  2Y9Z A;  4Y99 B;  4Y99 C;  1N7S A;  3JCU H;  1EZV I;  1ZW0 A;  3U1C A;  4HJG H;  3EWK A;  1SQX D;  1X79 B;  2K37 A;  2O1K A;  2J5U A;  1HUC A;  3II6 A;  5APX A;  3M06 A;  1RE4 A;  2ZXX A;  3C9I A;  2IBZ G;  2ZAE B;  4WY4 B;  1RE3 C;  3GF3 A;  1RE3 B;  5GTH H;  1YTZ T;  1VF5 C;  3L72 E;  4Z1M H;  1KQL A;  1RE3 A;  3F89 A;  3D70 A;  4U7J A;  1PPJ G;  2V7Q J;  4HYT B;  1VQM P;  4R9T A;  2OQQ A;  4GDO A;  2YXR B;  4L73 A;  2MKV A;  3OJA B;  3EFF K;  3PHL A;  2FYU G;  1KV4 A;  4EYY Q;  4WVZ A;  2KSE A;  1RE4 C;  3VTP C;  1RE4 B;  2FFD B;  2XKM A;  1X22 A;  1FZD A;  3B71 A;  2D2C C;  3L73 D;  3TNU B;  1H8A A;  2I8D A;  2OTK E;  2XZR A;  1BDC A;  2HFE D;  2YXQ B;  1LWU B;  2Q5U A;  1BSN A;  2B88 A;  3H1J J;  3ZDM A;  2O3J A;  1DIP A;  4N3Y B;  2K88 A;  1FZF B;  2IZ1 A;  1N86 C;  1FE6 A;  1IK7 A;  1UII A;  3WMM 0;  3FGA D;  3BVH C;  2OGU A;  3BVH B;  5AW4 B;  1PGO A;  4WY4 A;  2GM4 A;  1SQX J;  1ZR4 A;  5KLV E;  2WSF H;  2FFD A;  1SLQ A;  4AYC A;  4OWF A;  3RK3 B;  2FBW C;  3RK3 C;  1OZH A;  1KOR A;  5GTI H;  1M7L A;  3WU2 E;  4XFJ A;  1CSB A;  1LJ2 A;  3HE5 A;  3S4R A;  3R4Y A;  2AXT E;  3K5B A;  1T2K D;  2H43 B;  3Q5P A;  3H1K J;  3U59 A;  2ZVN B;  3H1L E;  1KIL B;  3AE7 C;  2B87 B;  3IFM A;  4HB1 A;  1LTB C;  2K1A A;  1NTK E;  1NTZ J;  2O01 J;  3L71 J;  4GOE A;  3KDP B;  1M1J A;  1USD A;  1SQV E;  4PV1 C;  1ZOY C;  2R3S A;  4PV1 B;  2WMM A;  4RO0 A;  3M91 A;  2K3R A;  1FZC B;  2D2C D;  3T97 B;  1FZC C;  2HLO B;  2POH A;  1KIL D;  2R5D A;  3CC7 P;  1BCC G;  2OYI A;  3KYQ A;  4DT0 A;  1HJB A;  2FIB A;  3AE8 C;  4NPD A;  4BRY A;  2WTY A;  1YQ3 C;  3H1I J;  3A0H H;  3G71 P;  2HOD B;  2YIU C;  2J61 A;  2ITA A;  1GL2 A;  1FZA C;  3H25 A;  2J3U A;  1SFC A;  1ZV8 A;  2PP6 A;  1PZQ A;  1ZRT D;  3WUT A;  3TGU J;  3GHG C;  2HPC C;  5AVS B;  4PD4 E;  1SFC C;  1NTM D;  2IDB A;  3I55 P;  5KAF H;  1S5L H;  4JQ0 D;  1T3J A;  4TT3 H;  3G6E P;  3A0B E;  3V2N A;  4H44 C;  2WSC J;  3H1J G;  5CCH C;  1FU1 A;  2KS1 B;  3CX5 H;  