2OYHC

Crystal structure of fragment d of gammad298,301a fibrinogen with the peptide ligand gly-his-arg-pro-amide
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
299
structure length
299
Chain Sequence
YEASILTHDSSIRYLQEIYNSNNQKIVNLKEKVAQLEAQCQEPCKDTVQIHDITGKDCQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQSAIPYALRVELEDWNGRTSTADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDAPSAKFFTSHNGMQFSTWDNDNDKFEGNCAEQDGSGWWMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIPFNRLTI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibrinogen alpha chain
publication title Probing the gamma2 Calcium-Binding Site: Studies with gammaD298,301A Fibrinogen Reveal Changes in the gamma294-301 Loop that Alter the Integrity of the "a" Polymerization Site.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
total genus 89
structure length 299
sequence length 299
chains with identical sequence F
ec nomenclature
pdb deposition date 2007-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2oyhC01
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 2oyhC02
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 2oyhC03
1LT9C 1RE3A 2Q9IB 1LTJA 1LT9B 1FZEA 1FZCA 2A45H 1FICA 3GHGC 2J3FA 2Z4EA 2J61A 1RF0C 2XNXA 2J3FD 3E1IC 4JYOX 1RF0B 1RE4C 2JHHC 2HPCC 1RE4B 2OYHA 3HUSA 2HPCB 1N86C 2Q9IA 1RF1C 1LT9A 1JY2O 2A45I 2FFDB 1JY2P 2J3OA 2J1GA 1FZBA 1Z3UA 1N73C 1RF0A 1FZFC 2JHKF 2J0GA 1RE4A 1FZAC 2HPCA 3FIBA 2J3GA 3GHGB 3E1IB 1FIBA 3H32C 2FFDA 1W2EA 3H32B 2HODC 1N86B 2HLOC 2HODB 1RF1B 2HLOB 4EPUA 3GHGA 1M1JC 1JY2N 1LWUC 3E1IA 1N73B 1FIDA 1RE3C 4M7HA 1FZFB 1LTJC 2H43C 2J0HA 4R9JA 1FZAB 2JHMF 2H43B 1N86A 1FZEC 1FZCC 2D39A 2HODA 1RF1A 1JC9A 2J2PA 2HLOA 4NYTA 2XNXC 2OYHC 3HUSC 3BVHC 1N73A 1FZDA 2J3UA 2Q9IC 3HUSB 3BVHB 1FZFA 4M7FA 2JHIF 2A45G 1FZGC 2H43A 1FZAA 1Z3SA 1FZGB 2FIBA 2OYIC 2GY7A 2J0YA 1M1JB 2OYIB 1FZBC 1LWUB 1FZBB 3H32A 1RE3B 2J5ZA 4ZFGA 4R9TA 1LTJB 2JHLF 1JY3O 4JZCA 3BVHA 1FZEB 2Z4EC 1FZCB 2J61B 2Z4EB 1JY3P 2J64A 1FZGA 2J60A 2XNXB 2FFDC 2WNPF 1JY3N 1M1JA 2OYIA 1T3UA 2OYHB 1LWUA
