4ZFGA

Dual-specificity fab 5a12 in complex with angiopoietin 2
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
220
structure length
220
Chain Sequence
QISFRDCAEVFKSGHTTNGIYTLTFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDGDNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLKATTMMIRPADFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Angiopoietin-2
publication title Deep Sequencing-guided Design of a High Affinity Dual Specificity Antibody to Target Two Angiogenic Factors in Neovascular Age-related Macular Degeneration.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/immune system
total genus 70
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 2015-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 4zfgA01
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 4zfgA02
1FZGB 1RE3C 2FFDC 1FZAC 2WNPF 3BVHC 2OYHB 2GY7A 2OYIC 3HUSC 1N73B 2JHKF 2Z4EC 2Q9IC 2J3GA 1FZCC 2J3FA 2J64A 3E1IB 2HLOC 1FIBA 1LTJC 2JHHC 4NYTA 1FZFC 2J0YA 1FZGC 1M1JB 3H32B 2H43B 2J2PA 1JC9A 2J0HA 2OYHC 2J61A 4ZFGA 1LT9C 1N73C 1FZDA 1Z3UA 2J3OA 1RF0B 1FZEB 3E1IC 2J60A 1LWUB 1N86B 2FIBA 1Z3SA 1FZBB 4M7HA 2XNXC 1M1JC 3H32C 2H43C 2J3FD 2J5ZA 2J0GA 2J1GA 2HPCB 1RF0C 1FZCB 1RE4B 1FZEC 1RF1B 1LWUC 1N86C 1FZBC 3FIBA 4JZCA 2HODB 1RE3B 2FFDB 2JHMF 2JHLF 1FZAB 4JYOX 1FIDA 3BVHB 2OYIB 4R9TA 1LT9B 4EPUA 2JHIF 3GHGC 3HUSB 4M7FA 2HPCC 2Z4EB 1FICA 2D39A 2J3UA 2Q9IB 4R9JA 1RE4C 1RF1C 2J61B 2HLOB 1LTJB 1FZFB 2HODC 2XNXB
chains in the Genus database with same CATH superfamily
1FZGB 1RE3C 2FFDC 1FZAC 2WNPF 3BVHC 2OYHB 2GY7A 2OYIC 3HUSC 1N73B 2JHKF 2Z4EC 2Q9IC 2J3GA 1FZCC 2J3FA 2J64A 3E1IB 2HLOC 1FIBA 1LTJC 2JHHC 4NYTA 1FZFC 2J0YA 1FZGC 1M1JB 3H32B 2H43B 2J2PA 1JC9A 2J0HA 2OYHC 2J61A 4ZFGA 1LT9C 1N73C 1FZDA 1Z3UA 2J3OA 1RF0B 1FZEB 3E1IC 2J60A 1LWUB 1N86B 2FIBA 1Z3SA 1FZBB 4M7HA 2XNXC 1M1JC 3H32C 2H43C 2J3FD 2J5ZA 3GHGB 2J0GA 2J1GA 2HPCB 1RF0C 1FZCB 1RE4B 1FZEC 1RF1B 1LWUC 1N86C 1FZBC 3FIBA 4JZCA 2HODB 1RE3B 2FFDB 2JHMF 2JHLF 1FZAB 4JYOX 1FIDA 3BVHB 2OYIB 4R9TA 1LT9B 4EPUA 2JHIF 3GHGC 3HUSB 4M7FA 2HPCC 2Z4EB 1FICA 2D39A 2J3UA 2Q9IB 4R9JA 1RE4C 1RF1C 2J61B 2HLOB 1LTJB 1FZFB 2HODC 2XNXB
chains in the Genus database with same CATH topology
1FZGB 1RE3C 2FFDC 1FZAC 2WNPF 3BVHC 2OYHB 2GY7A 2OYIC 3HUSC 1N73B 2JHKF 2Z4EC 2Q9IC 2J3GA 1FZCC 2J3FA 2J64A 3E1IB 2HLOC 1FIBA 1LTJC 2JHHC 4NYTA 1FZFC 2J0YA 1FZGC 1M1JB 3H32B 2H43B 2J2PA 1JC9A 2J0HA 2OYHC 2J61A 4ZFGA 1LT9C 1N73C 1FZDA 1Z3UA 2J3OA 1RF0B 1FZEB 3E1IC 2J60A 1LWUB 1N86B 2FIBA 1Z3SA 1FZBB 4M7HA 2XNXC 1M1JC 3H32C 2H43C 2J3FD 2J5ZA 2J0GA 2J1GA 2HPCB 1RF0C 1FZCB 1RE4B 1FZEC 1RF1B 1LWUC 1N86C 1FZBC 3FIBA 4JZCA 2HODB 1RE3B 2FFDB 2JHMF 2JHLF 1FZAB 4JYOX 1FIDA 3BVHB 2OYIB 4R9TA 1LT9B 4EPUA 2JHIF 3GHGC 3HUSB 4M7FA 2HPCC 2Z4EB 1FICA 2D39A 2J3UA 2Q9IB 4R9JA 1RE4C 1RF1C 2J61B 2HLOB 1LTJB 1FZFB 2HODC 2XNXB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FZG B;  1RE3 C;  2FFD C;  1FZA C;  2WNP F;  3BVH C;  