1RF1B

Crystal structure of fragment d of gammae132a fibrinogen with the peptide ligand gly-his-arg-pro-amide
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
299
structure length
299
Chain Sequence
IPTNLRVLRSILENLRSKIQKLESDVSAQMEYCRTPCTVSCNIPVVSGKECEEIIRKGGETSEMYLIQPDSSVKPYRVYCDMNTENGGWTVIQNRQDGSVDFGRKWDPYKQGFGNVATNTDGKNYCGLPGEYWLGNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGGFTVQNEANKYQISVNKYRGTAGNALMDGASQLMGENRTMTIHNGMFFSTYDRDNDGWLTSDPRKQCSKEDGGGWWYNRCHAANPNGRYYWGGQYTWDMAKHGTDDGVVWMNWKGSWYSMRKMSMKIRPFFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Blood clotting
molecule keywords Fibrinogen alpha/alpha-E chain
publication title Calcium-Binding Site beta2, Adjacent to the "b" Polymerization Site, Modulates Lateral Aggregation of Protofibrils during Fibrin Polymerization.
pubmed doi rcsb
source organism Homo sapiens
total genus 97
structure length 299
sequence length 299
chains with identical sequence E
ec nomenclature
pdb deposition date 2003-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1rf1B01
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 1rf1B02
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 1rf1B03
3HUSA 2H43A 3BVHC 1W2EA 2A45I 1FZGA 4ZFGA 2XNXA 2HODB 2A45G 4JYOX 2D39A 3HUSC 2H43C 4NYTA 1FZGC 2J2PA 1FZAA 2HLOB 1RF1A 1N86B 2JHIF 3FIBA 1FZAC 1M1JA 1FZDA 3E1IB 2J3FD 1JY2N 1RF1C 2JHHC 2OYIA 2Q9IB 1N86A 2J64A 1JY3P 2JHLF 4EPUA 1N73A 1M1JC 4JZCA 2OYIC 1FZCB 1FZEB 1N86C 2JHMF 1N73C 1Z3UA 1LT9B 2HODA 3GHGB 2HPCB 1FZEA 2J3OA 2WNPF 1FIBA 3H32B 1FZBB 4R9JA 1Z3SA 4M7FA 2J0YA 2HODC 1LT9A 3GHGA 1FZEC 2HPCA 1JY3O 2HLOA 2J0HA 1LWUB 3H32A 1LT9C 3E1IA 3GHGC 2HPCC 2FFDB 2GY7A 2HLOC 3BVHB 1FIDA 1RE3B 2Q9IA 3H32C 1JY2P 2FIBA 2Z4EB 1LWUA 1FZFB 2J61B 3E1IC 4R9TA 2OYHB 1LTJB 1RF0B 2FFDA 4M7HA 1FZCA 2XNXB 2Q9IC 1LWUC 1RE3A 2Z4EA 1FZFA 2JHKF 2J61A 2OYHA 2FFDC 1LTJA 1RF0A 1FZCC 1RE4B 1RE3C 1FZAB 2Z4EC 1JC9A 2J5ZA 2J0GA 1FZFC 1FZBA 1RF1B 2OYHC 1T3UA 1LTJC 1RF0C 2J3FA 2XNXC 1M1JB 1FICA 1RE4A 1JY2O 1JY3N 1FZBC 2J1GA 2J3UA 2OYIB 2A45H 3HUSB 2H43B 2J60A 1N73B 1RE4C 1FZGB 3BVHA 2J3GA
chains in the Genus database with same CATH superfamily
3CXHI 1J1DB 2D39A 5APTA 3A0HE 4I7ZC 1QL1A 4D6TG 4I1LA 1AJYA 2E74B 2BCCE 1Q81Q 3TNUA 1URQD 3E1IB 4HJGH 1X22A 1OFCX 2JHHC 1P84H 1SQPD 1HTLC 3L71E 3CMEP 4EPUA 2VRSA 2KZJA 1NTZE 1ZXGA 2BCCG 1EZVD 3L72D 5H2FH 3O6QA 2ZYGA 4H44B 1IFPA 4PJ0H 3SWKA 1KILE 3H1ID 3JC22 2XZRA 2AXTH 2IX7C 2ZVNB 1LT9A 3L71G 5M1BA 1NTZG 4PD4D 1LWUB 1SQXJ 5B5EH 1M8OB 2SPZA 1FZFB 1KFMA 2ZT9C 2C0XA 1E79H 4K3AA 1N7LA 1HJBA 5APYA 1VQMP 5KLIC 2FKWB 2A06D 1KYOD 2D2CC 3D6YA 1AA0A 3V5BA 1M90Q 2QJKB 4OGQC 4WY4B 4C7NA 3CC7P 3CCQP 4DJGA 3CXHH 2H43B 5AW7B 1RE4C 1FZGB 3BVHA 1RHZB 3KZIE 2WPQA 2XNDH 2HODB 1SQQJ 3C1LA 3H1JJ 1BSHA 2J2PA 1IK7A 1T6AA 1K05A 3P7KA 2J59M 1N86B 1N7SD 2QE7H 4H13C 2PAJA 1ZN5A 2J3FD 2J5UA 5AVYB 2Q6QA 1CSBA 2IFMA 1SQPJ 2W6JH 2IBZI 3G4SP 3F5HA 2K88A 2LXBA 4KT0J 5CCGD 3BCCD 3MHVA 3M91A 3NMDA 1QEXA 1YTZT 3WUVA 1KQGB 5KAIE 4EYYQ 2KLVA 1OWAA 3H1KD 2Y9YA 1LWUA 1HJ0A 2FXOA 3GW6A 3CCSP 1L4AC 2WSFJ 2BEQD 2KK7A 2W8ZA 1FZFA 1BE3E 2JHKF 2FYUD 4N78E 3RBZA 2J5ZA 1RF1B 2XNXC 1FICA 3H1LG 4IFDK 1YTZI 1JY3N 2OYIB 5BU5A 3QWOC 4WY4A 2WPRA 1PV3A 5KJ7D 4AQRD 2H43A 3A5TA 4N3YB 5CHXA 1FZGA 1EZVI 2KI7B 2WITA 2QG4A 4TLFA 4KHXA 1S3JA 2K9JB 1SLQA 5CCHC 2Z5IA 5TISH 1LTIC 5AW3B 3K5BA 4PD4I 1RQUA 1FZDA 3AE9C 1JY2N 1L0LD 2M5AB 4YPCA 1N86A 1SFCB 1VQLP 4Y99B 4ASWA 1NTKE 2Q5UA 4Z1MH 1VQ9P 1NH4A 1NTMD 1YITP 3B5NB 1VF5D 2KXPB 3IR9A 1IFIA 2MJZA 2YIUB 2P58A 4GT1A 3HD7C 1LTTC 1NTKG 1Q90D 2V7QJ 1SQBE 2XV5A 1YJ9P 3AECC 2HLOC 2V4HA 4IFMA 2H8PD 1IZNB 1S1CX 3L75J 4W7ZA 3RK3E 2OYOA 3P8CD 3VP8A 1EDIA 1VQ5P 1L0ND 1DEEG 5AW9B 3H1KJ 3Q2YA 1Y8AA 3L70E 1URQB 1M7LA 1YQ3C 3OA7A 2N1TD 1KQFB 1KFNA 2K1AA 2E74D 2WSEJ 1M1JB 3MD0A 5KLVJ 3CI9A 3HE5B 1N73B 3L70G 4L75A 2KLUA 3AEAC 1QL2A 1IK9A 1S5LX 1IFMA 4W7YA 5GTIH 2WSCJ 4ZFGA 3V4QA 3MUDA 4PD4H 3RL0C 2QJYB 4H44D 2WSFH 1EQ7A 2K9JA 2OARA 1NVOA 4JBZA 4U7JA 1E5WA 1LP1A 3CWBD 4D6TJ 1JY3P 1OX3A 1U7MA 5B66E 1SS1A 1D7MA 1NYHA 1KYOH 1DIPA 2M5AA 2JHMF 3L74D 4LLHA 1SFCA 2WZ7A 2FYNC 3V2QA 4IFFA 1FC2C 3AE2C 2HPCB 1X0TA 1LTBC 3I56P 2BCCJ 3B5NA 1DEBA 1LT9C 3CMAP 1AVOA 3BASA 3A2AA 1ZV8A 1JCDA 1KORA 1JY2P 2J61B 3L71J 2LKMA 1NTZJ 3H1IE 4M7HA 1PFIA 5GTIE 2JWDA 3H1HD 1N7SB 1LNQA 1FOSF 2B87B 3AE7C 2FXPA 2QRXA 2Q3EA 5AW0B 1OXZA 5AVWB 2I8DA 1L0NJ 1URQA 1JB0J 1NU1D 