4ZFGA

Dual-specificity fab 5a12 in complex with angiopoietin 2
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
220
structure length
220
Chain Sequence
QISFRDCAEVFKSGHTTNGIYTLTFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDGDNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLKATTMMIRPADFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein/immune system
molecule keywords Angiopoietin-2
publication title Deep Sequencing-guided Design of a High Affinity Dual Specificity Antibody to Target Two Angiogenic Factors in Neovascular Age-related Macular Degeneration.
pubmed doi rcsb
source organism Homo sapiens
total genus 70
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 2015-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 4zfgA01
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 4zfgA02
2J0YA 2J3GA 2HPCB 2J64A 2HPCC 3H32B 4M7HA 2J0HA 2GY7A 2J3UA 1Z3UA 1FIDA 2HLOB 2HLOC 1LTJC 3E1IB 3E1IC 4R9TA 4NYTA 1FZCB 1FZEB 1FZEC 2JHKF 4M7FA 1FZAB 1FZAC 4JYOX 1N73C 1FZFB 1FZFC 1LWUB 2OYHB 1LWUC 2OYHC 2D39A 2JHHC 1LT9B 1LT9C 2Q9IB 2Q9IC 2HODC 2J3FD 1LTJB 2J60A 2J61B 2OYIC 1FZDA 1M1JB 1M1JC 1Z3SA 3BVHC 1RE4C 3FIBA 1RF1C 1N73B 1FIBA 1FICA 4R9JA 4EPUA 2J0GA 4JZCA 2J3FA 3HUSC 2FFDC 1FZGB 1FZGC 2HODB 2XNXB 2XNXC 2JHLF 1RE3B 1RE3C 1FZBB 2OYIB 1FZBC 3GHGC 2H43C 2WNPF 4ZFGA 1RF0B 1RF0C 2J5ZA 2JHIF 3BVHB 2Z4EB 1RE4B 2Z4EC 1RF1B 3H32C 2FIBA 2JHMF 3HUSB 2J1GA 2FFDB 2J3OA 2J61A 1N86B 1N86C 1FZCC 1JC9A 2H43B 2J2PA
chains in the Genus database with same CATH superfamily
2J0YA 2J3GA 2HPCB 2J64A 2HPCC 3H32B 4M7HA 2J0HA 2GY7A 2J3UA 1Z3UA 1FIDA 2HLOB 2HLOC 1LTJC 3E1IB 3E1IC 4R9TA 4NYTA 1FZCB 1FZEB 1FZEC 2JHKF 4M7FA 1FZAB 1FZAC 4JYOX 1N73C 1FZFB 1FZFC 1LWUB 2OYHB 1LWUC 2OYHC 2D39A 2JHHC 1LT9B 1LT9C 2Q9IB 2Q9IC 2HODC 2J3FD 1LTJB 2J60A 2J61B 2OYIC 1FZDA 1M1JB 1M1JC 1Z3SA 3BVHC 1RE4C 3FIBA 1RF1C 1N73B 1FIBA 1FICA 4R9JA 4EPUA 2J0GA 4JZCA 2J3FA 3HUSC 2FFDC 1FZGB 1FZGC 2HODB 2XNXB 2XNXC 2JHLF 1RE3B 1RE3C 1FZBB 2OYIB 1FZBC 3GHGC 2H43C 2WNPF 4ZFGA 1RF0B 1RF0C 2J5ZA 2JHIF 3BVHB 2Z4EB 1RE4B 2Z4EC 1RF1B 3H32C 2FIBA 2JHMF 3HUSB 2J1GA 2FFDB 2J3OA 2J61A 1N86B 1N86C 1FZCC 1JC9A 3GHGB 2H43B 2J2PA
chains in the Genus database with same CATH topology
2J0YA 2J3GA 2HPCB 2J64A 2HPCC 3H32B 4M7HA 2J0HA 2GY7A 2J3UA 1Z3UA 1FIDA 2HLOB 2HLOC 1LTJC 3E1IB 3E1IC 4R9TA 4NYTA 1FZCB 1FZEB 1FZEC 2JHKF 4M7FA 1FZAB 1FZAC 4JYOX 1N73C 1FZFB 1FZFC 1LWUB 2OYHB 1LWUC 2OYHC 2D39A 2JHHC 1LT9B 1LT9C 2Q9IB 2Q9IC 2HODC 2J3FD 1LTJB 2J60A 2J61B 2OYIC 1FZDA 1M1JB 1M1JC 1Z3SA 3BVHC 1RE4C 3FIBA 1RF1C 1N73B 1FIBA 1FICA 4R9JA 4EPUA 2J0GA 4JZCA 2J3FA 3HUSC 2FFDC 1FZGB 1FZGC 2HODB 2XNXB 2XNXC 2JHLF 1RE3B 1RE3C 1FZBB 2OYIB 1FZBC 3GHGC 2H43C 2WNPF 4ZFGA 1RF0B 1RF0C 2J5ZA 2JHIF 3BVHB 2Z4EB 1RE4B 2Z4EC 1RF1B 3H32C 2FIBA 2JHMF 3HUSB 2J1GA 2FFDB 2J3OA 2J61A 1N86B 1N86C 1FZCC 1JC9A 2H43B 2J2PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J0Y A;  2J3G A;  2HPC B;  2J64 A;  2HPC C;  