2OYH B;  2GY7 A;  2OYI C;  3HUS C;  1N73 B;  2JHK F;  2Z4E C;  2Q9I C;  2J3G A;  1FZC C;  2J3F A;  2J64 A;  3E1I B;  2HLO C;  1FIB A;  1LTJ C;  2JHH C;  4NYT A;  1FZF C;  2J0Y A;  1FZG C;  1M1J B;  3H32 B;  2H43 B;  2J2P A;  1JC9 A;  2J0H A;  2OYH C;  2J61 A;  4ZFG A;  1LT9 C;  1N73 C;  1FZD A;  1Z3U A;  2J3O A;  1RF0 B;  1FZE B;  3E1I C;  2J60 A;  1LWU B;  1N86 B;  2FIB A;  1Z3S A;  1FZB B;  4M7H A;  2XNX C;  1M1J C;  3H32 C;  2H43 C;  2J3F D;  2J5Z A;  2J0G A;  2J1G A;  2HPC B;  1RF0 C;  1FZC B;  1RE4 B;  1FZE C;  1RF1 B;  1LWU C;  1N86 C;  1FZB C;  3FIB A;  4JZC A;  2HOD B;  1RE3 B;  2FFD B;  2JHM F;  2JHL F;  1FZA B;  4JYO X;  1FID A;  3BVH B;  2OYI B;  4R9T A;  1LT9 B;  4EPU A;  2JHI F;  3GHG C;  3HUS B;  4M7F A;  2HPC C;  2Z4E B;  1FIC A;  2D39 A;  2J3U A;  2Q9I B;  4R9J A;  1RE4 C;  1RF1 C;  2J61 B;  2HLO B;  1LTJ B;  1FZF B;  2HOD C;  2XNX B; 
#chains in the Genus database with same CATH topology
 1FZG B;  1RE3 C;  2FFD C;  1FZA C;  2WNP F;  3BVH C;  2OYH B;  2GY7 A;  2OYI C;  3HUS C;  1N73 B;  2JHK F;  2Z4E C;  2Q9I C;  2J3G A;  1FZC C;  2J3F A;  2J64 A;  3E1I B;  2HLO C;  1FIB A;  1LTJ C;  2JHH C;  4NYT A;  1FZF C;  2J0Y A;  1FZG C;  1M1J B;  3H32 B;  2H43 B;  2J2P A;  1JC9 A;  2J0H A;  2OYH C;  2J61 A;  4ZFG A;  1LT9 C;  1N73 C;  1FZD A;  1Z3U A;  2J3O A;  1RF0 B;  1FZE B;  3E1I C;  2J60 A;  1LWU B;  1N86 B;  2FIB A;  1Z3S A;  1FZB B;  4M7H A;  2XNX C;  1M1J C;  3H32 C;  2H43 C;  2J3F D;  2J5Z A;  3GHG B;  2J0G A;  2J1G A;  2HPC B;  1RF0 C;  1FZC B;  1RE4 B;  1FZE C;  1RF1 B;  1LWU C;  1N86 C;  1FZB C;  3FIB A;  4JZC A;  2HOD B;  1RE3 B;  2FFD B;  2JHM F;  2JHL F;  1FZA B;  4JYO X;  1FID A;  3BVH B;  2OYI B;  4R9T A;  1LT9 B;  4EPU A;  2JHI F;  3GHG C;  3HUS B;  4M7F A;  2HPC C;  2Z4E B;  1FIC A;  2D39 A;  2J3U A;  2Q9I B;  4R9J A;  1RE4 C;  1RF1 C;  2J61 B;  2HLO B;  1LTJ B;  1FZF B;  2HOD C;  2XNX B; 
#chains in the Genus database with same CATH homology
 1FZG B;  1RE3 C;  2FFD C;  1FZA C;  2WNP F;  3BVH C;  2OYH B;  2GY7 A;  2OYI C;  3HUS C;  1N73 B;  2JHK F;  2Z4E C;  2Q9I C;  2J3G A;  1FZC C;  2J3F A;  2J64 A;  3E1I B;  2HLO C;  1FIB A;  1LTJ C;  2JHH C;  4NYT A;  1FZF C;  2J0Y A;  1FZG C;  1M1J B;  3H32 B;  2H43 B;  2J2P A;  1JC9 A;  2J0H A;  2OYH C;  2J61 A;  4ZFG A;  1LT9 C;  1N73 C;  1FZD A;  1Z3U A;  2J3O A;  1RF0 B;  1FZE B;  3E1I C;  2J60 A;  1LWU B;  1N86 B;  2FIB A;  1Z3S A;  1FZB B;  4M7H A;  2XNX C;  1M1J C;  3H32 C;  2H43 C;  2J3F D;  2J5Z A;  2J0G A;  2J1G A;  2HPC B;  1RF0 C;  1FZC B;  1RE4 B;  1FZE C;  1RF1 B;  1LWU C;  1N86 C;  1FZB C;  3FIB A;  4JZC A;  2HOD B;  1RE3 B;  2FFD B;  2JHM F;  2JHL F;  1FZA B;  4JYO X;  1FID A;  3BVH B;  2OYI B;  4R9T A;  1LT9 B;  4EPU A;  2JHI F;  3GHG C;  3HUS B;  4M7F A;  2HPC C;  2Z4E B;  1FIC A;  2D39 A;  2J3U A;  2Q9I B;  4R9J A;  1RE4 C;  1RF1 C;  2J61 B;  2HLO B;  1LTJ B;  1FZF B;  2HOD C;  2XNX B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...