2J58A 1PP9D 1T3JA 2J1GA 3IFMA 1YBKA 1BDCA 1KYOE 3HE5A 2W6AA 3BVHC 1MFZA 2XNXA 2A45G 1S9KE 1QGKB 2RH0A 3U1CA 1J1DC 1VL2A 1BGYE 2WMMA 1K04A 4WWIA 1S72P 4LC1A 1NKNA 1JMMA 3QH9A 3B71A 3AEEC 3KHUA 1BGYG 1YIJP 1FIBA 4OWFA 2WSCH 1EDLA 2HPCA 2R5DA 2FFDB 2N9BA 4PV1B 3CCUP 2XDJA 5BVZA 1H88A 1LTJB 2O01J 1HGVA 1SQXD 2AEFA 2R3SA 3L73E 4XA4A 3L4FA 1LWUC 1FJPA 2M3EA 2J61A 3VTPC 3GF3A 3VYIA 2IZ1A 2CPSA 1FZFC 1GK6A 1N7SA 2B87A 1BCCE 3H1HJ 2J3FA 2MKVA 3L73G 1PGPA 1IFJA 3V2NA 1NJIQ 1VQNP 1NU1J 2IBZD 3OW2O 1PIXA 1VF5B 2QJKC 3TGUE 4WY4C 1W2EA 3H1LJ 1ZOYC 4K35A 1BCCG 2JWAA 2YO3A 2O1JA 3LW5H 2PGDA 5C39A 5CCGA 2H43C 4IL6H 2C0WA 2KS1B 1FZGC 3CC4P 1SQQD 1EXIA 2JHIF 3I5CA 5AW5B 4ZMDA 3TGUG 2E76D 3P32A 2J64A 3R2PA 1GW3A 1SQQK 4XFJA 2Q7CA 4BWNA 2PP6A 1FZEB 2N1TB 1N86C 3Q3DA 2O1KA 1BSNA 5CJ4A 1VPCA 3FWLA 4MN4C 1KN7A 5KJ7A 1RE3B 2Q9IA 2KNCB 2GUVA 1SQPK 1SQVD 3PLNA 2FFDA 1HF9A 1FZCA 2RKLA 1NTKJ 1GL2D 1LTJA 4B86A 5KKZB 2J0GA 2LXCB 3ABVC 3CX5D 1A02J 4R4LA 1QVGO 3IAOA 1Q82Q 2WVRA 1PPJD 2R5BA 2E5YA 4HKZH 4L74A 4EOTA 2OTJP 5AW4B 4JYOX 1VQ7P 1LGHB 2OGUA 2JR8A 3L70J 2O01H 2IPPA 1FZAA 1KZUB 3RK3C 3MUDC 2ZFCA 1UIXA 1P84E 3PHLA 2KS1A 2Z5HA 3TF5A 1QLED 3AEBC 3C8VA 1WMKA 5H2FE 4GOEA 4RESB 2R3CA 4PJ0E 1YHQP 2YO2A 1YQ4C 2AXTE 1KB9D 2IZ0A 4JPZB 1ZRTE 1FZEA 2N1TA 2J3OA 1NAYA 1FZBB 1SFCC 1H8AA 5B5EE 2YXQB 3E1IA 3L74E 2YKQA 1FIDA 1MV8A 3B5NC 1M1KQ 4GDOA 3TYYA 5TJHA 2YIUC 4ZKPA 1KD1Q 2E75D 1RE3A 2KNCA 4YTPC 1SQVJ 3L75D 1AVYA 3KYQA 2QEXP 1JC9A 4RO0A 5AW8B 3CXHE 3SWYA 3D70A 1GTWA 4HYTB 1URQC 2AEJA 2P7JA 5KLVD 5APVA 1Y47A 1PP9E 1GU4A 3H6PA 1OVVA 2H88C 4WB4A 2FYUK 3FX0A 3SFDC 5KAFH 3VMXA 1ZR4A 1J2JB 1BE3G 1HUCA 4W80A 2QIWA 1RY3A 2FBWC 3TK1A 3P8MC 5KLIB 4PV1D 2WPVB 4D6TD 2HODA 1H0TB 5AW6B 1ZLLA 4U3FE 3CX5I 3FGAD 2WSSH 2HPCC 2GY7A 3GMAA 4UB8H 2JP3A 4KJMA 1L0LK 2FIBA 3A0BH 2BCCD 5E79H 5APSA 3PRJA 4U3FG 3L36A 2XU6A 4GKGA 1HH0A 2E76B 3L71D 4BRYB 3OJAB 1NTZD 3G3ZA 1NTMK 3O8ZA 3RK2D 3LIDA 1T2KD 4NPFX 1N7SC 4C46A 3MTUE 1NTZK 1W5CE 1KILD 1IO4A 1GK4A 2IFNA 5DJUB 1SQBG 5TISE 3L73J 1KB9I 1L0NK 4M3LA 5L8RJ 4NYTA 1K8AQ 3CLQA 3JCUH 5CCGC 4XE5B 1RF1A 2E5TA 1R5LA 1DD4A 2IBZE 1BCCJ 2OYIA 1L4AB 1OW7A 2NPSD 1XTCC 1GL2B 2NRGA 2DW3A 1Q2NA 3KPEA 3TGUJ 2B89A 3CX5H 3Q5PA 1SQQE 5APXA 1GD2E 3H1JE 2ZXXA 4M7FA 2KB7P 1JY3O 2M3BA 3B4SA 1GMJA 1EC5A 3GF7A 2P2UA 2RMZA 4R9TA 3H1JG 5KJ7C 3M0DA 2IYPA 2Q9IC 1PZQA 1PL5A 1SQPE 5CBNA 3CL3D 2FFDC 3FXDA 1FZCC 2KOGA 1VQ8P 1LTJC 1JUNA 1EZVE 3L72E 1JY2O 4BRYA 1JTHB 1DD3A 1U57A 2AEMA 5APWA 1SQPG 1KB9H 3L37A 1LTSC 2R44A 4PD4E 4AYCA 3G71P 1EZVG 3L72G 4I2LC 3HD7B 5DJTB 3U59A 3H1IG 1VF5C 2HLOB 3H1LD 1PPJE 3SSUA 5GTHH 1M1JA 1FZAC 1VQ6P 1NU1K 2E75B 5AVRB 1BE3D 2A06E 4H0LD 1M57D 2V7QH 4N78D 1N73A 1J1EC 2YKPA 1CW5A 1ZW0A 1FBMA 1GL2A 5EFWB 1OMIA 1S5LH 4ZKUA 3GHGB 2A06G 2Q3IA 2J0YA 3AE5C 1FZEC 2N1TC 2KUBA 2ZVOB 2J0HA 2WSEH 2E74C 3AEDC 3AE6C 2WT7B 2E42A 1YI2P 2Z4EB 3KDPB 3VN0A 3E1IC 2OYHB 3AE8C 1OZHA 2I1KA 5CMZA 3AE4C 3ZDMA 3USSA 1RE3C 1OIPA 1GDTA 1FDIA 2CK3H 4H44C 1T3UA 4RKUJ 2P1JA 1NTKD 3MIWA 1IJDB 1OW6A 2P10A 2W6BA 3HUSB 2WWWA 1BDDA 1LTGC 1VQKP 1CI6B 2N9YB 3R4YA 4OH8B 3BCCE 1NTKK 2LR2A 2ZT9D 1JTHA 3G6EP 2O01N 3L75E 5AVZB 2K9YA 1SQXK 3H1KE 2JDIH 2D2CD 2RN0A 1EDJA 3U1AA 4OGQD 1USDA 1GW4A 3BCCG 2YMYA 3L70D 2FYUE 3NTNA 3H1KG 1IC2A 3AEFC 1FAVA 3BRTB 2Y0DA 3RK2B 1W2BO 1BE3J 5AVXB 3S4RA 2QM8A 1NO4A 4CPGA 2R32A 3BRVB 3PTZA 2FYUG 5AVSB 3H32B 1SP4A 3VMAA 2HODC 4C7NB 1KILB 4H13D 3GHGA 3M0AA 5AW1B 1AQTA 3BVHB 1OVRA 4D6TE 3V2RA 1RF0B 2E43A 3M06A 2M0BA 2WT7A 3WUTA 1FOSE 1X79B 2Z4EA 1L0LE 2HFED 2OYHA 2GM4A 3EFGA 1KTMA 2NPSB 3GLMA 1K9MQ 4U3FJ 3FWNA 1NTME 2FY8A 3MGNA 1L0LG 3EQ2A 1JNMA 1N2DC 1L4AD 1EXJA 3HUSA 4IL6E 1SQVK 1CI6A 2UWJE 3KZIH 3AEGC 2OTKE 2L5GB 3MZWB 1NTMG 5KTBA 1WT6A 3P8CE 1JMBA 2QJPB 2C9LY 1L0NE 4DOJA 1T8ZA 2WTYA 1SQBJ 1GZLA 1RF1C 1K73Q 3CCVP 4UB6H 3RGUA 4JZCA 5APQA 2P67A 2OYIC 2W27A 4JQ0D 1Z3UA 4GODA 1L0NG 2G8YA 3TDKA 2I1JA 5CCHD 1NOHA 3VOPA 2FYZA 1A02F 4HH2A 3H32A 1H89A 3TSIA 1S9KD 4GIFA 3WU2H 1KILA 1FE6A 5KAIH 3H25A 2GA1A 5AVQB 1FDOA 4Y99C 2BEZF 3CWBE 1BGYD 3M0DC 4DT0A 1RF0A 1VDFA 4H0LB 2K37A 2HR3A 3HD7D 3IF4A 1LT1A 3PH0A 3GG2A 2NPSA 2QVAA 1FDMA 1UIIA 4I7ZB 1YJNP 2E76C 2FXMA 4OVNF 4UB6E 3CWBG 1EDKA 2ZAEB 5AW2B 3N4XA 3L74G 1YYCA 3S1KA 1NGMB 1OW8A 1LJ2A 5K5GB 2IYOA 4JF7A 2W83C 1MZ9A 3L73D 3H1HE 3FIBA 1AFOA 3L72J 3CCEP 3WU2E 3ITKA 1LTAC 2JHLF 1M1JC 1FS0E 2KZIA 3H1IJ 1FJKA 1NU1E 1VQOP 1BCCD 1N73C 2OQQA 1JOCA 3H1LE 