2J60A

H-ficolin complexed to d-fucose
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
214
structure length
214
Chain Sequence
CQEGPRNCRELLSQGATLSGWYHLCLPEGRALPVFCDMDTEGGGWLVFQRRQDGSVDFFRSWSSYRAGFGNQESEFWLGNENLHQLTLQGNWELRVELEDFNGNRTFAHYATFRLLGEVDHYQLALGKFSEGTAGDSLSLHSGRPFTTYDADHDSSNSNCAVIVHGAWWYASCYRSNLNGRYAVSEAAAHKYGIDWASGRGVGHPYRRVRMMLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FICOLIN-3
publication title Structural Insights Into the Innate Immune Recognition Specificities of L- and H-Ficolins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lectin
total genus 63
structure length 214
sequence length 214
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2006-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 2j60A01
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 2j60A02
2OYHC 2HLOC 2J60A 1FZEC 1FZFB 2HPCC 2XNXB 1FZGC 2JHKF 2JHHC 2H43C 2OYHB 2FFDC 2HLOB 3E1IC 1N73C 1FZEB 2OYIC 2HPCB 2J1GA 1FZGB 1M1JC 3BVHC 2H43B 1FZBC 2JHIF 1RF1C 2J3UA 2FFDB 1JC9A 3E1IB 1N73B 3FIBA 2OYIB 4JZCA 1FIDA 1M1JB 3BVHB 2GY7A 2WNPF 2J3FA 1FZBB 2J5ZA 1RF1B 3H32C 2HODC 2J64A 4ZFGA 1RF0C 2J0YA 3H32B 2HODB 1FIBA 2J0GA 4R9JA 1LTJC 1RE3C 1RF0B 1LWUC 1FICA 1LTJB 2Z4EC 2JHLF 1RE3B 3GHGC 1FZAC 1RE4C 2J0HA 1LWUB 1LT9C 4R9TA 4M7FA 4M7HA 2Z4EB 4JYOX 3HUSC 1FZAB 2J3GA 1RE4B 2J3OA 4NYTA 1N86C 1FZCC 2Q9IC 1LT9B 2J2PA 4EPUA 1Z3SA 2J3FD 2JHMF 1Z3UA 1FZDA 3HUSB 1FZFC 2FIBA 1FZCB 1N86B 2D39A 2J61B 2XNXC 2Q9IB 2J61A
chains in the Genus database with same CATH superfamily
2OYHC 2HLOC 2J60A 1FZEC 1FZFB 2HPCC 2XNXB 1FZGC 2JHKF 2JHHC 2H43C 2OYHB 2FFDC 2HLOB 3E1IC 1N73C 1FZEB 2OYIC 2HPCB 2J1GA 1FZGB 1M1JC 3BVHC 2H43B 1FZBC 2JHIF 1RF1C 2J3UA 2FFDB 1JC9A 3E1IB 1N73B 3FIBA 2OYIB 4JZCA 1FIDA 1M1JB 3BVHB 2GY7A 2WNPF 2J3FA 1FZBB 2J5ZA 1RF1B 3H32C 2HODC 2J64A 4ZFGA 1RF0C 2J0YA 3H32B 2HODB 1FIBA 2J0GA 4R9JA 1LTJC 1RE3C 1RF0B 1LWUC 1FICA 1LTJB 2Z4EC 2JHLF 1RE3B 3GHGC 1FZAC 1RE4C 2J0HA 1LWUB 1LT9C 4R9TA 4M7FA 4M7HA 2Z4EB 4JYOX 3GHGB 3HUSC 1FZAB 2J3GA 1RE4B 2J3OA 4NYTA 1N86C 1FZCC 2Q9IC 1LT9B 2J2PA 4EPUA 1Z3SA 2J3FD 2JHMF 1Z3UA 1FZDA 3HUSB 1FZFC 2FIBA 1FZCB 1N86B 2D39A 2J61B 2XNXC 2Q9IB 2J61A
chains in the Genus database with same CATH topology
2OYHC 2HLOC 2J60A 1FZEC 1FZFB 2HPCC 2XNXB 1FZGC 2JHKF 2JHHC 2H43C 2OYHB 2FFDC 2HLOB 3E1IC 1N73C 1FZEB 2OYIC 2HPCB 2J1GA 1FZGB 1M1JC 3BVHC 2H43B 1FZBC 2JHIF 1RF1C 2J3UA 2FFDB 1JC9A 3E1IB 1N73B 3FIBA 2OYIB 4JZCA 1FIDA 1M1JB 3BVHB 2GY7A 2WNPF 2J3FA 1FZBB 2J5ZA 1RF1B 3H32C 2HODC 2J64A 4ZFGA 1RF0C 2J0YA 3H32B 2HODB 1FIBA 2J0GA 4R9JA 1LTJC 1RE3C 1RF0B 1LWUC 1FICA 1LTJB 2Z4EC 2JHLF 1RE3B 3GHGC 1FZAC 1RE4C 2J0HA 1LWUB 1LT9C 4R9TA 4M7FA 4M7HA 2Z4EB 4JYOX 3HUSC 1FZAB 2J3GA 1RE4B 2J3OA 4NYTA 1N86C 1FZCC 2Q9IC 1LT9B 2J2PA 4EPUA 1Z3SA 2J3FD 2JHMF 1Z3UA 1FZDA 3HUSB 1FZFC 2FIBA 1FZCB 1N86B 2D39A 2J61B 2XNXC 2Q9IB 2J61A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OYH C;  2HLO C;  2J60 A;  1FZE C;  1FZF B;  2HPC C;  