2N9Y B;  1KB9 I;  2R44 A;  1Z56 A;  2XV5 A;  3B4S A;  3BCC E;  1KQG B;  1EDL A;  4YXD C;  3KXD A;  1GW3 A;  1ZXG A;  1Q82 Q;  1HH0 A;  2J0H A;  3IF4 A;  1FZB C;  5CCG A;  5CHX A;  1OW7 A;  1FBM A;  1GD2 E;  4I1L A;  3TGU E;  2Q7C A;  3S9O A;  3MIW A;  3RL0 g;  1J1E C;  3M9H A;  2E74 B;  2KZI A;  4PJ0 E;  2NPS B;  3MP7 B;  1KYO D;  4WB4 A;  4IL6 E;  1Y47 A;  1URQ B;  1OMI A;  3ITK A;  1DEB A;  5TJH A;  4W80 A;  1RF0 A;  3Q1M A;  2OYO A;  2QJP C;  2P2U A;  1JNM A;  1S2E A;  4BWN A;  2CK3 H;  1M1J B;  1SQB G;  1M1J C;  3AEA C;  4KHX A;  2QE7 H;  3EFG A;  2C9L Y;  1JUN A;  3L72 D;  3MZW B;  3P8C D;  5KLV K;  5C39 A;  3OAK A;  3W67 A;  3BAT A;  2WSE H;  1LT9 B;  1SQQ E;  2WIT A;  2E74 D;  1K04 A;  1NAF A;  5BVZ A;  1SFC D;  3Q5S A;  1BE3 D;  3U1A A;  1URQ D;  1QVG O;  2H7H A;  2XU6 A;  3L71 E;  1GK4 A;  2WPR A;  3L74 E;  3VN0 A;  3FXE A;  4RKU J;  1MFZ A;  4AUW A;  1RHZ B;  2FXO A;  1S5L X;  3H1K D;  3B5N C;  3TSI A;  3RK2 B;  1IJD B;  2AEJ A;  1JEK A;  1VL2 A;  2CPB A;  3H1K E;  1AJY A;  3RL0 D;  2A06 D;  1JMB A;  1MKM A;  2B9B A;  2K9Y A;  3AE2 C;  1FZC A;  3JC2 2;  2ZVO B;  5DJU B;  2V7Q H;  4Y28 J;  3AE5 C;  4QMA A;  3V4W A;  2D39 A;  1S72 P;  1FZF A;  4C7N A;  2QVA A;  2JP3 A;  1JMM A;  2J2P A;  3MUD C;  4GT1 A;  3CX5 E;  1FDM A;  1QLE D;  1BGY E;  1H88 A;  2FYZ A;  1KTM A;  3L74 D;  1Q7Y Q;  1PP9 E;  1KMI Z;  3CCL P;  3F5H A;  1NJI Q;  3L4F A;  3CCQ P;  2N1T D;  2OYI B;  3A2A A;  1JB0 J;  1L0L K;  1T6A A;  1BE3 E;  1XTC C;  1EXI A;  2AXT H;  3I56 P;  3B8E B;  4ASV A;  3SFE C;  1X8Y A;  2JR8 A;  2L91 A;  1YIJ P;  2NPS A;  4NYT A;  4JYB A;  1DD4 A;  1QGK B;  3AED C;  1NTZ D;  1Q2N A;  3HD7 C;  1GL2 B;  2QA4 P;  1PL5 A;  1R5L A;  1NTK K;  1YJN P;  3M0D A;  3H1H J;  1KQF B;  4IFF A;  2FYU K;  4H0L C;  1VQL P;  4H0L B;  3AEE C;  2J0Y A;  4W7Z A;  1VQK P;  2Z4E B;  2Q9I B;  3CCE P;  2AEF A;  1KIL A;  5AVV B;  2KZJ A;  3TYY A;  2N1T B;  2W6A A;  1EXJ A;  3KQG A;  2ZYA A;  3A0H E;  5APT A;  4H44 B;  1FC2 C;  3H6P