3H32 B;  4M7H A;  2J0H A;  2GY7 A;  2J3U A;  1Z3U A;  1FID A;  2HLO B;  2HLO C;  1LTJ C;  3E1I B;  3E1I C;  4R9T A;  4NYT A;  1FZC B;  1FZE B;  1FZE C;  2JHK F;  4M7F A;  1FZA B;  1FZA C;  4JYO X;  1N73 C;  1FZF B;  1FZF C;  1LWU B;  2OYH B;  1LWU C;  2OYH C;  2D39 A;  2JHH C;  1LT9 B;  1LT9 C;  2Q9I B;  2Q9I C;  2HOD C;  2J3F D;  1LTJ B;  2J60 A;  2J61 B;  2OYI C;  1FZD A;  1M1J B;  1M1J C;  1Z3S A;  3BVH C;  1RE4 C;  3FIB A;  1RF1 C;  1N73 B;  1FIB A;  1FIC A;  4R9J A;  4EPU A;  2J0G A;  4JZC A;  2J3F A;  3HUS C;  2FFD C;  1FZG B;  1FZG C;  2HOD B;  2XNX B;  2XNX C;  2JHL F;  1RE3 B;  1RE3 C;  1FZB B;  2OYI B;  1FZB C;  3GHG C;  2H43 C;  2WNP F;  4ZFG A;  1RF0 B;  1RF0 C;  2J5Z A;  2JHI F;  3BVH B;  2Z4E B;  1RE4 B;  2Z4E C;  1RF1 B;  3H32 C;  2FIB A;  2JHM F;  3HUS B;  2J1G A;  2FFD B;  2J3O A;  2J61 A;  1N86 B;  1N86 C;  1FZC C;  1JC9 A;  2H43 B;  2J2P A; 
#chains in the Genus database with same CATH topology
 2J0Y A;  2J3G A;  2HPC B;  2J64 A;  2HPC C;  3H32 B;  4M7H A;  2J0H A;  2GY7 A;  2J3U A;  1Z3U A;  1FID A;  2HLO B;  2HLO C;  1LTJ C;  3E1I B;  3E1I C;  4R9T A;  4NYT A;  1FZC B;  1FZE B;  1FZE C;  2JHK F;  4M7F A;  1FZA B;  1FZA C;  4JYO X;  1N73 C;  1FZF B;  1FZF C;  1LWU B;  2OYH B;  1LWU C;  2OYH C;  2D39 A;  2JHH C;  1LT9 B;  1LT9 C;  2Q9I B;  2Q9I C;  2HOD C;  2J3F D;  1LTJ B;  2J60 A;  2J61 B;  2OYI C;  1FZD A;  1M1J B;  1M1J C;  1Z3S A;  3BVH C;  1RE4 C;  3FIB A;  1RF1 C;  1N73 B;  1FIB A;  1FIC A;  4R9J A;  4EPU A;  2J0G A;  4JZC A;  2J3F A;  3HUS C;  2FFD C;  1FZG B;  1FZG C;  2HOD B;  2XNX B;  2XNX C;  2JHL F;  1RE3 B;  1RE3 C;  1FZB B;  2OYI B;  1FZB C;  3GHG C;  2H43 C;  2WNP F;  4ZFG A;  1RF0 B;  1RF0 C;  2J5Z A;  2JHI F;  3BVH B;  2Z4E B;  1RE4 B;  2Z4E C;  1RF1 B;  3H32 C;  2FIB A;  2JHM F;  3HUS B;  2J1G A;  2FFD B;  2J3O A;  2J61 A;  1N86 B;  1N86 C;  1FZC C;  1JC9 A;  3GHG B;  2H43 B;  2J2P A; 
#chains in the Genus database with same CATH homology
 2J0Y A;  2J3G A;  2HPC B;  2J64 A;  2HPC C;  3H32 B;  4M7H A;  2J0H A;  2GY7 A;  2J3U A;  1Z3U A;  1FID A;  2HLO B;  2HLO C;  1LTJ C;  3E1I B;  3E1I C;  4R9T A;  4NYT A;  1FZC B;  1FZE B;  1FZE C;  2JHK F;  4M7F A;  1FZA B;  1FZA C;  4JYO X;  1N73 C;  1FZF B;  1FZF C;  1LWU B;  2OYH B;  1LWU C;  2OYH C;  2D39 A;  2JHH C;  1LT9 B;  1LT9 C;  2Q9I B;  2Q9I C;  2HOD C;  2J3F D;  1LTJ B;  2J60 A;  2J61 B;  2OYI C;  1FZD A;  1M1J B;  1M1J C;  1Z3S A;  3BVH C;  1RE4 C;  3FIB A;  1RF1 C;  1N73 B;  1FIB A;  1FIC A;  4R9J A;  4EPU A;  2J0G A;  4JZC A;  2J3F A;  3HUS C;  2FFD C;  1FZG B;  1FZG C;  2HOD B;  2XNX B;  2XNX C;  2JHL F;  1RE3 B;  1RE3 C;  1FZB B;  2OYI B;  1FZB C;  3GHG C;  2H43 C;  2WNP F;  4ZFG A;  1RF0 B;  1RF0 C;  2J5Z A;  2JHI F;  3BVH B;  2Z4E B;  1RE4 B;  2Z4E C;  1RF1 B;  3H32 C;  2FIB A;  2JHM F;  3HUS B;  2J1G A;  2FFD B;  2J3O A;  2J61 A;  1N86 B;  1N86 C;  1FZC C;  1JC9 A;  2H43 B;  2J2P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...