3PJSK 3RL0D 5KLVK 3V4WA 3H1HG 2C9NY 2H89C 1GL2C 1R5SA 4JYCA 1QVFO 3S9OA 2JEEA 3TGUD 2ZT9B 3V6IA 1NU1G 2QJYC 1PP9G 1Q86Q 3HE4B 2D2CB 4YXDC 3L35A 2Y0CA 2YKOA 4OGQB 1GU5A 3E7KA 3RK3B 1CZQA 1AV1A 5APUA 2GUSA 2ZYDA 2JJLA 1RE4B 2WPSA 3RL0g 1FZBA 2HG5D 1USEA 1HWTC 3VMYA 3FXEA 3A7OA 2AXCA 1N8RQ 4WBAA 3A3YB 1LP1B 1BGYJ 1ZP0C 4L76A 1NAFA 2J60A 3G9RA 4H13B 2A45I 2JKVA 1JCCA 1HVVA 3KQGA 5KAFE 4Y28J 5CJ0A 1YJWP 3E1RA 1SQXE 1KYOI 2K3RA 3MP7B 3UIAA 1JEKA 1SVFA 4EI2A 4LGDE 1Y9BA 3BCCJ 4EDFA 5B66H 2O3JA 3C9IA 3I55P 1SQXG 2E75C 3M9HA 3CD6P 4IOIH 3T97B 1M56D 3SWFA 1Z3SA 1AQ5A 1DX7A 2XKMA 1KMIZ 4UB8E 3Q5SA 3A0BE 3GHGC 5E79E 2W90A 2ZJSE 2JO1A 2YXRB 3W67A 2FYUJ 3F89A 2H7HA 1Z56A 4YXWH 2KSJA 3EWKA 2IBZG 4AUWA 1P84D 2XNXB 1PGQA 3HE4A 3PP5A 1Q7YQ 1OVUA 1ZMEC 2Z4EC 1H0TA 2KSEA 2POHA 2OYHC 4DZOA 1RE4A 1WRGA 1SQQG 1PGJA 2QM7A 4BXLA 2A45H 4TT3H 3V2PA 2PFXA 4RJTA 2YMKA 1ZRTD 3EFFK 1MFTA 2J3GA 4NPDA 2KYVA 2NZ2A 4PV1C 2Q1KA 3HTKB 3M9BA 3JCUE 3HUSC 1TU3F 1L0LJ 1MUUA 1SQVE 1G2CB 1L2PA 3CPWO 2ITAA 2CPBA 1HGZA 3B8EB 4O9BA 1QX8A 3Q5RA 3RBXA 1G1JA 1X8YA 1U7JA 1NTMJ 1NKZB 4WY4D 4R4MA 2M8RA 1RQVA 3CX5E 3CXHD 1R8EA 1SQVG 3LW5J 2HYNA 1KC8Q 2WNPF 3KXDA 5AVTB 4GOFA 3T97A 3RK2C 3NFQA 1T2KC 1JO5A 3CC2P 1L4AA 3H32C 5AVUB 1PPJG 1KILC 4ASVA 3BATA 4IL6X 5CBOA 3CCRP 4EIJA 1IFNA 1KV4A 1G1IA 1MKMA 1RH5B 3AE1C 1RF0C 3OAKA 1ZR2A 1KB9E 3D6ZA 2J3UA 2Y0EA 2BASA 3RL0B 1NHLA 2NPSC 4U3FD 3CCLP 4N6JA 5CCHA 1IFDA 4JYBA 3SFEC 3WUUA 3TNUB 3N7NA 3LIEA 3W68A 1FU1A 3CWBJ 4HB1A 3HTKA 5GTHE 3VP9A 3II6A 4L73A 1VQPP 3IN6A 5KKZC 4A7PA 2FYNB 3L74J 1G2CA 4C7RA 2QSIA 2Q9IB 3Q1MA 2B88A 3JSVC 3O6QB 3NXSA 1S5LE 2QJPC 1FZCB 2L91A 1SQBD 1P84I 4NPEA 1XTGB 1LT9B 5AVVB 3A0HH 3RK3D 4R9JA 3HD7A 1SQBK 3L75G 5KLVE 2HLOA 3CCMP 1S4XA 2YNYA 2KIKA 1PGOA 2KP8A 1DH3A 2B9BA 3AE3C 1KQSO 3D71A 1VQ4P 4ZNCA 2Y9ZA 2G3AA 5KLVG 1PP9J 1X9VA 2QA4P 5BU8B 3M9QA 2ZYAA 1SFCD 4WVZA 1FZAB 1JM0A 4QMAA 3VMZA 2WQYC 4DCKA 1HBWA 1KQLA 1J1EB 2OTLP 3HRNA 1FZBC 2ZXEB 3CCJP 3WMM0 3B5ND 1NWQA 2PRRA 1S2EA 4H0LC 3H1JD 2IDBA 4I6MC
chains in the Genus database with same CATH topology
2IFNA 3HE5A 1J1DB 2W6AA 3BVHC 1MFZA 2XNXA 3N4XA 2A45G 1S9KE 2D39A 5APTA 1YYCA 1L0NK 4M3LA 1QL1A 4NYTA 4I1LA 3CLQA 5CCGC 4XE5B 1RF1A 4JF7A 3U1CA 1J1DC 1MZ9A 3TNUA 3FIBA 1URQD 3E1IB 1AFOA 2JHHC 2OYIA 1L4AB 1LTAC 1HTLC 2NPSD 2JHLF 2VRSA 4EPUA 1M1JC 1XTCC 1GL2B 1FJKA 4LC1A 1NKNA 1JMMA 1N73C 1JOCA 3KPEA 3RL0D 5KLVK 3V4WA 5APXA 1GD2E 2C9NY 1GL2C 1FIBA 2XZRA 2IX7C 4M7FA 2WSCH 2KB7P 1LT9A 4JYCA 2HPCA 2JEEA 2R5DA 1JY3O 2M3BA 1LWUB 2FFDB 2N9BA 2P2UA 3HE4B 2XDJA 1FZFB 4R9TA 5BVZA 5KJ7C 1H88A 3L35A 1KFMA 1LTJB 2YKOA 3M0DA 1HGVA 4XA4A 1GU5A 2Q9IC 2C0XA 3L4FA 1LWUC 3RK3B 1FJPA 1CZQA 1N7LA 5APUA 2GUSA 5APYA 1HJBA 2J61A 3VTPC 2JJLA 3CL3D 2FKWB 2FFDC 3VYIA 1FZCC 1RE4B 2WPSA 2CPSA 2KOGA 1FZFC 1GK6A 1FZBA 1N7SA 2HG5D 3V5BA 1LTJC 1HWTC 3VMYA 4C7NA 4WY4B 1JUNA 2J3FA 3A7OA 4WBAA 3A3YB 1JY2O 1JTHB 1IFJA 2H43B 1NAFA 2J60A 5AW7B 3V2NA 1RE4C 1FZGB 5APWA 3BVHA 3L37A 2WPQA 1LTSC 4WY4C 4AYCA 1W2EA 2A45I 2HODB 2YO3A 2O1JA 3LW5H 1JCCA 1HVVA 5CCGA 2H43C 4I2LC 2C0WA 3HD7B 3KQGA 1FZGC 2J2PA 5CJ0A 3U59A 3P7KA 2J59M 2HLOB 1N86B 1N7SD 2PAJA 2JHIF 1ZN5A 3I5CA 5AW5B 1FZAC 1M1JA 2J3FD 1NU1K 5AVRB 3UIAA 3P32A 4N78D 2J64A 1N73A 1J1EC 1SVFA 3R2PA 1GW3A 1SQQK 2Q7CA 2PP6A 2YKPA 4LGDE 5AVYB 1FZEB 2N1TB 1N86C 1CW5A 1FBMA 3C9IA 1CSBA 2IFMA 1GL2A 2O1KA 3M9HA 5CJ4A 4ZKUA 3GHGB 1VPCA 5CCGD 3SWFA 2Q3IA 1Z3SA 2J0YA 1AQ5A 1DX7A 2XKMA 3M91A 1FZEC 3NMDA 2N1TC 1YTZT 2J0HA 2WSEH 3GHGC 2KLVA 1OWAA 5KJ7A 2WT7B 2E42A 1RE3B 2Q9IA 2GUVA 2Z4EB 1LWUA 2H7HA 1SQPK 1Z56A 3KDPB 3VN0A 3E1IC 2KSJA 2OYHB 4AUWA 2FFDA 1L4AC 1FZCA 2I1KA 5CMZA 2XNXB 3HE4A 1FZFA 2JHKF 3PP5A 1GL2D 4N78E 1LTJA 4B86A 1RE3C 1GDTA 2Z4EC 2J5ZA 2J0GA 1RF1B 2POHA 2OYHC 1T3UA 2P1JA 4DZOA 2XNXC 1FICA 1RE4A 3MIWA 1A02J 1WRGA 4IFDK 1IJDB 1YTZI 1JY3N 2QM7A 2W6BA 2OYIB 2A45H 5BU5A 3HUSB 2WWWA 3V2PA 4WY4A 1LTGC 1CI6B 2WPRA 5KJ7D 2R5BA 4OH8B 1NTKK 2J3GA 1JTHA 2KYVA 4AQRD 2H43A 5AVZB 4EOTA 3A5TA 4N3YB 5CHXA 1FZGA 5AW4B 2WITA 3HTKB 4JYOX 3M9BA 1SQXK 1LGHB 4KHXA 3HUSC 2O01H 3U1AA 2IPPA 1SLQA 5CCHC 2Z5IA 1MUUA 1FZAA 1KZUB 3RK3C 1G2CB 1LTIC 2ZFCA 5AW3B 1GW4A 2CPBA 2Z5HA 1HGZA 1FZDA 3B8EB 4O9BA 2YMYA 1JY2N 1G1JA 1X8YA 3NTNA 1N86A 1NKZB 1SFCB 4WY4D 4Y99B 1IC2A 2M8RA 4RESB 2R3CA 1FAVA 2Q5UA 3BRTB 3RK2B 2YO2A 5AVXB 2HYNA 2QM8A 1NO4A 1NH4A 2R32A 1FZEA 2N1TA 3BRVB 2J3OA 3B5NB 2WNPF 5AVSB 3H32B 1FZBB 1SFCC 1SP4A 2HODC 