A;  3HUS B;  2E5T A;  2IBZ I;  4D6T G;  3SFD C;  1PGJ A;  2O01 H;  3BRT B;  1QL2 A;  3GF7 A;  3QWO C;  1RF0 C;  4GOD A;  2G3A A;  1BCC E;  3IAO A;  1JY2 N;  1IFI A;  4ZKU A;  4W7Y A;  2BCC J;  5K5G B;  2A45 I;  3C1L A;  2WNP F;  1VF5 D;  2HYN A;  5KTB A;  2LR2 A;  2Y0E A;  2M3B A;  1KYO H;  3CCR P;  3E1I B;  1S5L E;  3CLQ A;  3LW5 H;  3D71 A;  3PTZ A;  3RBZ A;  2H89 C;  1L0N G;  1IC2 A;  2FFD C;  3JSV C;  1FZF C;  5AVQ B;  1IFM A;  3AE6 C;  2ZT9 D;  1SQV K;  2N1T A;  4XA4 A;  1FOS E;  2W6J H;  1AVO A;  3L36 A;  1AVY A;  2KYV A;  3AEC C;  4U3F G;  1NU1 D;  4U3F D;  1E79 H;  1JC9 A;  5KKZ C;  1FDI A;  5APU A;  1FJP A;  2A06 G;  1ZME C;  3CD6 P;  2E76 C;  1AQ5 A;  4H44 D;  3H1L G;  2Q3E A;  3L75 G;  3HE4 A;  2W27 A;  2HG5 D;  1PIX A;  2Q1K A;  4IL6 H;  2BAS A;  2IFM A;  2E75 D;  3ABV C;  5E79 E;  1S3J A;  3SWY A;  1N73 B;  1KYO I;  2P7J A;  1YJW P;  3OA7 A;  3GG2 A;  1JTH B;  3V5B A;  5APY A;  1HTL C;  1JY3 O;  3PP5 A;  1X0T A;  3H1I G;  1YYC A;  1NYH A;  2M5A B;  3VP9 A;  2C9N Y;  2YKP A;  2IBZ D;  1NTK G;  2YO3 A;  1Z3S A;  3L74 G;  1IFP A;  2OTJ P;  2JJL A;  1U7M A;  1NU1 E;  1RY3 A;  4HKZ H;  2QJY B;  2HLO C;  3L37 A;  4MN4 C;  2J5Z A;  5H2F E;  3TGU G;  2Y0C A;  3B5N A;  1LTI C;  2QSI A;  4UB6 E;  4ZKP A;  4WWI A;  2KOG A;  4JF7 A;  1T2K C;  5L8R J;  3CCJ P;  3CX5 D;  1NTZ G;  1N73 A;  2YKO A;  3FX0 A;  2YO2 A;  1G2C B;  2IX7 C;  1FDO A;  4DCK A;  1N8R Q;  1MV8 A;  1G2C A;  3C8V A;  4H13 C;  3LIE A;  1NTM G;  5KJ7 D;  4DZO A;  1ZR2 A;  4TLF A;  1FZE A;  1NWQ A;  2C0W A;  2IYO A;  1CI6 A;  5GTH E;  1FJK A;  3A7O A;  3R2P A;  4A7P A;  3H1J D;  4EDF A;  2IFN A;  3G3Z A;  3KPE A;  1L4A D;  3VP8 A;  5CCG C;  4GOF A;  2W83 C;  2YNY A;  2M5A A;  1PPJ D;  4I7Z B;  2QIW A;  1M8O B;  1K73 Q;  3CCV P;  4YTP C;  1Z3U A;  3HE5 B;  1NVO A;  3L72 G;  1IFN A;  5TIS H;  3WUU A;  3GHG A;  2HPC A;  3RL0 B;  4R9J A;  2H43 A;  1LT9 C;  1OW8 A;  2YKQ A;  3WUV A;  1HF9 A;  5CJ4 A;  1KB9 D;  1DD3 A;  1DEE G;  1JCD A;  2FYN