2HPCC

Crystal structure of fragment d from human fibrinogen complexed with gly-pro-arg-pro-amide.
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
305
structure length
305
Chain Sequence
EIMKYEASILTHDSSIRYLQEIYNSNNQKIVNLKEKVAQLEAQCQEPCKDTVQIHDITGKDCQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQSAIPYALRVELEDWNGRTSTADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEGNCAEQDGSGWWMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIPFNRLTIGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibrinogen alpha chain
molecule tags Blood clotting
total genus 51
structure length 305
sequence length 305
chains with identical sequence F, I, L
ec nomenclature
pdb deposition date 2006-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 2hpcC01
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 2hpcC02
2J5ZA 1RE3C 1N73C 3FIBA 2J60A 2HPCC 2WNPF 3E1IB 1M1JC 1LT9B 2J1GA 3HUSC 2FFDB 2H43C 1JC9A 2JHHC 2J3FA 3BVHC 1LWUC 1FZEB 1Z3UA 1FZFB 1FZCC 3H32C 2HODB 1RE4C 2J2PA 1FZGC 2GY7A 2J61A 2J3GA 1Z3SA 2OYHC 1LTJC 1FZBC 1RF1C 2Z4EB 2OYIB 1N86B 2XNXB 3E1IC 1FZAB 1RF0B 4ZFGA 1LT9C 2FFDC 2HLOB 2Q9IB 2J3UA 1RE3B 2J61B 4R9TA 4JZCA 2HPCB 2J3FD 1FZEC 1M1JB 4M7FA 1FZFC 1FIBA 2H43B 4R9JA 2HODC 2J0YA 1FZDA 4NYTA 2JHLF 3BVHB 1LWUB 2J64A 4M7HA 2J0HA 3GHGC 4EPUA 1N73B 1FZCB 3H32B 4JYOX 1RE4B 2Z4EC 2FIBA 1FZGB 2OYIC 1N86C 1FICA 2JHKF 2XNXC 2D39A 1FZAC 1FIDA 1RF0C 2JHIF 3HUSB 2J3OA 2OYHB 1LTJB 1FZBB 1RF1B 2J0GA 2HLOC 2JHMF 2Q9IC
chains in the Genus database with same CATH superfamily
2J5ZA 1RE3C 1N73C 3FIBA 2J60A 2HPCC 2WNPF 3E1IB 1M1JC 1LT9B 2J1GA 3HUSC 2FFDB 2H43C 1JC9A 2JHHC 2J3FA 3BVHC 1LWUC 1FZEB 1Z3UA 1FZFB 1FZCC 3H32C 2HODB 1RE4C 2J2PA 1FZGC 2GY7A 2J61A 2J3GA 1Z3SA 3GHGB 2OYHC 1LTJC 1FZBC 1RF1C 2Z4EB 2OYIB 1N86B 2XNXB 3E1IC 1FZAB 1RF0B 4ZFGA 1LT9C 2FFDC 2HLOB 2Q9IB 2J3UA 1RE3B 2J61B 4R9TA 4JZCA 2HPCB 2J3FD 1FZEC 1M1JB 4M7FA 1FZFC 1FIBA 2H43B 4R9JA 2HODC 2J0YA 1FZDA 4NYTA 2JHLF 3BVHB 1LWUB 2J64A 4M7HA 2J0HA 3GHGC 4EPUA 1N73B 1FZCB 3H32B 4JYOX 1RE4B 2Z4EC 2FIBA 1FZGB 2OYIC 1N86C 1FICA 2JHKF 2XNXC 2D39A 1FZAC 1FIDA 1RF0C 2JHIF 3HUSB 2J3OA 2OYHB 1LTJB 1FZBB 1RF1B 2J0GA 2HLOC 2JHMF 2Q9IC
chains in the Genus database with same CATH topology
2J5ZA 1RE3C 1N73C 3FIBA 2J60A 2HPCC 2WNPF 3E1IB 1M1JC 1LT9B 2J1GA 3HUSC 2FFDB 2H43C 1JC9A 2JHHC 2J3FA 3BVHC 1LWUC 1FZEB 1Z3UA 1FZFB 1FZCC 3H32C 2HODB 1RE4C 2J2PA 1FZGC 2GY7A 2J61A 2J3GA 1Z3SA 2OYHC 1LTJC 1FZBC 1RF1C 2Z4EB 2OYIB 1N86B 2XNXB 3E1IC 1FZAB 1RF0B 4ZFGA 1LT9C 2FFDC 2HLOB 2Q9IB 2J3UA 1RE3B 2J61B 4R9TA 4JZCA 2HPCB 2J3FD 1FZEC 1M1JB 4M7FA 1FZFC 1FIBA 2H43B 4R9JA 2HODC 2J0YA 1FZDA 4NYTA 2JHLF 3BVHB 1LWUB 2J64A 4M7HA 2J0HA 3GHGC 4EPUA 1N73B 1FZCB 3H32B 4JYOX 1RE4B 2Z4EC 2FIBA 1FZGB 2OYIC 1N86C 1FICA 2JHKF 2XNXC 2D39A 1FZAC 1FIDA 1RF0C 2JHIF 3HUSB 2J3OA 2OYHB 1LTJB 1FZBB 1RF1B 2J0GA 2HLOC 2JHMF 2Q9IC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J5Z A;  1RE3 C;  1N73 C;  3FIB A;  2J60 A;  2HPC