chains in the Genus database with same CATH superfamily
1SQVJ 2XV5A 1LT9B 2DW3A 1JEKA 3CCQP 2A45H 2J3FA 1RF0C 2POHA 1G2CB 1RE4B 2OYHA 1CW5A 4YXDC 2CPBA 2QG4A 1LTIC 1L4AC 2Z5HA 4XA4A 1BDDA 1P84I 1NU1G 3M06A 4ASWA 1JMMA 3O6QA 1W2BO 1U57A 3H1KD 4RJTA 1X8YA 1OMIA 1MZ9A 5BVZA 2WSSH 2W6AA 3M91A 5APYA 2WSEH 3L74J 5CCHC 2ZT9C 1FBMA 1HH0A 3H1LD 4KT0J 1L0LJ 3HE4A 3B5NB 2HLOB 3L75D 3R4YA 3CXHD 1SQPJ 2QE7H 1M1KQ 3CCSP 1M8OB 5AW0B 1N73B 3L71G 1N2DC 1GTWA 4UB6E 1S3JA 1FJPA 1FZEC 2N1TA 2QM8A 1Q81Q 1LTGC 1CI6A 3H1JD 1FZFA 2FYNB 3D6ZA 1HJBA 1SQVE 2YXQB 2FIBA 3PH0A 3HD7B 1M1JB 1NKNA 4PD4I 3AECC 3PLNA 2W90A 1NTZJ 4GOEA 3R2PA 1PP9D 4HH2A 2KSJA 3BATA 2D2CC 4HKZH 4IOIH 2KOGA 3AE9C 2OYHB 1N7SC 3B8EB 1L0NJ 4JYOX 3O6QB 1S1CX 5BU8B 1CZQA 2QJKC 1KFMA 1N86C 2KIKA 4UB6H 1VPCA 1VQ4P 1URQA 1EQ7A 1OVUA 1YQ4C 1QEXA 3FWNA 4RO0A 4EI2A 1L0LE 1VQ8P 2W83C 5AW4B 4W7ZA 1SQPE 4Z1MH 5CBNA 1R5LA 1M7LA 3HE4B 2W6JH 3OAKA 1FIBA 1PGJA 2P58A 5GTHE 2N1TB 4Y99C 1AV1A 1KFNA 2BCCD 1CI6B 4H0LD 1FZFB 3KYQA 3AEGC 3S1KA 2E5YA 5KAFE 4JYBA 4JQ0D 2L5GB 2E74D 4M3LA 3V4QA 3HUSC 3L4FA 2RKLA 5H2FH 3WUTA 3OA7A 2LXCB 4IL6E 1BSNA 1VDFA 4PJ0E 1VQMP 1JY3O 3FXDA 2RN0A 1VF5B 5AVQB 1LWUA 1M56D 1RE3A 2A06G 1URQB 5GTHH 3CWBD 2J61A 1NH4A 3E1IC 1GMJA 2FXOA 3RK2D 3V2NA 2HPCC 1IJDB 4WY4D 1SQBD 2I8DA 1EDLA 5KAFH 1JY2O 1NTKG 2R5DA 2B88A 1FZBA 2R44A 1GK4A 2NPSD 4C46A 4N78D 5KJ7D 2BEZF 1SQQG 4A7PA 3G71P 1M90Q 4PV1C 3P7KA 2JR8A 1DH3A 3N4XA 3AE2C 3GHGA 5AVSB 1X9VA 5APSA 1OVRA 2FYUG 3CC4P 2HODA 5KLVG 3L74D 3GG2A 1EZVI 3CX5E 3CD6P 4H13C 3BVHC 2R32A 1HVVA 3H6PA 5APVA 2A45G 2I1KA 5AVRB 1R8EA 2WSCH 1ZLLA 3ABVC 1LWUB 2QIWA 4OGQC 1RE3B 2YIUC 2FYUK 2JJLA 2MJZA 1H8AA 4JF7A 3CPWO 5KLVK 3K5BA 2P2UA 2J61B 3TGUD 3A2AA 3TK1A 2OYIA 1KB9D 3AEAC 1S5LX 2YXRB 1BE3J 