C;  1QL1 A;  2H8P D;  1N7S B;  1DH3 A;  4I6M C;  2QM7 A;  1VQN P;  1WRG A;  2OTL P;  1AFO A;  2NPS C;  2JWA A;  1BSH A;  2KNC B;  5CCH D;  3GW6 A;  1OXZ A;  3P32 A;  3V2Q A;  2PAJ A;  2J3O A;  3SSU A;  1U7J A;  1SQP E;  3AE3 C;  3IN6 A;  4PV1 D;  4GKG A;  1LTJ C;  2Z5H A;  1GDT A;  4N78 E;  5B5E H;  1N7L A;  3I5C A;  1FZG B;  1LNQ A;  2J3F D;  1L0L J;  2ZJS E;  1VQ4 P;  1OVR A;  5AVY B;  3E7K A;  1RF1 C;  1FID A;  3MGN A;  1KN7 A;  1KIL C;  4AQR D;  1MZ9 A;  2O01 N;  2OYH C;  1LP1 A;  4H13 D;  3P8M C;  2KP8 A;  1PGQ A;  1GK6 A;  2PRR A;  1USE A;  1KB9 E;  5KAI H;  5BU5 A;  4B86 A;  2SPZ A;  2YMY A;  3FWN A;  2Z5I A;  5DJT B;  3AE4 C;  1L2P A;  3P7K A;  2I1J A;  2G8Y A;  5B66 H;  2WT7 A;  1N2D C;  1FIB A;  1FZE C;  2KSJ A;  4N6J A;  1KYO E;  1J1D C;  1RQV A;  1J1D B;  3CPW O;  3CI9 A;  1P84 H;  3L75 J;  2E5Y A;  3L73 J;  3QH9 A;  1LWU A;  1CI6 B;  3WU2 H;  5APW A;  1N7S D;  4M7F A;  1M90 Q;  2WPS A;  5KLI C;  3PRJ A;  1G1I A;  3MHV A;  1OIP A;  4K3A A;  1D7M A;  1FZA A;  1NKZ B;  3TGU D;  2Z4E A;  3Q3D A;  2A45 H;  1M1K Q;  2H43 C;  1LTA C;  3CXH I;  1YHQ P;  3S1K A;  4WBA A;  1S9K E;  5B5E E;  2XND H;  4DOJ A;  5TIS E;  2JHK F;  1GW4 A;  1SQB K;  3RK2 D;  4L75 A;  1VF5 B;  1SQX K;  1RQU A;  2GUS A;  1H0T A;  4L74 A;  1WMK A;  1G1J A;  1P84 D;  3L73 G;  1L4A C;  1K8A Q;  3VMZ A;  1DX7 A;  3O8Z A;  3USS A;  4RES B;  5AW2 B;  4WY4 C;  2WSF J;  2I1K A;  3LID A;  2ZYD A;  2M8R A;  1NTM E;  2DW3 A;  1SQQ D;  1M57 D;  2P1J A;  1SQX G;  3BAS A;  1BGY J;  1L0N E;  1A02 J;  2QEX P;  1LT1 A;  1OVU A;  1LTS C;  3AEG C;  2LKM A;  2RMZ A;  1URQ C;  2FY8 A;  2OYH A;  2BCC D;  3CX5 I;  2P67 A;  1JY3 P;  2D2C B;  4NPE A;  4LLH A;  4KT0 J;  4IL6 X;  5AW0 B;  1HGV A;  2ZFC A;  1FOS F;  4L76 A;  3BCC D;  2W90 A;  1WT6 A;  3TNU A;  4D6T J;  1BGY D;  3CL3 D;  2HR3 A;  3CXH D;  4LC1 A;  3L74 J;  2R32 A;  1NHL A;  3L70 E;  1S1C X;  5CJ0 A;  2J0G A;  3KZI E;  3Q2Y A;  1SQB D;  3RGU A;  2KIK A;  3N4X A;  2W6B A;  1VPC A;  3RBX A;  