3IR9A 1H8AA 4C7NB 1KILB 1IFIA 2MJZA 3GHGA 5AVTB 3T97A 4GT1A 3RK2C 3NFQA 3HD7C 3M0AA 1LTTC 5AW1B 1T2KC 3E1IA 2XV5A 1JO5A 2HLOC 3BVHB 2YKQA 1FIDA 1L4AA 4IFMA 1MV8A 2H8PD 3B5NC 3H32C 5AVUB 3V2RA 3TYYA 1KILC 4W7ZA 3P8CD 1RF0B 3VP8A 4ZKPA 2E43A 3M06A 2WT7A 3BATA 5AW9B 1RE3A 1FOSE 1X79B 2Z4EA 4EIJA 1IFNA 2HFED 1URQB 1M7LA 2OYHA 1G1IA 2GM4A 3EFGA 3OA7A 3KYQA 1JC9A 2NPSB 2N1TD 1KFNA 5AW8B 1RF0C 1M1JB 3OAKA 3SWYA 3MD0A 1ZR2A 2J3UA 1GTWA 4HYTB 1URQC 3CI9A 3HE5B 2BASA 3RL0B 3MGNA 1N73B 3EQ2A 1JNMA 1NHLA 1N2DC 2NPSC 1L4AD 2P7JA 1QL2A 1IK9A 3HUSA 5APVA 1IFMA 4W7YA 1SQVK 1CI6A 4ZFGA 4N6JA 5CCHA 1IFDA 4JYBA 3V4QA 3MUDA 1GU4A 2L5GB 3RL0C 3TNUB 3N7NA 3H6PA 3LIEA 5KTBA 1FU1A 2WSFH 1EQ7A 3HTKA 4WB4A 2FYUK 1WT6A 3VP9A 3P8CE 3II6A 2C9LY 4DOJA 3VMXA 1ZR4A 1J2JB 2OARA 1HUCA 1T8ZA 2WTYA 1E5WA 1G2CA 1GZLA 4W80A 1RF1C 4C7RA 2Q9IB 1JY3P 1RY3A 3TK1A 4JZCA 5APQA 3NXSA 2P67A 3P8MC 2OYIC 1FZCB 2JHMF 2W27A 4LLHA 1XTGB 1Z3UA 1LT9B 1SFCA 2WZ7A 3V2QA 5AVVB 4IFFA 2HODA 2HPCB 2I1JA 5CCHD 1NOHA 3RK3D 4R9JA 3HD7A 1SQBK 1LTBC 5AW6B 1ZLLA 3VOPA 2FYZA 1A02F 2HLOA 3B5NA 4HH2A 3H32A 1H89A 1DEBA 1LT9C 3TSIA 3BASA 1S9KD 4GIFA 3A2AA 2HPCC 1KILA 1ZV8A 1JCDA 2YNYA 2GY7A 2KP8A 1DH3A 1L0LK 1JY2P 2FIBA 2J61B 2LKMA 4M7HA 5APSA 1PFIA 5AVQB 1N7SB 1FOSF 1X9VA 3L36A 5BU8B 2XU6A 4Y99C 4GKGA 1HH0A 3M9QA 3M0DC 1SFCD 1RF0A 1VDFA 1FZAB 5AW0B 3OJAB 1OXZA 3G3ZA 1NTMK 5AVWB 3VMZA 3O8ZA 3RK2D 1URQA 3HD7D 3LIDA 1HBWA 2J58A 1KQLA 1J1EB 1T3JA 1T2KD 3HRNA 1N7SC 1FZBC 2J1GA 2NPSA 2ZXEB 4C46A 3WMM0 1FDMA 3B5ND 3MTUE 3IFMA 1NTZK 1NWQA 2FXMA 1KILD 4I6MC 1IO4A 1GK4A 5AW2B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HUS A;  2H43 A;  3BVH C;  1W2E A;  2A45 I;  1FZG A;  4ZFG A;  2XNX A;  2HOD B;  2A45 G;  4JYO X;  2D39 A;  3HUS C;  2H43 C;  4NYT A;  1FZG C;  2J2P A;  1FZA A;  2HLO B;  1RF1 A;  1N86 B;  2JHI F;  3FIB A;  1FZA C;  1M1J A;  1FZD A;  3E1I B;  2J3F D;  1JY2 N;  1RF1 C;  2JHH C;  2OYI A;  2Q9I B;  1N86 A;  2J64 A;  1JY3 P;  2JHL F;  4EPU A;  1N73 A;  1M1J C;  4JZC A;  2OYI C;  1FZC B;  1FZE B;  1N86 C;  2JHM F;  1N73 C;  1Z3U A;  1LT9 B;  2HOD A;  3GHG B;  2HPC B;  1FZE A;  2J3O A;  2WNP F;  1FIB A;  3H32 B;  1FZB B;  4R9J A;  1Z3S A;  4M7F A;  2J0Y A;  2HOD C;  1LT9 A;  3GHG A;  1FZE C;  2HPC A;  1JY3 O;  2HLO A;  2J0H A;  1LWU B;  3H32 A;  1LT9 C;  3E1I A;  3GHG C;  2HPC C;  2FFD B;  2GY7 A;  2HLO C;  3BVH B;  1FID A;  1RE3 B;  2Q9I A;  3H32 C;  1JY2 P;  2FIB A;  2Z4E B;  1LWU A;  1FZF B;  2J61 B;  3E1I C;  4R9T A;  2OYH B;  1LTJ B;  1RF0 B;  2FFD A;  4M7H A;  1FZC A;  2XNX B;  2Q9I C;  1LWU C;  1RE3 A;  2Z4E A;  1FZF A;  2JHK F;  2J61 A;  2OYH A;  2FFD C;  1LTJ A;  1RF0 A;  1FZC C;  1RE4 B;  1RE3 C;  1FZA B;  2Z4E C;  1JC9 A;  2J5Z A;  2J0G A;  1FZF C;  1FZB A;  1RF1 B;  2OYH C;  1T3U A;  1LTJ C;  1RF0 C;  2J3F A;  2XNX C;  1M1J B;  1FIC A;  1RE4 A;  1JY2 O;  1JY3 N;  1FZB C;  2J1G A;  2J3U A;  2OYI B;  2A45 H;  3HUS B;  2H43 B;  2J60 A;  1N73 B;  1RE4 C;  1FZG B;  3BVH A;  2J3G A; 
#chains in the Genus database with same CATH topology
 3CXH I;  1J1D B;  2D39 A;  5APT A;  3A0H E;  4I7Z C;  1QL1 A;  4D6T G;  4I1L A;  1AJY A;  2E74 B;  2BCC E;  1Q81 Q;  3TNU A;  1URQ D;  3E1I B;  4HJG H;  1X22 A;  1OFC X;  2JHH C;  1P84 H;  1SQP D;  1HTL C;  3L71 E;  3CME P;  4EPU A;  2VRS A;  2KZJ A;  1NTZ E;  1ZXG A;  2BCC G;  1EZV D;  3L72 D;  5H2F H;  3O6Q A;  2ZYG A;  4H44 B;  1IFP A;  4PJ0 H;  3SWK A;  1KIL E;  3H1I D;  3JC2 2;  2XZR A;  2AXT H;  2IX7 C;  2ZVN B;  1LT9 A;  3L71 G;  5M1B A;  1NTZ G;  4PD4 D;  1LWU B;  1SQX J;  5B5E H;  1M8O B;  2SPZ A;  1FZF B;  1KFM A;  2ZT9 C;  2C0X A;  1E79 H;  4K3A A;  1N7L A;  1HJB A;  5APY A;  1VQM P;  5KLI C;  2FKW B;  2A06 D;  1KYO D;  2D2C C;  3D6Y A;  1AA0 A;  3V5B A;  1M90 Q;  2QJK B;  4OGQ C;  4WY4 B;  4C7N A;  3CC7 P;  3CCQ P;  4DJG A;  3CXH H;  2H43 B;  5AW7 B;  1RE4 C;  1FZG B;  3BVH A;  1RHZ B;  3KZI E;  2WPQ A;  2XND H;  2HOD B;  1SQQ J;  3C1L A;  3H1J J;  1BSH A;  2J2P A;  1IK7 A;  1T6A A;  1K05 A;  3P7K A;  2J59 M;  1N86 B;  1N7S D;  2QE7 H;  4H13 C;  2PAJ A;  1ZN5 A;  2J3F D;  2J5U A;  5AVY B;  2Q6Q A;  1CSB A;  2IFM A;  1SQP J;  2W6J H;  2IBZ I;  3G4S P;  3F5H A;  2K88 A;  2LXB A;  4KT0 J;  5CCG D;  3BCC D;  3MHV A;  3M91 A;  3NMD A;  1QEX A;  1YTZ T;  3WUV A;  1KQG B;  5KAI E;  4EYY Q;  2KLV A;  1OWA A;  3H1K D;  2Y9Y A;  1LWU A;  1HJ0 A;  2FXO A;  3GW6 A;  3CCS P;  