2KLUA 1BCCD 2W8ZA 3H1IG 1YJNP 2P7JA 1FICA 2KXPB 1NTZD 1NTMD 1LJ2A 3KZIE 2JEEA 4R4MA 3L73G 2HFED 2A45I 1SP4A 2QA4P 2ITAA 4UB8H 1L0ND 2H7HA 3H1KJ 2ZAEB 1DD4A 2G3AA 3GHGB 1U7JA 4D6TG 1GU5A 4EYYQ 2QJPB 1KYOE 1QVFO 4RESB 2QEXP 3PP5A 2HODB 1IK7A 3H1LJ 2HG5D 3GW6A 3GMAA 3A5TA 2WWWA 3BRTB 3TNUA 4TLFA 1RH5B 2C0XA 2IZ0A 1KILD 3V6IA 1FZGC 3H1JJ 1BE3E 1KV4A 2OYIB 3VYIA 2JO1A 4YXWH 3MD0A 4JZCA 1S9KD 1NU1D 1PP9J 2WNPF 5TJHA 1G1JA 3A0HE 1SQVG 2FXPA 1AJYA 4JYCA 1OFCX 3H1KE 2WPVB 1FDOA 5K5GB 1BDCA 4H44D 3CC2P 4U7JA 2ZXEB 4EOTA 4YTPC 5GTIE 3B5NC 4XFJA 2FKWB 4IFMA 3D71A 3L71D 2J1GA 3H1LE 1N73C 2QM7A 1WMKA 1SQVK 3CXHE 5KJ7A 4L74A 1QL2A 1H89A 3RK3B 4H0LB 4WB4A 1EDIA 3H32C 1ZR2A 1L4AD 3L72D 3L70J 4AYCA 3KDPB 2FYNC 1YBKA 4DCKA 2KZJA 2E74B 3HD7C 1M1JC 1G2CA 3H1JE 1AQ5A 3IF4A 2BCCJ 4JBZA 3C9IA 2M0BA 2E42A 1VQPP 1JO5A 1JMBA 3E7KA 5APWA 2OYHC 1PP9E 1L0LK 1HGVA 4EIJA 1SQPK 1EDKA 2MKVA 3TYYA 1KD1Q 1DD3A 3MTUE 2KP8A 3VMYA 1G1IA 1QL1A 2K1AA 4KHXA 3P8MC 1IFNA 1K04A 1MFTA 2GUSA 4XE5B 1E79H 2PAJA 2YMKA 3Q2YA 1SQBJ 1JM0A 2N1TC 3AE6C 1ZMEC 2BEQD 1RHZB 4I1LA 1NVOA 2IPPA 1XTCC 1Z3UA 2OYOA 3FWLA 1FZFC 1YYCA 2J58A 3RL0g 2BCCE 2K37A 5E79H 2J3GA 1SQXG 1Q82Q 2FFDA 4B86A 4GOFA 1BGYG 3M0DA 2O01N 3BRVB 4M7HA 1GL2D 1NYHA 3L36A 1J1EB 1HUCA 4LC1A 2R3CA 1SQXK 1IK9A 1T3JA 1VF5C 1KTMA 2E76D 2NZ2A 1KILA 1PV3A 2A06D 4TT3H 1EDJA 1X0TA 1PPJD 1URQC 3T97A 3SFDC 1E5WA 1R5SA 3GF7A 1OW8A 3CCVP 4AQRD 3VTPC 3SFEC 2M5AA 2O01J 3PTZA 2JHLF 3CWBE 1NTKD 3SWFA 2Z4EC 1YJ9P 3V5BA 1SQBE 1VQNP 2WPSA 3TGUJ 2I1JA 4HB1A 1DX7A 1SQQD 1PL5A 1AQTA 1BCCJ 3Q3DA 2WPRA 2E43A 1JB0J 3H1HG 4N78E 2JHHC 1NTMJ 4DOJA 3SSUA 3CMAP 2QJYC 2FFDB 1UIXA 3P8CD 1MUUA 3CCLP 1RF0A 5KKZC 1J1DB 4N6JA 3MGNA 4ZKUA 2JKVA 3C8VA 2FBWC 1KQSO 1L4AA 1UIIA 1HGZA 3G4SP 5AW3B 2YKQA 3IR9A 5CCGD 2QVAA 4OWFA 2GUVA 3L74E 1T2KD 2P10A 3AEEC 1VQ6P 3EWKA 1YTZT 2IFMA 1GK6A 2NRGA 1KILB 1PIXA 1LWUC 1RE3C 2V7QJ 3T97B 2KSEA 1RF1A 1KQGB 3L70D 