3HTK A;  3LW5 J;  5KAF E;  3L73 E;  5AW9 B;  1S4X A;  1FZB B;  1P84 E;  1P84 I;  3KHU A;  3L75 E;  2FXP A;  1KD1 Q;  1YTZ I;  2FKW B;  1QX8 A;  1VQ6 P;  1NKN A;  1VDF A;  5AVU B;  2FYU J;  1L0N J;  4U3F E;  1MUU A;  4M3L A;  2JHM F;  1RF1 B;  1PV3 A;  2QJK C;  5AW5 B;  5KJ7 C;  3JCU E;  3N7N A;  2R3C A;  3G4S P;  3HUS A;  2CPS A;  3OW2 O;  3FIB A;  3CC2 P;  3NFQ A;  2JDI H;  4BXL A;  1J2J B;  1EDI A;  2YMK A;  2QJP B;  2E42 A;  1XTG B;  4JYO X;  3M0A A;  4ZMD A;  1BE3 J;  1EQ7 A;  4I2L C;  1W5C E;  3GMA A;  3AEB C;  3P8C E;  3HRN A;  1VQ9 P;  4H0L D;  1JY3 N;  1K05 A;  1SP4 A;  3W68 A;  1VQP P;  2KI7 B;  1FAV A;  3H1H D;  1L0L E;  1FZB A;  1M56 D;  3RK2 C;  2NZ2 A;  1FZE B;  2FYU E;  1TU3 F;  2E76 B;  2WPQ A;  4IFD K;  1KB9 H;  5KAI E;  1LT9 A;  4UB8 H;  1S9K D;  1H89 A;  1NTK D;  2KS1 A;  1PP9 G;  1T8Z A;  4JYC A;  5CBN A;  2JWD A;  1NTZ K;  1RH5 B;  5EFW B;  1HGZ A;  3HD7 B;  3CWB E;  2JO1 A;  1YQ4 C;  1SQP K;  2YIU B;  2HOD C;  3O6Q A;  4IFM A;  3M0D C;  3CWB G;  2QJY C;  3SWK A;  1GU4 A;  3CMA P;  1CZQ A;  1ZP0 C;  3CME P;  4OGQ C;  1AQT A;  4OGQ B;  4GIF A;  1AV1 A;  3RK3 D;  3VMX A;  1OX3 A;  4O9B A;  5AW8 B;  3A0B H;  1SFC B;  4ASW A;  1GL2 D;  4D6T E;  1KC8 Q;  2FXM A;  1QEX A;  5B66 E;  1KFN A;  1SQP G;  4OH8 B;  2WSC H;  3EQ2 A;  1IO4 A;  4R4M A;  2XNX B;  1SVF A;  2XNX C;  1JO5 A;  1J1E B;  3E1R A;  3AE9 C;  1N7S C;  2MJZ A;  3H32 C;  5GTI E;  4C7N B;  3CCU P;  5AVR B;  2QRX A;  1SQQ J;  1RF0 B;  2J1G A;  5AW1 B;  1PGP A;  3A3Y B;  2B89 A;  1JY2 O;  4M7H A;  3KZI H;  4JZC A;  3O6Q B;  1FZA B;  2JEE A;  5KJ7 A;  2AXC A;  3TK1 A;  5AVX B;  3AEF C;  2PGD A;  2WVR A;  1BE3 G;  2JHL F;  1BCC D;  2BCC E;  2BEQ D;  3AE1 C;  2Y9Y A;  4EOT A;  2Z4E C;  4I7Z C;  2JHI F;  5APQ A;  1YJ9 P;  1NTZ E;  1EC5 A;  3NMD A;  1Y8A A;  4PJ0 H;  1NTM J;  3D6Z A;  1NTK J;  1SQP J;  1X9V A;  1YIT P;  3PLN A;  2FYU D;  1KIL E;  3BRV B;  2XNX A;  2NRG A;  1N86 B;  1U57 A;  1UIX A;  3MTU E;  5H2F H;  2BCC G;  2ZXE B;  2J3G A;  3CC4 P;  2KB7 P;  1NAY A;  3CXH E;  2WSE J;  3RK3 E; 