1L4A C;  2WSF J;  2BEQ D;  2KK7 A;  2W8Z A;  1FZF A;  1BE3 E;  2JHK F;  2FYU D;  4N78 E;  3RBZ A;  2J5Z A;  1RF1 B;  2XNX C;  1FIC A;  3H1L G;  4IFD K;  1YTZ I;  1JY3 N;  2OYI B;  5BU5 A;  3QWO C;  4WY4 A;  2WPR A;  1PV3 A;  5KJ7 D;  4AQR D;  2H43 A;  3A5T A;  4N3Y B;  5CHX A;  1FZG A;  1EZV I;  2KI7 B;  2WIT A;  2QG4 A;  4TLF A;  4KHX A;  1S3J A;  2K9J B;  1SLQ A;  5CCH C;  2Z5I A;  5TIS H;  1LTI C;  5AW3 B;  3K5B A;  4PD4 I;  1RQU A;  1FZD A;  3AE9 C;  1JY2 N;  1L0L D;  2M5A B;  4YPC A;  1N86 A;  1SFC B;  1VQL P;  4Y99 B;  4ASW A;  1NTK E;  2Q5U A;  4Z1M H;  1VQ9 P;  1NH4 A;  1NTM D;  1YIT P;  3B5N B;  1VF5 D;  2KXP B;  3IR9 A;  1IFI A;  2MJZ A;  2YIU B;  2P58 A;  4GT1 A;  3HD7 C;  1LTT C;  1NTK G;  1Q90 D;  2V7Q J;  1SQB E;  2XV5 A;  1YJ9 P;  3AEC C;  2HLO C;  2V4H A;  4IFM A;  2H8P D;  1IZN B;  1S1C X;  3L75 J;  4W7Z A;  3RK3 E;  2OYO A;  3P8C D;  3VP8 A;  1EDI A;  1VQ5 P;  1L0N D;  1DEE G;  5AW9 B;  3H1K J;  3Q2Y A;  1Y8A A;  3L70 E;  1URQ B;  1M7L A;  1YQ3 C;  3OA7 A;  2N1T D;  1KQF B;  1KFN A;  2K1A A;  2E74 D;  2WSE J;  1M1J B;  3MD0 A;  5KLV J;  3CI9 A;  3HE5 B;  1N73 B;  3L70 G;  4L75 A;  2KLU A;  3AEA C;  1QL2 A;  1IK9 A;  1S5L X;  1IFM A;  4W7Y A;  5GTI H;  2WSC J;  4ZFG A;  3V4Q A;  3MUD A;  4PD4 H;  3RL0 C;  2QJY B;  4H44 D;  2WSF H;  1EQ7 A;  2K9J A;  2OAR A;  1NVO A;  4JBZ A;  4U7J A;  1E5W A;  1LP1 A;  3CWB D;  4D6T J;  1JY3 P;  1OX3 A;  1U7M A;  5B66 E;  1SS1 A;  1D7M A;  1NYH A;  1KYO H;  1DIP A;  2M5A A;  2JHM F;  3L74 D;  4LLH A;  1SFC A;  2WZ7 A;  2FYN C;  3V2Q A;  4IFF A;  1FC2 C;  3AE2 C;  2HPC B;  1X0T A;  1LTB C;  3I56 P;  2BCC J;  3B5N A;  1DEB A;  1LT9 C;  3CMA P;  1AVO A;  3BAS A;  3A2A A;  1ZV8 A;  1JCD A;  1KOR A;  1JY2 P;  2J61 B;  3L71 J;  2LKM A;  1NTZ J;  3H1I E;  4M7H A;  1PFI A;  5GTI E;  2JWD A;  3H1H D;  1N7S B;  1LNQ A;  1FOS F;  2B87 B;  3AE7 C;  2FXP A;  2QRX A;  2Q3E A;  5AW0 B;  1OXZ A;  5AVW B;  2I8D A;  1L0N J;  1URQ A;  1JB0 J;  1NU1 D;  2J58 A;  1PP9 D;  1T3J A;  2J1G A;  3IFM A;  1YBK A;  1BDC A;  1KYO E;  3HE5 A;  2W6A A;  3BVH C;  1MFZ A;  2XNX A;  2A45 G;  1S9K E;  1QGK B;  2RH0 A;  3U1C A;  1J1D C;  1VL2 A;  1BGY E;  2WMM A;  1K04 A;  4WWI A;  1S72 P;  4LC1 A;  1NKN A;  1JMM A;  3QH9 A;  3B71 A;  3AEE C;  3KHU A;  1BGY G;  1YIJ P;  1FIB A;  4OWF A;  2WSC H;  1EDL A;  2HPC A;  2R5D A;  2FFD B;  2N9B A;  4PV1 B;  3CCU P;  2XDJ A;  5BVZ A;  1H88 A;  1LTJ B;  2O01 J;  1HGV A;  1SQX D;  2AEF A;  2R3S A;  3L73 E;  4XA4 A;  3L4F A;  1LWU C;  1FJP A;  2M3E A;  2J61 A;  3VTP C;  3GF3 A;  3VYI A;  2IZ1 A;  2CPS A;  1FZF C;  1GK6 A;  1N7S A;  2B87 A;  1BCC E;  3H1H J;  2J3F A;  2MKV A;  3L73 G;  1PGP A;  1IFJ A;  3V2N A;  1NJI Q;  1VQN P;  1NU1 J;  2IBZ D;  3OW2 O;  1PIX A;  1VF5 B;  2QJK C;  3TGU E;  4WY4 C;  1W2E A;  3H1L J;  1ZOY C;  4K35 A;  1BCC G;  2JWA A;  2YO3 A;  2O1J A;  3LW5 H;  2PGD A;  5C39 A;  5CCG A;  2H43 C;  4IL6 H;  2C0W A;  2KS1 B;  1FZG C;  3CC4 P;  1SQQ D;  1EXI A;  2JHI F;  3I5C A;  5AW5 B;  4ZMD A;  3TGU G;  2E76 D;  3P32 A;  2J64 A;  3R2P A;  1GW3 A;  1SQQ K;  4XFJ A;  2Q7C A;  4BWN A;  2PP6 A;  1FZE B;  2N1T B;  1N86 C;  3Q3D A;  2O1K A;  1BSN A;  5CJ4 A;  1VPC A;  3FWL A;  4MN4 C;  1KN7 A;  5KJ7 A;  1RE3 B;  2Q9I A;  2KNC B;  2GUV A;  1SQP K;  1SQV D;  3PLN A;  2FFD A;  1HF9 A;  1FZC A;  2RKL A;  1NTK J;  1GL2 D;  1LTJ A;  4B86 A;  5KKZ B;  2J0G A;  2LXC B;  3ABV C;  3CX5 D;  1A02 J;  4R4L A;  1QVG O;  3IAO A;  1Q82 Q;  2WVR A;  1PPJ D;  2R5B A;  2E5Y A;  4HKZ H;  4L74 A;  4EOT A;  2OTJ P;  5AW4 B;  4JYO X;  1VQ7 P;  1LGH B;  2OGU A;  2JR8 A;  3L70 J;  2O01 H;  2IPP A;  1FZA A;  1KZU B;  3RK3 C;  3MUD C;  2ZFC A;  1UIX A;  1P84 E;  3PHL A;  2KS1 A;  2Z5H A;  3TF5 A;  1QLE D;  3AEB C;  3C8V A;  1WMK A;  5H2F E;  4GOE A;  4RES B;  2R3C A;  4PJ0 E;  1YHQ P;  2YO2 A;  1YQ4 C;  2AXT E;  1KB9 D;  2IZ0 A;  4JPZ B;  1ZRT E;  1FZE A;  2N1T A;  2J3O A;  1NAY A;  1FZB B;  1SFC C;  1H8A A;  5B5E E;  2YXQ B;  3E1I A;  3L74 E;  2YKQ A;  1FID A;  1MV8 A;  3B5N C;  1M1K Q;  4GDO A;  3TYY A;  5TJH A;  2YIU C;  4ZKP A;  1KD1 Q;  2E75 D;  1RE3 A;  2KNC A;  4YTP C;  1SQV J;  3L75 D;  1AVY A;  3KYQ A;  2QEX P;  1JC9 A;  4RO0 A;  5AW8 B;  3CXH E;  3SWY A;  3D70 A;  1GTW A;  4HYT B;  1URQ C;  2AEJ A;  2P7J A;  5KLV D;  5APV A;  1Y47 A;  1PP9 E;  1GU4 A;  3H6P A;  1OVV A;  2H88 C;  4WB4 A;  2FYU K;  3FX0 A;  