2HPCC

Crystal structure of fragment d from human fibrinogen complexed with gly-pro-arg-pro-amide.
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
305
structure length
305
Chain Sequence
EIMKYEASILTHDSSIRYLQEIYNSNNQKIVNLKEKVAQLEAQCQEPCKDTVQIHDITGKDCQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQSAIPYALRVELEDWNGRTSTADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEGNCAEQDGSGWWMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIPFNRLTIGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Blood clotting
molecule keywords Fibrinogen alpha chain
total genus 51
structure length 305
sequence length 305
chains with identical sequence F, I, L
ec nomenclature
pdb deposition date 2006-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 2hpcC01
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 2hpcC02
2FIBA 2OYHB 2H43C 1RF0C 1Z3UA 2J61A 1LT9C 1RE3C 3HUSB 2J5ZA 3E1IC 2HPCB 4JYOX 4R9TA 2J0HA 2J64A 1LTJB 2J0GA 2Q9IB 1FZBC 2WNPF 2XNXC 3HUSC 3H32C 1LWUB 2HODC 1LTJC 2J3UA 2Z4EB 2Q9IC 1N86B 2OYIB 2J3GA 1FIDA 4R9JA 1RE4B 2JHLF 3BVHB 1FZAB 1FZFB 4ZFGA 1FZGB 1FIBA 2OYHC 2J3OA 2HLOB 2J61B 1FZEB 1N86C 1N73B 2JHKF 4M7FA 4JZCA 2HPCC 3FIBA 1FZEC 2J3FD 1FZCB 1Z3SA 2H43B 1RF0B 1JC9A 1LT9B 1RE3B 2JHIF 1LWUC 2JHMF 2Z4EC 3E1IB 3GHGC 1M1JB 2OYIC 4EPUA 1RE4C 1FZBB 2D39A 3BVHC 2GY7A 1FZAC 1FZFC 2XNXB 1FZGC 2J60A 1FZDA 1RF1B 2JHHC 1M1JC 2HLOC 3H32B 1N73C 2FFDB 2HODB 1RF1C 2J3FA 4NYTA 2J1GA 1FZCC 1FICA 4M7HA 2J0YA 2J2PA 2FFDC
chains in the Genus database with same CATH superfamily
2FIBA 2OYHB 2H43C 1RF0C 1Z3UA 2J61A 1LT9C 1RE3C 3HUSB 2J5ZA 3E1IC 2HPCB 4JYOX 4R9TA 2J0HA 2J64A 1LTJB 2J0GA 2Q9IB 1FZBC 2WNPF 2XNXC 3HUSC 3H32C 1LWUB 2HODC 1LTJC 2J3UA 2Z4EB 3GHGB 2Q9IC 1N86B 2OYIB 2J3GA 1FIDA 4R9JA 1RE4B 2JHLF 3BVHB 1FZAB 1FZFB 4ZFGA 1FZGB 1FIBA 2OYHC 2J3OA 2HLOB 2J61B 1FZEB 1N86C 1N73B 2JHKF 4M7FA 4JZCA 2HPCC 3FIBA 1FZEC 2J3FD 1FZCB 1Z3SA 2H43B 1RF0B 1JC9A 1LT9B 1RE3B 2JHIF 1LWUC 2JHMF 2Z4EC 3E1IB 3GHGC 1M1JB 2OYIC 4EPUA 1RE4C 1FZBB 2D39A 3BVHC 2GY7A 1FZAC 1FZFC 2XNXB 1FZGC 2J60A 1FZDA 1RF1B 2JHHC 1M1JC 2HLOC 3H32B 1N73C 2FFDB 2HODB 1RF1C 2J3FA 4NYTA 2J1GA 1FZCC 1FICA 4M7HA 2J0YA 2J2PA 2FFDC
chains in the Genus database with same CATH topology
2FIBA 2OYHB 2H43C 1RF0C 1Z3UA 2J61A 1LT9C 1RE3C 3HUSB 2J5ZA 3E1IC 2HPCB 4JYOX 4R9TA 2J0HA 2J64A 1LTJB 2J0GA 2Q9IB 1FZBC 2WNPF 2XNXC 3HUSC 3H32C 1LWUB 2HODC 1LTJC 2J3UA 2Z4EB 2Q9IC 1N86B 2OYIB 2J3GA 1FIDA 4R9JA 1RE4B 2JHLF 3BVHB 1FZAB 1FZFB 4ZFGA 1FZGB 1FIBA 2OYHC 2J3OA 2HLOB 2J61B 1FZEB 1N86C 1N73B 2JHKF 4M7FA 4JZCA 2HPCC 3FIBA 1FZEC 2J3FD 1FZCB 1Z3SA 2H43B 1RF0B 1JC9A 1LT9B 1RE3B 2JHIF 1LWUC 2JHMF 2Z4EC 3E1IB 3GHGC 1M1JB 2OYIC 4EPUA 1RE4C 1FZBB 2D39A 3BVHC 2GY7A 1FZAC 1FZFC 2XNXB 1FZGC 2J60A 1FZDA 1RF1B 2JHHC 1M1JC 2HLOC 3H32B 1N73C 2FFDB 2HODB 1RF1C 2J3FA 4NYTA 2J1GA 1FZCC 1FICA 4M7HA 2J0YA 2J2PA 2FFDC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FIB A;  2OYH B;  2H43 C;  1RF0 C;  1Z3U A;  