#chains in the Genus database with same CATH homology
 2N1T C;  1RE3 C;  5CCG D;  1RE3 B;  3L4F A;  1YTZ T;  3NXS A;  2N1T D;  2OYI B;  3A2A A;  3P7K A;  2I1J A;  2WT7 A;  1KQL A;  1RE3 A;  1L0L K;  1LTJ B;  1XTC C;  1E5W A;  1N2D C;  1FIB A;  1FZE C;  2HLO A;  2KSJ A;  4N6J A;  3B8E B;  1J1D C;  1URQ A;  3T97 A;  1J1D B;  3SWF A;  1NOH A;  3CI9 A;  4HYT B;  4R9T A;  1X8Y A;  1LWU A;  1NO4 A;  2NPS A;  3OJA B;  1GU5 A;  2XDJ A;  1CI6 B;  4NYT A;  1JCC A;  5APW A;  4JYB A;  3HD7 A;  1N7S D;  3HD7 C;  1GL2 B;  3H32 A;  4M7F A;  1N86 A;  5APV A;  2WPS A;  1NTK K;  2GY7 A;  3M0D A;  1G1I A;  1RE4 C;  3VTP C;  1RE4 B;  3M9B A;  3L35 A;  1FZG A;  4IFF A;  2FFD B;  2XKM A;  2J58 A;  2FYU K;  5AW6 B;  1FZD A;  1ZN5 A;  4HH2 A;  1FZA A;  2J0Y A;  1NKZ B;  2Z4E A;  3TNU B;  2A45 H;  4W7Z A;  1H8A A;  4EIJ A;  2XZR A;  2H43 C;  2Z4E B;  1LTA C;  2Q9I B;  1NH4 A;  2C0X A;  5BU8 B;  4WBA A;  1S9K E;  1KIL A;  2WWW A;  5AVV B;  2HFE D;  3MD0 A;  4DOJ A;  1LWU B;  3TYY A;  2N1T B;  2JHK F;  2Q5U A;  1GW4 A;  2W6A A;  1SQB K;  1KZU B;  3KQG A;  3RK2 D;  3NTN A;  4N3Y B;  5CMZ A;  2OYI C;  5APT A;  1SQX K;  1FZF B;  2GUS A;  1N86 C;  2NPS D;  3H6P A;  3HUS B;  1G1J A;  1L4A C;  3WMM 0;  2E43 A;  2GUV A;  3BVH C;  2O01 H;  3BVH B;  3VMY A;  5AW4 B;  3VMZ A;  3BRT B;  1JY2 P;  3O8Z A;  1DX7 A;  1QL2 A;  4WY4 A;  4RES B;  5AW2 B;  2GM4 A;  1HWT C;  3V4Q A;  4WY4 C;  1ZR4 A;  2I1K A;  1RF0 C;  3LID A;  1GL2 C;  2WSF H;  2FFD A;  1SLQ A;  2WT7 B;  4AYC A;  2M8R A;  1FIC A;  3RK3 B;  3RK3 C;  1N73 C;  1JY2 N;  4N78 D;  1IFI A;  5AW7 B;  4ZKU A;  1M7L A;  2P1J A;  4W7Y A;  1CSB A;  4XE5 B;  3HE5 A;  2J61 B;  3BAS A;  1A02 J;  2A45 I;  2WZ7 A;  1T2K D;  2WNP F;  2HYN A;  5KTB A;  2H43 B;  3U59 A;  1LTS C;  2A45 G;  1HBW A;  2M3B A;  1KIL B;  3E1I B;  2LKM A;  3CLQ A;  3IFM A;  3LW5 H;  1LTB C;  1URQ C;  1IC2 A;  2OYH A;  2FFD C;  4ZFG A;  1FZF C;  2P67 A;  3HUS C;  