3SFD C;  5KAF H;  3VMX A;  1ZR4 A;  1J2J B;  1BE3 G;  1HUC A;  4W80 A;  2QIW A;  1RY3 A;  2FBW C;  3TK1 A;  3P8M C;  5KLI B;  4PV1 D;  2WPV B;  4D6T D;  2HOD A;  1H0T B;  5AW6 B;  1ZLL A;  4U3F E;  3CX5 I;  3FGA D;  2WSS H;  2HPC C;  2GY7 A;  3GMA A;  4UB8 H;  2JP3 A;  4KJM A;  1L0L K;  2FIB A;  3A0B H;  2BCC D;  5E79 H;  5APS A;  3PRJ A;  4U3F G;  3L36 A;  2XU6 A;  4GKG A;  1HH0 A;  2E76 B;  3L71 D;  4BRY B;  3OJA B;  1NTZ D;  3G3Z A;  1NTM K;  3O8Z A;  3RK2 D;  3LID A;  1T2K D;  4NPF X;  1N7S C;  4C46 A;  3MTU E;  1NTZ K;  1W5C E;  1KIL D;  1IO4 A;  1GK4 A;  2IFN A;  5DJU B;  1SQB G;  5TIS E;  3L73 J;  1KB9 I;  1L0N K;  4M3L A;  5L8R J;  4NYT A;  1K8A Q;  3CLQ A;  3JCU H;  5CCG C;  4XE5 B;  1RF1 A;  2E5T A;  1R5L A;  1DD4 A;  2IBZ E;  1BCC J;  2OYI A;  1L4A B;  1OW7 A;  2NPS D;  1XTC C;  1GL2 B;  2NRG A;  2DW3 A;  1Q2N A;  3KPE A;  3TGU J;  2B89 A;  3CX5 H;  3Q5P A;  1SQQ E;  5APX A;  1GD2 E;  3H1J E;  2ZXX A;  4M7F A;  2KB7 P;  1JY3 O;  2M3B A;  3B4S A;  1GMJ A;  1EC5 A;  3GF7 A;  2P2U A;  2RMZ A;  4R9T A;  3H1J G;  5KJ7 C;  3M0D A;  2IYP A;  2Q9I C;  1PZQ A;  1PL5 A;  1SQP E;  5CBN A;  3CL3 D;  2FFD C;  3FXD A;  1FZC C;  2KOG A;  1VQ8 P;  1LTJ C;  1JUN A;  1EZV E;  3L72 E;  1JY2 O;  4BRY A;  1JTH B;  1DD3 A;  1U57 A;  2AEM A;  5APW A;  1SQP G;  1KB9 H;  3L37 A;  1LTS C;  2R44 A;  4PD4 E;  4AYC A;  3G71 P;  1EZV G;  3L72 G;  4I2L C;  3HD7 B;  5DJT B;  3U59 A;  3H1I G;  1VF5 C;  2HLO B;  3H1L D;  1PPJ E;  3SSU A;  5GTH H;  1M1J A;  1FZA C;  1VQ6 P;  1NU1 K;  2E75 B;  5AVR B;  1BE3 D;  2A06 E;  4H0L D;  1M57 D;  2V7Q H;  4N78 D;  1N73 A;  1J1E C;  2YKP A;  1CW5 A;  1ZW0 A;  1FBM A;  1GL2 A;  5EFW B;  1OMI A;  1S5L H;  4ZKU A;  3GHG B;  2A06 G;  2Q3I A;  2J0Y A;  3AE5 C;  1FZE C;  2N1T C;  2KUB A;  2ZVO B;  2J0H A;  2WSE H;  2E74 C;  3AED C;  3AE6 C;  2WT7 B;  2E42 A;  1YI2 P;  2Z4E B;  3KDP B;  3VN0 A;  3E1I C;  2OYH B;  3AE8 C;  1OZH A;  2I1K A;  5CMZ A;  3AE4 C;  3ZDM A;  3USS A;  1RE3 C;  1OIP A;  1GDT A;  1FDI A;  2CK3 H;  4H44 C;  1T3U A;  4RKU J;  2P1J A;  1NTK D;  3MIW A;  1IJD B;  1OW6 A;  2P10 A;  2W6B A;  3HUS B;  2WWW A;  1BDD A;  1LTG C;  1VQK P;  1CI6 B;  2N9Y B;  3R4Y A;  4OH8 B;  3BCC E;  1NTK K;  2LR2 A;  2ZT9 D;  1JTH A;  3G6E P;  2O01 N;  3L75 E;  5AVZ B;  2K9Y A;  1SQX K;  3H1K E;  2JDI H;  2D2C D;  2RN0 A;  1EDJ A;  3U1A A;  4OGQ D;  1USD A;  1GW4 A;  3BCC G;  2YMY A;  3L70 D;  2FYU E;  3NTN A;  3H1K G;  1IC2 A;  3AEF C;  1FAV A;  3BRT B;  2Y0D A;  3RK2 B;  1W2B O;  1BE3 J;  5AVX B;  3S4R A;  2QM8 A;  1NO4 A;  4CPG A;  2R32 A;  3BRV B;  3PTZ A;  2FYU G;  5AVS B;  3H32 B;  1SP4 A;  3VMA A;  2HOD C;  4C7N B;  1KIL B;  4H13 D;  3GHG A;  3M0A A;  5AW1 B;  1AQT A;  3BVH B;  1OVR A;  4D6T E;  3V2R A;  1RF0 B;  2E43 A;  3M06 A;  2M0B A;  2WT7 A;  3WUT A;  1FOS E;  1X79 B;  2Z4E A;  1L0L E;  2HFE D;  2OYH A;  2GM4 A;  3EFG A;  1KTM A;  2NPS B;  3GLM A;  1K9M Q;  4U3F J;  3FWN A;  1NTM E;  2FY8 A;  3MGN A;  1L0L G;  3EQ2 A;  1JNM A;  1N2D C;  1L4A D;  1EXJ A;  3HUS A;  4IL6 E;  1SQV K;  1CI6 A;  2UWJ E;  3KZI H;  3AEG C;  2OTK E;  2L5G B;  3MZW B;  1NTM G;  5KTB A;  1WT6 A;  3P8C E;  1JMB A;  2QJP B;  2C9L Y;  1L0N E;  4DOJ A;  1T8Z A;  2WTY A;  1SQB J;  1GZL A;  1RF1 C;  1K73 Q;  3CCV P;  4UB6 H;  3RGU A;  4JZC A;  5APQ A;  2P67 A;  2OYI C;  2W27 A;  4JQ0 D;  1Z3U A;  4GOD A;  1L0N G;  2G8Y A;  3TDK A;  2I1J A;  5CCH D;  1NOH A;  3VOP A;  2FYZ A;  1A02 F;  4HH2 A;  3H32 A;  1H89 A;  3TSI A;  1S9K D;  4GIF A;  3WU2 H;  1KIL A;  1FE6 A;  5KAI H;  3H25 A;  2GA1 A;  5AVQ B;  1FDO A;  4Y99 C;  2BEZ F;  3CWB E;  1BGY D;  3M0D C;  4DT0 A;  1RF0 A;  1VDF A;  4H0L B;  2K37 A;  2HR3 A;  3HD7 D;  3IF4 A;  1LT1 A;  3PH0 A;  3GG2 A;  2NPS A;  2QVA A;  1FDM A;  1UII A;  4I7Z B;  1YJN P;  2E76 C;  2FXM A;  4OVN F;  4UB6 E;  3CWB G;  1EDK A;  2ZAE B;  5AW2 B;  3N4X A;  3L74 G;  1YYC A;  3S1K A;  1NGM B;  1OW8 A;  1LJ2 A;  5K5G B;  2IYO A;  4JF7 A;  2W83 C;  1MZ9 A;  3L73 D;  3H1H E;  3FIB A;  1AFO A;  3L72 J;  3CCE P;  3WU2 E;  3ITK A;  1LTA C;  2JHL F;  1M1J C;  1FS0 E;  2KZI A;  3H1I J;  1FJK A;  1NU1 E;  1VQO P;  1BCC D;  1N73 C;  2OQQ A;  1JOC A;  3H1L E;  3PJS K;  3RL0 D;  5KLV K;  3V4W A;  3H1H G;  2C9N Y;  2H89 C;  1GL2 C;  1R5S A;  4JYC A;  1QVF O;  3S9O A;  2JEE A;  3TGU D;  2ZT9 B;  3V6I A;  1NU1 G;  2QJY C;  1PP9 G;  1Q86 Q;  3HE4 B;  2D2C B;  4YXD