2J61 A;  1LT9 C;  1RE3 C;  3HUS B;  2J5Z A;  3E1I C;  2HPC B;  4JYO X;  4R9T A;  2J0H A;  2J64 A;  1LTJ B;  2J0G A;  2Q9I B;  1FZB C;  2WNP F;  2XNX C;  3HUS C;  3H32 C;  1LWU B;  2HOD C;  1LTJ C;  2J3U A;  2Z4E B;  2Q9I C;  1N86 B;  2OYI B;  2J3G A;  1FID A;  4R9J A;  1RE4 B;  2JHL F;  3BVH B;  1FZA B;  1FZF B;  4ZFG A;  1FZG B;  1FIB A;  2OYH C;  2J3O A;  2HLO B;  2J61 B;  1FZE B;  1N86 C;  1N73 B;  2JHK F;  4M7F A;  4JZC A;  2HPC C;  3FIB A;  1FZE C;  2J3F D;  1FZC B;  1Z3S A;  2H43 B;  1RF0 B;  1JC9 A;  1LT9 B;  1RE3 B;  2JHI F;  1LWU C;  2JHM F;  2Z4E C;  3E1I B;  3GHG C;  1M1J B;  2OYI C;  4EPU A;  1RE4 C;  1FZB B;  2D39 A;  3BVH C;  2GY7 A;  1FZA C;  1FZF C;  2XNX B;  1FZG C;  2J60 A;  1FZD A;  1RF1 B;  2JHH C;  1M1J C;  2HLO C;  3H32 B;  1N73 C;  2FFD B;  2HOD B;  1RF1 C;  2J3F A;  4NYT A;  2J1G A;  1FZC C;  1FIC A;  4M7H A;  2J0Y A;  2J2P A;  2FFD C; 
#chains in the Genus database with same CATH topology
 2FIB A;  2OYH B;  2H43 C;  1RF0 C;  1Z3U A;  2J61 A;  1LT9 C;  1RE3 C;  3HUS B;  2J5Z A;  3E1I C;  2HPC B;  4JYO X;  4R9T A;  2J0H A;  2J64 A;  1LTJ B;  2J0G A;  2Q9I B;  1FZB C;  2WNP F;  2XNX C;  3HUS C;  3H32 C;  1LWU B;  2HOD C;  1LTJ C;  2J3U A;  2Z4E B;  3GHG B;  2Q9I C;  1N86 B;  2OYI B;  2J3G A;  1FID A;  4R9J A;  1RE4 B;  2JHL F;  3BVH B;  1FZA B;  1FZF B;  4ZFG A;  1FZG B;  1FIB A;  2OYH C;  2J3O A;  2HLO B;  2J61 B;  1FZE B;  1N86 C;  1N73 B;  2JHK F;  4M7F A;  4JZC A;  2HPC C;  3FIB A;  1FZE C;  2J3F D;  1FZC B;  1Z3S A;  2H43 B;  1RF0 B;  1JC9 A;  1LT9 B;  1RE3 B;  2JHI F;  1LWU C;  2JHM F;  2Z4E C;  3E1I B;  3GHG C;  1M1J B;  2OYI C;  4EPU A;  1RE4 C;  1FZB B;  2D39 A;  3BVH C;  2GY7 A;  1FZA C;  1FZF C;  2XNX B;  1FZG C;  2J60 A;  1FZD A;  1RF1 B;  2JHH C;  1M1J C;  2HLO C;  3H32 B;  1N73 C;  2FFD B;  2HOD B;  1RF1 C;  2J3F A;  4NYT A;  2J1G A;  1FZC C;  1FIC A;  4M7H A;  2J0Y A;  2J2P A;  2FFD C; 
#chains in the Genus database with same CATH homology
 2FIB A;  2OYH B;  2H43 C;  1RF0 C;  1Z3U A;  2J61 A;  1LT9 C;  1RE3 C;  3HUS B;  2J5Z A;  3E1I C;  2HPC B;  4JYO X;  4R9T A;  2J0H A;  2J64 A;  1LTJ B;  2J0G A;  2Q9I B;  1FZB C;  2WNP F;  2XNX C;  3HUS C;  3H32 C;  1LWU B;  2HOD C;  1LTJ C;  2J3U A;  2Z4E B;  2Q9I C;  1N86 B;  2OYI B;  2J3G A;  1FID A;  4R9J A;  1RE4 B;  2JHL F;  3BVH B;  1FZA B;  1FZF B;  4ZFG A;  1FZG B;  1FIB A;  2OYH C;  2J3O A;  2HLO B;  2J61 B;  1FZE B;  1N86 C;  1N73 B;  2JHK F;  4M7F A;  4JZC A;  2HPC C;  3FIB A;  1FZE C;  2J3F D;  1FZC B;  1Z3S A;  2H43 B;  1RF0 B;  1JC9 A;  1LT9 B;  1RE3 B;  2JHI F;  1LWU C;  2JHM F;  2Z4E C;  3E1I B;  3GHG C;  1M1J B;  2OYI C;  4EPU A;  1RE4 C;  1FZB B;  2D39 A;  3BVH C;  2GY7 A;  1FZA C;  1FZF C;  2XNX B;  1FZG C;  2J60 A;  1FZD A;  1RF1 B;  2JHH C;  1M1J C;  2HLO C;  3H32 B;  1N73 C;  2FFD B;  2HOD B;  1RF1 C;  2J3F A;  4NYT A;  2J1G A;  1FZC C;  1FIC A;  4M7H A;  2J0Y A;  2J2P A;  2FFD C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...