1OW6A 2M5AB 2YMYA 3JCUE 5TISE 1X22A 3H1ID 5L8RJ 3TGUE 2IBZD 5CJ4A 1KB9E 3TSIA 3RK3D 2K9JA 1K73Q 3BASA 1FZBC 2P67A 2XZRA 1PGPA 3M9BA 1BCCE 4MN4C 1AFOA 4U3FG 2J5UA 2OTLP 1NTZE 1NTME 1SFCC 2J59M 1NU1J 3MIWA 4H44B 1IO4A 5AVXB 2L91A 2K9YA 1VQKP 1JTHA 1HJ0A 1T8ZA 2PRRA 3B71A 4D6TD 3GHGC 2XNXA 1L0NE 1RF0B 1FE6A 1KYOI 2JP3A 1T6AA 5AVUB 1N7SA 2QSIA 1IZNB 2O01H 2W27A 3BCCD 1L4AB 3B4SA 3TF5A 2WITA 3JCUH 3L71J 5KAIE 2IDBA 5BU5A 3M9QA 3F5HA 4ASVA 3RBZA 3L72J 1RF1B 1EZVG 1NAFA 1L2PA 4GKGA 2OQQA 1KILE 5B66E 2E5TA 3LW5J 3L75G 1GL2A 3VN0A 2K9JB 4IL6H 1A02J 2IYPA 4N3YB 4YPCA 2FY8A 2IYOA 3U1CA 1DIPA 4PJ0H 2B9BA 1S9KE 1FZDA 1NU1E 4LLHA 4M7FA 1X79B 1DEEG 1KZUB 2HR3A 3AE7C 1VQ7P 3H1JG 4WBAA 3AE3C 1EC5A 1JTHB 1HTLC 1YITP 2ZFCA 3A7OA 1YIJP 2XNDH 2XNXB 2KNCA 1JY3N 4I6MC 1SVFA 1NHLA 1N7SB 1Q7YQ 3L71E 5AW1B 3CCEP 1PFIA 5B66H 4H0LC 1IFIA 1DEBA 3HTKA 1WT6A 2QJKB 3OJAB 4Y28J 3L72E 2E74C 1ZN5A 3ITKA 1IFJA 5CMZA 2HPCA 2OARA 1Q86Q 1HWTC 1HBWA 1GL2B 5CCGA 4BWNA 2KK7A 2P1JA 1CSBA 1KMIZ 2KUBA 3KXDA 1MV8A 4OVNF 5CJ0A 2E75D 2PP6A 2E76B 2YKOA 2O1JA 3CX5H 4HJGH 3RL0D 2H43C 3WUVA 1Y8AA 3Q5SA 2Q3IA 3I56P 3MP7B 4GIFA 3RK2C 3AE8C 4WY4C 3Q5PA 1P84D 2J3UA 3HUSB 1ZRTD 5B5EE 1GW3A 2IZ1A 2KNCB 2AEFA 3S4RA 2NPSC 2Q1KA 2J5ZA 2KS1A 2ZVOB 3S9OA 3BVHA 3M9HA 1NTKJ 1VQLP 2V4HA 1GU4A 1LTAC 3HTKB 3KZIH 5AVWB 1LT9C 1LTJA 1SQQJ 1ZR4A 3CWBG 1RE4C 2HPCB 1BGYD 3KQGA 2Q9IA 2ZYGA 2KYVA 4EDFA 1VQOP 1KYOH 2WMMA 1HF9A 3M0AA 4PD4D 1FOSE 2JHKF 2FYUJ 5KLVJ 4BRYB 1ZOYC 2FYZA 1RQVA 1OX3A 3V2QA 5APXA 2HLOC 1SQBK 2AXTE 3NFQA 5C39A 2A06E 2R5BA 4I7ZB 4DZOA 1PPJE 1Y47A 1IFPA 2LXBA 3VMAA 3PHLA 1GD2E 2CK3H 2JDIH 3MUDC 1NTKE 1OZHA 4GT1A 2KS1B 1QX8A 3L74G 3USSA 3BVHB 4L75A 1M57D 1L0LG 1MFZA 1FU1A 1FZAA 3H1IJ 1SQPG 2AEJA 3H1HD 3CL3D 2WSEJ 3A0HH 1SQQE 3VP9A 1LTJB 4KJMA 5CCHD 2ZT9D 1H88A 2KZIA 3H25A 3L73J 1FZGA 1NJIQ 1KC8Q 2FFDC 3IFMA 1J1DC 2Q9IB 2K88A 5GTIH 3MZWB 3P8CE 1LP1A 1FZCA 1KORA 2N9BA 2XDJA 