C;  3L35 A;  2Y0C A;  2YKO A;  4OGQ B;  1GU5 A;  3E7K A;  3RK3 B;  1CZQ A;  1AV1 A;  5APU A;  2GUS A;  2ZYD A;  2JJL A;  1RE4 B;  2WPS A;  3RL0 g;  1FZB A;  2HG5 D;  1USE A;  1HWT C;  3VMY A;  3FXE A;  3A7O A;  2AXC A;  1N8R Q;  4WBA A;  3A3Y B;  1LP1 B;  1BGY J;  1ZP0 C;  4L76 A;  1NAF A;  2J60 A;  3G9R A;  4H13 B;  2A45 I;  2JKV A;  1JCC A;  1HVV A;  3KQG A;  5KAF E;  4Y28 J;  5CJ0 A;  1YJW P;  3E1R A;  1SQX E;  1KYO I;  2K3R A;  3MP7 B;  3UIA A;  1JEK A;  1SVF A;  4EI2 A;  4LGD E;  1Y9B A;  3BCC J;  4EDF A;  5B66 H;  2O3J A;  3C9I A;  3I55 P;  1SQX G;  2E75 C;  3M9H A;  3CD6 P;  4IOI H;  3T97 B;  1M56 D;  3SWF A;  1Z3S A;  1AQ5 A;  1DX7 A;  2XKM A;  1KMI Z;  4UB8 E;  3Q5S A;  3A0B E;  3GHG C;  5E79 E;  2W90 A;  2ZJS E;  2JO1 A;  2YXR B;  3W67 A;  2FYU J;  3F89 A;  2H7H A;  1Z56 A;  4YXW H;  2KSJ A;  3EWK A;  2IBZ G;  4AUW A;  1P84 D;  2XNX B;  1PGQ A;  3HE4 A;  3PP5 A;  1Q7Y Q;  1OVU A;  1ZME C;  2Z4E C;  1H0T A;  2KSE A;  2POH A;  2OYH C;  4DZO A;  1RE4 A;  1WRG A;  1SQQ G;  1PGJ A;  2QM7 A;  4BXL A;  2A45 H;  4TT3 H;  3V2P A;  2PFX A;  4RJT A;  2YMK A;  1ZRT D;  3EFF K;  1MFT A;  2J3G A;  4NPD A;  2KYV A;  2NZ2 A;  4PV1 C;  2Q1K A;  3HTK B;  3M9B A;  3JCU E;  3HUS C;  1TU3 F;  1L0L J;  1MUU A;  1SQV E;  1G2C B;  1L2P A;  3CPW O;  2ITA A;  2CPB A;  1HGZ A;  3B8E B;  4O9B A;  1QX8 A;  3Q5R A;  3RBX A;  1G1J A;  1X8Y A;  1U7J A;  1NTM J;  1NKZ B;  4WY4 D;  4R4M A;  2M8R A;  1RQV A;  3CX5 E;  3CXH D;  1R8E A;  1SQV G;  3LW5 J;  2HYN A;  1KC8 Q;  2WNP F;  3KXD A;  5AVT B;  4GOF A;  3T97 A;  3RK2 C;  3NFQ A;  1T2K C;  1JO5 A;  3CC2 P;  1L4A A;  3H32 C;  5AVU B;  1PPJ G;  1KIL C;  4ASV A;  3BAT A;  4IL6 X;  5CBO A;  3CCR P;  4EIJ A;  1IFN A;  1KV4 A;  1G1I A;  1MKM A;  1RH5 B;  3AE1 C;  1RF0 C;  3OAK A;  1ZR2 A;  1KB9 E;  3D6Z A;  2J3U A;  2Y0E A;  2BAS A;  3RL0 B;  1NHL A;  2NPS C;  4U3F D;  3CCL P;  4N6J A;  5CCH A;  1IFD A;  4JYB A;  3SFE C;  3WUU A;  3TNU B;  3N7N A;  3LIE A;  3W68 A;  1FU1 A;  3CWB J;  4HB1 A;  3HTK A;  5GTH E;  3VP9 A;  3II6 A;  4L73 A;  1VQP P;  3IN6 A;  5KKZ C;  4A7P A;  2FYN B;  3L74 J;  1G2C A;  4C7R A;  2QSI A;  2Q9I B;  3Q1M A;  2B88 A;  3JSV C;  3O6Q B;  3NXS A;  1S5L E;  2QJP C;  1FZC B;  2L91 A;  1SQB D;  1P84 I;  4NPE A;  1XTG B;  1LT9 B;  5AVV B;  3A0H H;  3RK3 D;  4R9J A;  3HD7 A;  1SQB K;  3L75 G;  5KLV E;  2HLO A;  3CCM P;  1S4X A;  2YNY A;  2KIK A;  1PGO A;  2KP8 A;  1DH3 A;  2B9B A;  3AE3 C;  1KQS O;  3D71 A;  1VQ4 P;  4ZNC A;  2Y9Z A;  2G3A A;  5KLV G;  1PP9 J;  1X9V A;  2QA4 P;  5BU8 B;  3M9Q A;  2ZYA A;  1SFC D;  4WVZ A;  1FZA B;  1JM0 A;  4QMA A;  3VMZ A;  2WQY C;  4DCK A;  1HBW A;  1KQL A;  1J1E B;  2OTL P;  3HRN A;  1FZB C;  2ZXE B;  3CCJ P;  3WMM 0;  3B5N D;  1NWQ A;  2PRR A;  1S2E A;  4H0L C;  3H1J D;  2IDB A;  4I6M C; 
#chains in the Genus database with same CATH homology
 2IFN A;  3HE5 A;  1J1D B;  2W6A A;  3BVH C;  1MFZ A;  2XNX A;  3N4X A;  2A45 G;  1S9K E;  2D39 A;  5APT A;  1YYC A;  1L0N K;  4M3L A;  1QL1 A;  4NYT A;  4I1L A;  3CLQ A;  5CCG C;  4XE5 B;  1RF1 A;  4JF7 A;  3U1C A;  1J1D C;  1MZ9 A;  3TNU A;  3FIB A;  1URQ D;  3E1I B;  1AFO A;  2JHH C;  2OYI A;  1L4A B;  1LTA C;  1HTL C;  2NPS D;  2JHL F;  2VRS A;  4EPU A;  1M1J C;  1XTC C;  1GL2 B;  1FJK A;  4LC1 A;  1NKN A;  1JMM A;  1N73 C;  1JOC A;  3KPE A;  3RL0 D;  5KLV K;  3V4W A;  5APX A;  1GD2 E;  2C9N Y;  1GL2 C;  1FIB A;  2XZR A;  2IX7 C;  4M7F A;  2WSC H;  2KB7 P;  1LT9 A;  4JYC A;  2HPC A;  2JEE A;  2R5D A;  1JY3 O;  2M3B A;  1LWU B;  2FFD B;  2N9B A;  2P2U A;  3HE4 B;  2XDJ A;  1FZF B;  4R9T A;  5BVZ A;  5KJ7 C;  1H88 A;  3L35 A;  1KFM A;  1LTJ B;  2YKO A;  3M0D A;  1HGV A;  4XA4 A;  1GU5 A;  2Q9I C;  2C0X A;  3L4F A;  1LWU C;  3RK3 B;  1FJP A;  1CZQ A;  1N7L A;  5APU A;  2GUS A;  5APY A;  1HJB A;  2J61 A;  3VTP C;  2JJL A;  3CL3 D;  2FKW B;  2FFD C;  3VYI A;  1FZC C;  1RE4 B;  2WPS A;  2CPS A;  2KOG A;  1FZF C;  1GK6 A;  1FZB A;  1N7S A;  2HG5 D;  3V5B A;  1LTJ C;  1HWT C;  3VMY A;  4C7N A;  4WY4 B;  1JUN A;  2J3F A;  3A7O A;  4WBA A;  3A3Y B;  1JY2 O;  1JTH B;  1IFJ A;  2H43 B;  1NAF A;  2J60 A;  5AW7 B;  3V2N A;  1RE4 C;  1FZG B;  5APW A;  3BVH A;  3L37 A;  2WPQ A;  1LTS C;  4WY4 C;  4AYC A;  1W2E A;  2A45 I;  2HOD B;  2YO3 A;  2O1J A;  3LW5 H;  1JCC A;  1HVV A;  5CCG A;  2H43 C;  4I2L C;  2C0W A;  3HD7 B;  3KQG A;  1FZG C;  2J2P A;  5CJ0 