5AVQ B;  1IFM A;  1JY3 P;  3KDP B;  1M1J A;  3B5N D;  4LLH A;  2Q9I C;  1SQV K;  2N1T A;  5AW0 B;  1HGV A;  4XA4 A;  1GTW A;  1FOS E;  2ZFC A;  3M9Q A;  1FOS F;  3L36 A;  3M91 A;  2KYV A;  2Q9I A;  1FZC B;  3V2P A;  1FZC C;  1WT6 A;  3TNU A;  1JOC A;  2HLO B;  3CL3 D;  2POH A;  1JC9 A;  1KIL D;  4EPU A;  4LC1 A;  5APU A;  1FJP A;  2R5D A;  4C46 A;  2R32 A;  1AQ5 A;  2OYI A;  1L4A B;  3HTK B;  1NHL A;  5CJ0 A;  3KYQ A;  2J0G A;  3HE4 A;  2W27 A;  2HG5 D;  1HJB A;  2FIB A;  3N4X A;  3H32 B;  2W6B A;  1VPC A;  2BAS A;  3HTK A;  2IFM A;  3E1I C;  1LTT C;  2WTY A;  5AW9 B;  1FZB B;  2OAR A;  3SWY A;  2HOD B;  1N73 B;  2P7J A;  5CCH A;  1IFJ A;  2J61 A;  3OA7 A;  3UIA A;  1GL2 A;  1FZA C;  2J3U A;  1JTH B;  3V5B A;  4WY4 D;  1LTJ A;  1T3U A;  1JTH A;  1SFC A;  1YTZ I;  1ZV8 A;  2FKW B;  2PP6 A;  5APY A;  2JHH C;  1HTL C;  1FZG C;  4LGD E;  1JY3 O;  3V2R A;  1NKN A;  3PP5 A;  1YYC A;  2KLV A;  3VOP A;  3VP9 A;  2C9N Y;  1VDF A;  5AVU B;  2YKP A;  3GHG B;  2HPC B;  3GHG C;  2HPC C;  5AVS B;  1MUU A;  1SFC C;  2YO3 A;  4M3L A;  1Z3S A;  2JHM F;  1RF1 B;  5AW5 B;  1PFI A;  5KJ7 C;  1LWU C;  2J64 A;  1RF1 A;  2JJL A;  3N7N A;  1LTG C;  1T3J A;  1HVV A;  1RY3 A;  2R3C A;  3V2N A;  2HLO C;  3HUS A;  3L37 A;  2CPS A;  2J5Z A;  3FIB A;  3NFQ A;  2QM8 A;  5CCH C;  1J2J B;  1FU1 A;  3B5N A;  1A02 F;  1LTI C;  2E42 A;  1XTG B;  4JYO X;  3M0A A;  4ZKP A;  1Z56 A;  2XV5 A;  2KOG A;  2N9B A;  4JF7 A;  1EQ7 A;  4I2L C;  3P8C E;  5AVW B;  3HRN A;  1T2K C;  3IR9 A;  3RL0 C;  1GW3 A;  1JY3 N;  1SP4 A;  1HH0 A;  2YKO A;  1N73 A;  2J0H A;  1FAV A;  1FZB C;  1IK9 A;  1FZB A;  5CCG A;  2YO2 A;  1G2C B;  3RK2 C;  2IX7 C;  5CHX A;  3HD7 D;  1FBM A;  1GD2 E;  4I1L A;  2Q7C A;  1FZE B;  3MIW A;  2VRS A;  2WPQ A;  4IFD K;  5AVT B;  2L5G B;  1MV8 A;  1G2C A;  1J1E C;  1LT9 A;  1W2E A;  1S9K D;  2Q3I A;  3LIE A;  3M9H A;  1H89 A;  2R5B A;  5KJ7 D;  4DZO A;  1ZR2 A;  1T8Z A;  4JYC A;  2J59 M;  1NTZ K;  2NPS B;  1FZE A;  1NWQ A;  1HGZ A;  3HD7 