4D6TJ 4K3AA 3CXHH 2Q5UA 1NTZG 2WT7A 3BCCJ 3II6A 4WVZA 2H88C 1KILC 1AA0A 5AW7B 2SPZA 1A02F 2CPSA 1L0NG 3HE5A 4ZKPA 3NTNA 1OXZA 2D2CD 1NTZK 2YNYA 1OW7A 1N7SD 3L70E 2KLVA 4L73A 1KB9I 3QWOC 3H1IE 4U3FD 4L76A 2IBZE 3FGAD 3AEBC 4R9JA 3RK3E 1FZAB 4WWIA 1LGHB 1L0NK 3JSVC 2Y0CA 4H44C 4C7RA 3NMDA 3CI9A 1VQ5P 1ZP0C 1FZGB 2Q6QA 5DJUB 5AVZB 1KN7A 2GY7A 2M3EA 2UWJE 2Z5IA 4D6TE 1Q2NA 1OWAA 1RQUA 1LP1B 1FZCB 2Y0DA 4O9BA 3LIEA 4RKUJ 2N9YB 2VRSA 1KQLA 1AVYA 3BCCE 4DT0A 1K8AQ 2WT7B 3U59A 1K9MQ 4IL6X 2AXCA 3QH9A 1FC2C 1SFCD 4ZNCA 1EZVD 1EXJA 1RF1C 1LNQA 1FOSF 3A3YB 3CCMP 3V2PA 3HE5B 2GA1A 3MHVA 1NU1K 1AVOA 3C1LA 1QGKB 5DJTB 5APQA 4CPGA 2E75B 2J0GA 4QMAA 4W80A 4JPZB 3RL0B 3SWKA 3H32B 3L37A 4W7YA 2R3SA 3VMZA 3EQ2A 3L72G 2LR2A 2WPQA 1NWQA 5KLIB 1FS0E 1ZW0A 2Q3EA 3CLQA 2Q7CA 2FYUD 5KLVD 2IX7C 2ZYAA 2XNXC 3CX5I 1PGOA 1OVVA 3W68A 2QRXA 2G8YA 2H89C 1U7MA 2BASA 5CCHA 3HRNA 4PV1D 5H2FE 1JY3P 2WVRA 2J64A 1FAVA 4AUWA 5CHXA 4ZMDA 2WTYA 3U1AA 3OW2O 1FZEA 1SQXJ 3Q5RA 2Z4EA 3D70A 1LT1A 1GL2C 4K35A 5CBOA 1JCCA 3L73D 4H13D 1BGYJ 2E76C 1W5CE 2WSCJ 1JY2P 2J3OA 1BE3G 4OGQD 2HYNA 2QJPC 1YHQP 3V4WA 5AW2B 3W67A 2K3RA 2HODC 2ZVNB 3GF3A 1P84E 1QLED 5TISH 1FIDA 5KTBA 2C9LY 1ZRTE 1ZXGA 1QVGO 3H1KG 2JHMF 1KB9H 1N86A 2D39A 1SLQA 3CCJP 2ZT9B 2WSFJ 3EFGA 3H1LG 3VP8A 1PPJG 1K05A 1MKMA 2XU6A 2OYIC 1LTTC 1TU3F 5AVVB 3H1HJ 3ZDMA 1SQXE 4LGDE 4ZFGA 1PGQA 3CCRP 2B89A 1FJKA 3I55P 1FZEB 2C9NY 2Z4EB 1H0TA 4NPEA 2C0WA 2YO2A 4GDOA 1BGYE 5CCGC 1SQVD 4NPFX 3GLMA 1YJWP 1T2KC 2O1KA 2B87A 1P84H 2PGDA 3N7NA 3V2RA 1NAYA 4PD4E 1SFCA 3G6EP 2Y9ZA 5KAIH 3HUSA 2V7QH 2H8PD 1XTGB 1NTKK 1PP9G 3O8ZA 4DJGA 4I7ZC 2D2CB 2QJYB 5EFWB 3CXHI 5KKZB 3RK3C 1SQQK 2ZXXA 1W2EA 5APTA 1L0LD 1N86B 4UB8E 1SQPD 1USEA 2XKMA 2OTJP 1JY2N 3E1IA 4IFDK 4U3FJ 1LTJC 2RH0A 3VMXA 3H1HE 1S2EA 5M1BA 3Q1MA 5AW5B 5AW9B 1YQ3C 3RBXA 3B5ND 2M3BA 4PD4H 2W6BA 3WUUA 3WU2E 1JCDA 3L70G 2Q9IC 4I2LC 4Y99B 1H0TB 4BRYA 2IBZG 2J0YA 1FZBB 