A;  3U59 A;  3P7K A;  2J59 M;  2HLO B;  1N86 B;  1N7S D;  2PAJ A;  2JHI F;  1ZN5 A;  3I5C A;  5AW5 B;  1FZA C;  1M1J A;  2J3F D;  1NU1 K;  5AVR B;  3UIA A;  3P32 A;  4N78 D;  2J64 A;  1N73 A;  1J1E C;  1SVF A;  3R2P A;  1GW3 A;  1SQQ K;  2Q7C A;  2PP6 A;  2YKP A;  4LGD E;  5AVY B;  1FZE B;  2N1T B;  1N86 C;  1CW5 A;  1FBM A;  3C9I A;  1CSB A;  2IFM A;  1GL2 A;  2O1K A;  3M9H A;  5CJ4 A;  4ZKU A;  3GHG B;  1VPC A;  5CCG D;  3SWF A;  2Q3I A;  1Z3S A;  2J0Y A;  1AQ5 A;  1DX7 A;  2XKM A;  3M91 A;  1FZE C;  3NMD A;  2N1T C;  1YTZ T;  2J0H A;  2WSE H;  3GHG C;  2KLV A;  1OWA A;  5KJ7 A;  2WT7 B;  2E42 A;  1RE3 B;  2Q9I A;  2GUV A;  2Z4E B;  1LWU A;  2H7H A;  1SQP K;  1Z56 A;  3KDP B;  3VN0 A;  3E1I C;  2KSJ A;  2OYH B;  4AUW A;  2FFD A;  1L4A C;  1FZC A;  2I1K A;  5CMZ A;  2XNX B;  3HE4 A;  1FZF A;  2JHK F;  3PP5 A;  1GL2 D;  4N78 E;  1LTJ A;  4B86 A;  1RE3 C;  1GDT A;  2Z4E C;  2J5Z A;  2J0G A;  1RF1 B;  2POH A;  2OYH C;  1T3U A;  2P1J A;  4DZO A;  2XNX C;  1FIC A;  1RE4 A;  3MIW A;  1A02 J;  1WRG A;  4IFD K;  1IJD B;  1YTZ I;  1JY3 N;  2QM7 A;  2W6B A;  2OYI B;  2A45 H;  5BU5 A;  3HUS B;  2WWW A;  3V2P A;  4WY4 A;  1LTG C;  1CI6 B;  2WPR A;  5KJ7 D;  2R5B A;  4OH8 B;  1NTK K;  2J3G A;  1JTH A;  2KYV A;  4AQR D;  2H43 A;  5AVZ B;  4EOT A;  3A5T A;  4N3Y B;  5CHX A;  1FZG A;  5AW4 B;  2WIT A;  3HTK B;  4JYO X;  3M9B A;  1SQX K;  1LGH B;  4KHX A;  3HUS C;  2O01 H;  3U1A A;  2IPP A;  1SLQ A;  5CCH C;  2Z5I A;  1MUU A;  1FZA A;  1KZU B;  3RK3 C;  1G2C B;  1LTI C;  2ZFC A;  5AW3 B;  1GW4 A;  2CPB A;  2Z5H A;  1HGZ A;  1FZD A;  3B8E B;  4O9B A;  2YMY A;  1JY2 N;  1G1J A;  1X8Y A;  3NTN A;  1N86 A;  1NKZ B;  1SFC B;  4WY4 D;  4Y99 B;  1IC2 A;  2M8R A;  4RES B;  2R3C A;  1FAV A;  2Q5U A;  3BRT B;  3RK2 B;  2YO2 A;  5AVX B;  2HYN A;  2QM8 A;  1NO4 A;  1NH4 A;  2R32 A;  1FZE A;  2N1T A;  3BRV B;  2J3O A;  3B5N B;  2WNP F;  5AVS B;  3H32 B;  1FZB B;  1SFC C;  1SP4 A;  2HOD C;  3IR9 A;  1H8A A;  4C7N B;  1KIL B;  1IFI A;  2MJZ A;  3GHG A;  5AVT B;  3T97 A;  4GT1 A;  3RK2 C;  3NFQ A;  3HD7 C;  3M0A A;  1LTT C;  5AW1 B;  1T2K C;  3E1I A;  2XV5 A;  1JO5 A;  2HLO C;  3BVH B;  2YKQ A;  1FID A;  1L4A A;  4IFM A;  1MV8 A;  2H8P D;  3B5N C;  3H32 C;  5AVU B;  3V2R A;  3TYY A;  1KIL C;  4W7Z A;  3P8C D;  1RF0 B;  3VP8 A;  4ZKP A;  2E43 A;  3M06 A;  2WT7 A;  3BAT A;  5AW9 B;  1RE3 A;  1FOS E;  1X79 B;  2Z4E A;  4EIJ A;  1IFN A;  2HFE D;  1URQ B;  1M7L A;  2OYH A;  1G1I A;  2GM4 A;  3EFG A;  3OA7 A;  3KYQ A;  1JC9 A;  2NPS B;  2N1T D;  1KFN A;  5AW8 B;  1RF0 C;  1M1J B;  3OAK A;  3SWY A;  3MD0 A;  1ZR2 A;  2J3U A;  1GTW A;  4HYT B;  1URQ C;  3CI9 A;  3HE5 B;  2BAS A;  3RL0 B;  3MGN A;  1N73 B;  3EQ2 A;  1JNM A;  1NHL A;  1N2D C;  2NPS C;  1L4A D;  2P7J A;  1QL2 A;  1IK9 A;  3HUS A;  5APV A;  1IFM A;  4W7Y A;  1SQV K;  1CI6 A;  4ZFG A;  4N6J A;  5CCH A;  1IFD A;  4JYB A;  3V4Q A;  3MUD A;  1GU4 A;  2L5G B;  3RL0 C;  3TNU B;  3N7N A;  3H6P A;  3LIE A;  5KTB A;  1FU1 A;  2WSF H;  1EQ7 A;  3HTK A;  4WB4 A;  2FYU K;  1WT6 A;  3VP9 A;  3P8C E;  3II6 A;  2C9L Y;  4DOJ A;  3VMX A;  1ZR4 A;  1J2J B;  2OAR A;  1HUC A;  1T8Z A;  2WTY A;  1E5W A;  1G2C A;  1GZL A;  4W80 A;  1RF1 C;  4C7R A;  2Q9I B;  1JY3 P;  1RY3 A;  3TK1 A;  4JZC A;  5APQ A;  3NXS A;  2P67 A;  3P8M C;  2OYI C;  1FZC B;  2JHM F;  2W27 A;  4LLH A;  1XTG B;  1Z3U A;  1LT9 B;  1SFC A;  2WZ7 A;  3V2Q A;  5AVV B;  4IFF A;  2HOD A;  2HPC B;  2I1J A;  5CCH D;  1NOH A;  3RK3 D;  4R9J A;  3HD7 A;  1SQB K;  1LTB C;  5AW6 B;  1ZLL A;  3VOP A;  2FYZ A;  1A02 F;  2HLO A;  3B5N A;  4HH2 A;  3H32 A;  1H89 A;  1DEB A;  1LT9 C;  3TSI A;  3BAS A;  1S9K D;  4GIF A;  3A2A A;  2HPC C;  1KIL A;  1ZV8 A;  1JCD A;  2YNY A;  2GY7 A;  2KP8 A;  1DH3 A;  1L0L K;  1JY2 P;  2FIB A;  2J61 B;  2LKM A;  4M7H A;  5APS A;  1PFI A;  5AVQ B;  1N7S B;  1FOS F;  1X9V A;  3L36 A;  5BU8 B;  2XU6 A;  4Y99 C;  4GKG A;  1HH0 A;  3M9Q A;  3M0D C;  1SFC D;  1RF0 A;  1VDF A;  1FZA B;  5AW0 B;  3OJA B;  1OXZ A;  3G3Z A;  1NTM K;  5AVW B;  3VMZ A;  3O8Z A;  3RK2 D;  1URQ A;  3HD7 D;  3LID A;  1HBW A;  2J58 A;  1KQL A;  1J1E B;  1T3J A;  1T2K D;  3HRN A;  1N7S C;  1FZB C;  2J1G A;  2NPS A;  2ZXE B;  4C46 A;  3WMM 0;  1FDM A;  3B5N D;  3MTU E;  3IFM A;  1NTZ K;  1NWQ A;  2FXM A;  1KIL D;  4I6M C;  1IO4 A;  1GK4 A;  5AW2 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...