C;  2WNP F;  3E1I B;  1M1J C;  1LT9 B;  2J1G A;  3HUS C;  2FFD B;  2H43 C;  1JC9 A;  2JHH C;  2J3F A;  3BVH C;  1LWU C;  1FZE B;  1Z3U A;  1FZF B;  1FZC C;  3H32 C;  2HOD B;  1RE4 C;  2J2P A;  1FZG C;  2GY7 A;  2J61 A;  2J3G A;  1Z3S A;  2OYH C;  1LTJ C;  1FZB C;  1RF1 C;  2Z4E B;  2OYI B;  1N86 B;  2XNX B;  3E1I C;  1FZA B;  1RF0 B;  4ZFG A;  1LT9 C;  2FFD C;  2HLO B;  2Q9I B;  2J3U A;  1RE3 B;  2J61 B;  4R9T A;  4JZC A;  2HPC B;  2J3F D;  1FZE C;  1M1J B;  4M7F A;  1FZF C;  1FIB A;  2H43 B;  4R9J A;  2HOD C;  2J0Y A;  1FZD A;  4NYT A;  2JHL F;  3BVH B;  1LWU B;  2J64 A;  4M7H A;  2J0H A;  3GHG C;  4EPU A;  1N73 B;  1FZC B;  3H32 B;  4JYO X;  1RE4 B;  2Z4E C;  2FIB A;  1FZG B;  2OYI C;  1N86 C;  1FIC A;  2JHK F;  2XNX C;  2D39 A;  1FZA C;  1FID A;  1RF0 C;  2JHI F;  3HUS B;  2J3O A;  2OYH B;  1LTJ B;  1FZB B;  1RF1 B;  2J0G A;  2HLO C;  2JHM F;  2Q9I C; 
#chains in the Genus database with same CATH topology
 2J5Z A;  1RE3 C;  1N73 C;  3FIB A;  2J60 A;  2HPC C;  2WNP F;  3E1I B;  1M1J C;  1LT9 B;  2J1G A;  3HUS C;  2FFD B;  2H43 C;  1JC9 A;  2JHH C;  2J3F A;  3BVH C;  1LWU C;  1FZE B;  1Z3U A;  1FZF B;  1FZC C;  3H32 C;  2HOD B;  1RE4 C;  2J2P A;  1FZG C;  2GY7 A;  2J61 A;  2J3G A;  1Z3S A;  3GHG B;  2OYH C;  1LTJ C;  1FZB C;  1RF1 C;  2Z4E B;  2OYI B;  1N86 B;  2XNX B;  3E1I C;  1FZA B;  1RF0 B;  4ZFG A;  1LT9 C;  2FFD C;  2HLO B;  2Q9I B;  2J3U A;  1RE3 B;  2J61 B;  4R9T A;  4JZC A;  2HPC B;  2J3F D;  1FZE C;  1M1J B;  4M7F A;  1FZF C;  1FIB A;  2H43 B;  4R9J A;  2HOD C;  2J0Y A;  1FZD A;  4NYT A;  2JHL F;  3BVH B;  1LWU B;  2J64 A;  4M7H A;  2J0H A;  3GHG C;  4EPU A;  1N73 B;  1FZC B;  3H32 B;  4JYO X;  1RE4 B;  2Z4E C;  2FIB A;  1FZG B;  2OYI C;  1N86 C;  1FIC A;  2JHK F;  2XNX C;  2D39 A;  1FZA C;  1FID A;  1RF0 C;  2JHI F;  3HUS B;  2J3O A;  2OYH B;  1LTJ B;  1FZB B;  1RF1 B;  2J0G A;  2HLO C;  2JHM F;  2Q9I C; 
#chains in the Genus database with same CATH homology
 2J5Z A;  1RE3 C;  1N73 C;  3FIB A;  2J60 A;  2HPC C;  2WNP F;  3E1I B;  1M1J C;  1LT9 B;  2J1G A;  3HUS C;  2FFD B;  2H43 C;  1JC9 A;  2JHH C;  2J3F A;  3BVH C;  1LWU C;  1FZE B;  1Z3U A;  1FZF B;  1FZC C;  3H32 C;  2HOD B;  1RE4 C;  2J2P A;  1FZG C;  2GY7 A;  2J61 A;  2J3G A;  1Z3S A;  2OYH C;  1LTJ C;  1FZB C;  1RF1 C;  2Z4E B;  2OYI B;  1N86 B;  2XNX B;  3E1I C;  1FZA B;  1RF0 B;  4ZFG A;  1LT9 C;  2FFD C;  2HLO B;  2Q9I B;  2J3U A;  1RE3 B;  2J61 B;  4R9T A;  4JZC A;  2HPC B;  2J3F D;  1FZE C;  1M1J B;  4M7F A;  1FZF C;  1FIB A;  2H43 B;  4R9J A;  2HOD C;  2J0Y A;  1FZD A;  4NYT A;  2JHL F;  3BVH B;  1LWU B;  2J64 A;  4M7H A;  2J0H A;  3GHG C;  4EPU A;  1N73 B;  1FZC B;  3H32 B;  4JYO X;  1RE4 B;  2Z4E C;  2FIB A;  1FZG B;  2OYI C;  1N86 C;  1FIC A;  2JHK F;  2XNX C;  2D39 A;  1FZA C;  1FID A;  1RF0 C;  2JHI F;  3HUS B;  2J3O A;  2OYH B;  1LTJ B;  1FZB B;  1RF1 B;  2J0G A;  2HLO C;  2JHM F;  2Q9I C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...