2BCCG 1NGMB 3AEFC 3G9RA 2B87B 4NPDA 3AEDC 2FXMA 4OH8B 1LTBC 1SFCB 5AW8B 1NO4A 1T3UA 3HD7D 3L35A 1RY3A 3NXSA 2OGUA 2WSFH 4C7NA 3A0BE 2J3FD 3FX0A 3LW5H 5KJ7C 1IFMA 3PRJA 1NKZB 1VQ9P 1FDMA 3CC7P 3BCCG 3WU2H 3L75J 2AEMA 2IBZI 1SQXD 1NOHA 1FZAC 4R4LA 1GDTA 4IFFA 3FIBA 4U3FE 3D6YA 3AE5C 1N7LA 3E1IB 4HYTB 2M8RA 1SQBG 1FDIA 3UIAA 1JNMA 3KHUA 2PFXA 5AVTB 1J1EC 1J2JB 2J0HA 5B5EH 1FZCC 3AE1C 2J2PA 3A0BH 2N1TD 1ZV8A 1JUNA 3IAOA 3KPEA 4PV1B 3E1RA 2H43A 1Z3SA 1USDA 1IC2A 1OIPA 2KB7P 4R9TA 4WY4A 3CX5D 2IFNA 2WZ7A 3P32A 4C7NB 3TDKA 3IN6A 1PZQA 4BXLA 1EZVE 1S5LE 1LTSC 3LIDA 4H13B 1GW4A 3F89A 2E75C 2Y0EA 2NPSA 2LKMA 3L75E 2JWAA 1D7MA 3RL0C 1VF5D 2O3JA 4OGQB 1Z56A 3EFFK 2YIUB 3FXEA 3AE4C 1LT9A 1GZLA 2Y9YA 1URQD 2JWDA 5KLIC 3TNUB 3TGUG 2ZYDA 3VOPA 1RE4A 3M0DC 2AXTH 3CMEP 2FYUE 1KQFB 1BCCG 1BSHA 2KI7B 2YO3A 2ZJSE 3RGUA 5KLVE 1JOCA 1Q90D 1NTMG 5AVYB 2YKPA 1SS1A 5AW6B 5E79E 4EPUA 1S5LH 1IFDA 2H43B 3PJSK 1KYOD 2RMZA 1WRGA 3I5CA 3B5NA 1JC9A 1VL2A 2HLOA 2WQYC 4NYTA 1S4XA 3RK2B 2OTKE 1NTMK 4WY4B 1Y9BA 3JC22 5APUA 1N73A 2JHIF 1YTZI 1EXIA 3G3ZA 1S72P 3CWBJ 3H32A 2NPSB 3MUDA 4GODA 1N8RQ 3CCUP 2J60A 3L73E 3HD7A 2GM4A 3WMM0 1M1JA 1BE3D 3SWYA 1YI2P
chains in the Genus database with same CATH topology
2WTYA 1NHLA 1N7SB 2XV5A 3U1AA 1LT9B 5AW1B 1FZEA 4JYCA 2A45H 2J3FA 2Z4EA 1PFIA 1RF0C 2POHA 1G2CB 1IFIA 1DEBA 1GL2C 3HTKA 1WT6A 1RE4B 1JCCA 2OYHA 2ZXEB 1CW5A 4EOTA 2CPBA 3OJAB 1LTIC 3B5NC 1L4AC 2FKWB 2Z5HA 4XA4A 4IFMA 1JY2P 2J3OA 3M06A 2J1GA 1JMMA 1N73C 2QM7A 1ZN5A 1X8YA 1SQVK 5KJ7A 1IFJA 2HYNA 5CMZA 2HPCA 1MZ9A 5BVZA 1QL2A 1H89A 3RK3B 2OARA 2W6AA 4WB4A 3M91A 1HWTC 5APYA 1HBWA 3H32C 1GL2B 1L4AD 1ZR2A 3V4WA 5AW2B 3SWYA 2WSEH 5CCGA 2P1JA 1CSBA 5CCHC 2HODC 1MV8A 1FBMA 5CJ0A 1HH0A 3KDPB 4AYCA 2PP6A 3HE4A 3B5NB 2HLOB 2YKOA 2O1JA 3HD7C 1M1JC 1G2CA 1AQ5A 5AW0B 1N73B 1FIDA 5KTBA 2C9LY 1N2DC 3RL0D 2H43C 3C9IA 1GTWA 2JHMF 2Q3IA 1N86A 1FZEC 1FJPA 2D39A 1SLQA 4GIFA 