B;  2C0W A;  2IPP A;  1CI6 A;  2OYH B;  4WB4 A;  1SQP K;  1NTM K;  1FJK A;  1URQ B;  3A7O A;  3R2P A;  2HOD C;  4IFM A;  1DEB A;  3M0D C;  2IFN A;  4W80 A;  1GU4 A;  3G3Z A;  3KPE A;  1GZL A;  1CZQ A;  1L4A D;  1RF0 A;  3VP8 A;  5CCG C;  1ZLL A;  2YNY A;  4GIF A;  2J3F A;  2P2U A;  3RK3 D;  3VMX A;  1JNM A;  4O9B A;  5AW8 B;  1M1J B;  1SFC B;  1M1J C;  1KFM A;  4KHX A;  1GL2 D;  1Z3U A;  3HE5 B;  4C7R A;  3EFG A;  2C9L Y;  1JUN A;  1NU1 K;  3P8C D;  1IFN A;  5KLV K;  3OAK A;  2FXM A;  3GHG A;  2HPC A;  3BAT A;  3RL0 B;  2WSE H;  1LT9 B;  2WIT A;  2H43 A;  4R9J A;  1LT9 C;  1SQQ K;  1KFN A;  2YKQ A;  1NAF A;  4OH8 B;  5AW3 B;  1IFD A;  5BVZ A;  2WSC H;  3EQ2 A;  5CJ4 A;  1SFC D;  1IO4 A;  3E1I A;  2XNX B;  1SVF A;  1JCD A;  2XNX C;  3U1A A;  1URQ D;  1JO5 A;  1J1E B;  3HE4 B;  1QL1 A;  2H7H A;  2XU6 A;  1GK4 A;  2H8P D;  1N7S B;  2WPR A;  3VN0 A;  1L4A A;  1N7S C;  2MJZ A;  1DH3 A;  4I6M C;  2QM7 A;  3A5T A;  3H32 C;  1WRG A;  4C7N B;  1AFO A;  1MFZ A;  5AVR B;  2O1J A;  2J60 A;  4AUW A;  1OWA A;  2NPS C;  5CCH D;  1RF0 B;  2J1G A;  5AW1 B;  3A3Y B;  3MUD A;  1JY2 O;  1OXZ A;  3P32 A;  3B5N B;  2HOD A;  2PAJ A;  3V2Q A;  3BVH A;  2J3O A;  4M7H A;  3B5N C;  3TSI A;  3RK2 B;  4JZC A;  1IJD B;  4GKG A;  1FZA B;  1LTJ C;  2Z5H A;  1GDT A;  2JEE A;  4N78 E;  2CPB A;  1L0N K;  3TK1 A;  3VYI A;  5KJ7 A;  5AVX B;  1N7L A;  3I5C A;  5APS A;  1FZG B;  2JHL F;  3RL0 D;  2J3F D;  5AVZ B;  1LGH B;  4EOT A;  2Z4E C;  1FZC A;  2JHI F;  5AVY B;  1CW5 A;  5APQ A;  3MGN A;  1RF1 C;  1FID A;  1KIL C;  3NMD A;  4AQR D;  1MZ9 A;  4Y99 B;  4Y99 C;  3V4W A;  1N7S A;  2D39 A;  1X9V A;  2OYH C;  1FZF A;  4C7N A;  3U1C A;  3BRV B;  2XNX A;  1JMM A;  3P8M C;  2J2P A;  2KP8 A;  1N86 B;  3MTU E;  1GK6 A;  1X79 B;  2O1K A;  1HUC A;  4GT1 A;  2ZXE B;  3II6 A;  5APX A;  3M06 A;  2J3G A;  1RE4 A;  1FDM A;  2KB7 P;  5BU5 A;  1H88 A;  4B86 A;  2FYZ A;  3C9I A;  2YMY A;  2Z5I A;  4WY4 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...