2XNX B;  1FZG C;  2JHK F;  2JHH C;  2H43 C;  2OYH B;  2FFD C;  2HLO B;  3E1I C;  1N73 C;  1FZE B;  2OYI C;  2HPC B;  2J1G A;  1FZG B;  1M1J C;  3BVH C;  2H43 B;  1FZB C;  2JHI F;  1RF1 C;  2J3U A;  2FFD B;  1JC9 A;  3E1I B;  1N73 B;  3FIB A;  2OYI B;  4JZC A;  1FID A;  1M1J B;  3BVH B;  2GY7 A;  2WNP F;  2J3F A;  1FZB B;  2J5Z A;  1RF1 B;  3H32 C;  2HOD C;  2J64 A;  4ZFG A;  1RF0 C;  2J0Y A;  3H32 B;  2HOD B;  1FIB A;  2J0G A;  4R9J A;  1LTJ C;  1RE3 C;  1RF0 B;  1LWU C;  1FIC A;  1LTJ B;  2Z4E C;  2JHL F;  1RE3 B;  3GHG C;  1FZA C;  1RE4 C;  2J0H A;  1LWU B;  1LT9 C;  4R9T A;  4M7F A;  4M7H A;  2Z4E B;  4JYO X;  3HUS C;  1FZA B;  2J3G A;  1RE4 B;  2J3O A;  4NYT A;  1N86 C;  1FZC C;  2Q9I C;  1LT9 B;  2J2P A;  4EPU A;  1Z3S A;  2J3F D;  2JHM F;  1Z3U A;  1FZD A;  3HUS B;  1FZF C;  2FIB A;  1FZC B;  1N86 B;  2D39 A;  2J61 B;  2XNX C;  2Q9I B;  2J61 A; 
#chains in the Genus database with same CATH topology
 2OYH C;  2HLO C;  2J60 A;  1FZE C;  1FZF B;  2HPC C;  2XNX B;  1FZG C;  2JHK F;  2JHH C;  2H43 C;  2OYH B;  2FFD C;  2HLO B;  3E1I C;  1N73 C;  1FZE B;  2OYI C;  2HPC B;  2J1G A;  1FZG B;  1M1J C;  3BVH C;  2H43 B;  1FZB C;  2JHI F;  1RF1 C;  2J3U A;  2FFD B;  1JC9 A;  3E1I B;  1N73 B;  3FIB A;  2OYI B;  4JZC A;  1FID A;  1M1J B;  3BVH B;  2GY7 A;  2WNP F;  2J3F A;  1FZB B;  2J5Z A;  1RF1 B;  3H32 C;  2HOD C;  2J64 A;  4ZFG A;  1RF0 C;  2J0Y A;  3H32 B;  2HOD B;  1FIB A;  2J0G A;  4R9J A;  1LTJ C;  1RE3 C;  1RF0 B;  1LWU C;  1FIC A;  1LTJ B;  2Z4E C;  2JHL F;  1RE3 B;  3GHG C;  1FZA C;  1RE4 C;  2J0H A;  1LWU B;  1LT9 C;  4R9T A;  4M7F A;  4M7H A;  2Z4E B;  4JYO X;  3GHG B;  3HUS C;  1FZA B;  2J3G A;  1RE4 B;  2J3O A;  4NYT A;  1N86 C;  1FZC C;  2Q9I C;  1LT9 B;  2J2P A;  4EPU A;  1Z3S A;  2J3F D;  2JHM F;  1Z3U A;  1FZD A;  3HUS B;  1FZF C;  2FIB A;  1FZC B;  1N86 B;  2D39 A;  2J61 B;  2XNX C;  2Q9I B;  2J61 A; 
#chains in the Genus database with same CATH homology
 2OYH C;  2HLO C;  2J60 A;  1FZE C;  1FZF B;  2HPC C;  2XNX B;  1FZG C;  2JHK F;  2JHH C;  2H43 C;  2OYH B;  2FFD C;  2HLO B;  3E1I C;  1N73 C;  1FZE B;  2OYI C;  2HPC B;  2J1G A;  1FZG B;  1M1J C;  3BVH C;  2H43 B;  1FZB C;  2JHI F;  1RF1 C;  2J3U A;  2FFD B;  1JC9 A;  3E1I B;  1N73 B;  3FIB A;  2OYI B;  4JZC A;  1FID A;  1M1J B;  3BVH B;  2GY7 A;  2WNP F;  2J3F A;  1FZB B;  2J5Z A;  1RF1 B;  3H32 C;  2HOD C;  2J64 A;  4ZFG A;  1RF0 C;  2J0Y A;  3H32 B;  2HOD B;  1FIB A;  2J0G A;  4R9J A;  1LTJ C;  1RE3 C;  1RF0 B;  1LWU C;  1FIC A;  1LTJ B;  2Z4E C;  2JHL F;  1RE3 B;  3GHG C;  1FZA C;  1RE4 C;  2J0H A;  1LWU B;  1LT9 C;  4R9T A;  4M7F A;  4M7H A;  2Z4E B;  4JYO X;  3HUS C;  1FZA B;  2J3G A;  1RE4 B;  2J3O A;  4NYT A;  1N86 C;  1FZC C;  2Q9I C;  1LT9 B;  2J2P A;  4EPU A;  1Z3S A;  2J3F D;  2JHM F;  1Z3U A;  1FZD A;  3HUS B;  1FZF C;  2FIB A;  1FZC B;  1N86 B;  2D39 A;  2J61 B;  2XNX C;  2Q9I B;  2J61 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...