2N1TA 2QM8A 3RK2C 2E42A 4WY4C 1JO5A 1LTGC 1CI6A 5APWA 2OYHC 2J3UA 3HUSB 1FZFA 3EFGA 1L0LK 1HGVA 4EIJA 1HJBA 1GW3A 3VP8A 2FIBA 2XU6A 2OYIC 1SQPK 1LTTC 3HD7B 1M1JB 1NKNA 5AVVB 2NPSC 2J5ZA 4LGDE 4ZFGA 3TYYA 3R2PA 3MTUE 3BVHA 1FJKA 1FZEB 3M9HA 4HH2A 2C9NY 2KP8A 2KSJA 2Z4EB 3VMYA 2C0WA 1GU4A 2YO2A 3BATA 1G1IA 1LTAC 3HTKB 2KOGA 5CCGC 1QL1A 2OYHB 1N7SC 5AVWB 1T2KC 1LT9C 4KHXA 3P8MC 1LTJA 1IFNA 2O1KA 3B8EB 1ZR4A 3N7NA 2GUSA 3V2RA 4XE5B 4JYOX 2PAJA 1SFCA 1RE4C 5BU8B 1CZQA 1KFMA 3HUSA 2HPCB 3KQGA 1N86C 2Q9IA 1VPCA 1URQA 2KYVA 2N1TC 1EQ7A 2H8PD 1XTGB 1NTKK 4I1LA 3O8ZA 2IPPA 1XTCC 5AW4B 1Z3UA 4W7ZA 3M0AA 1FZFC 1FOSE 2JHKF 1M7LA 3HE4B 1YYCA 2J58A 3RK3C 1SQQK 3OAKA 2J3GA 1FIBA 2FFDA 2FYZA 1W2EA 5APTA 1N86B 3V2QA 5APXA 4B86A 2HLOC 1SQBK 2N1TB 4Y99C 3M0DA 3NFQA 2XKMA 1KFNA 2R5BA 4DZOA 1CI6B 1JY2N 3E1IA 4IFDK 3BRVB 4M7HA 1FZFB 1LTJC 1GL2D 3KYQA 3L36A 3VMXA 1J1EB 1HUCA 4LC1A 1GD2E 2R3CA 1SQXK 4JYBA 1IK9A 1T3JA 5AW5B 5AW9B 2L5GB 3B5ND 2M3BA 2W6BA 4M3LA 1KILA 3V4QA 4GT1A 1JCDA 3HUSC 2Q9IC 3L4FA 3BVHB 4I2LC 1MFZA 1URQC 3OA7A 3T97A 1FU1A 1FZAA 4Y99B 1E5WA 3CL3D 2J0YA 4AQRD 3VTPC 1VDFA 3VP9A 1FZBB 1LTJB 2JHLF 1JY3O 3SWFA 5CCHD 2Z4EC 1H88A 3V5BA 1FZGA 2FXMA 4OH8B 2FFDC 1LTBC 1SFCB 3IFMA 2WPSA 5AW8B 5AVQB 1NO4A 1T3UA 3HD7D 2I1JA 1LWUA 1J1DC 1RE3A 1DX7A 2Q9IB 3L35A 1RY3A 1URQB 3NXSA 3P8CE 1FZCA 2WSFH 4C7NA 2WPRA 2E43A 2J61A 1NH4A 2N9BA 2XDJA 2J3FD 3E1IC 4N78E 3RK2D 3V2NA 5KJ7C 3LW5H 1IFMA 2JHHC 2HPCC 1IJDB 4WY4D 2Q5UA 4DOJA 1NKZB 1FDMA 1JY2O 2WT7A 3II6A 2FFDB 1KILC 2R5DA 5AW7B 3P8CD 1MUUA 1FZBA 1RF0A 1GK4A 1J1DB 2NPSD 4N6JA 4C46A 4N78D 3MGNA 1NOHA 4ZKUA 1FZAC 1A02F 5KJ7D 1GDTA 2CPSA 4IFFA 3FIBA 1L4AA 1N7LA 3HE5A 3E1IB 1HGZA 4ZKPA 3NTNA 4HYTB 1OXZA 5AW3B 2YKQA 3IR9A 1NTZK 2YNYA 5CCGD 2M8RA 2GUVA 1N7SD 2KLVA 3P7KA 1T2KD 1DH3A 3N4XA 3UIAA 1JNMA 1YTZT 2IFMA 1GK6A 3GHGA 1KILB 5AVSB 1LWUC 1X9VA 1RE3C 5AVTB 5APSA 1J1EC 1J2JB 2J0HA 4R9JA 1FZAB 1FZCC 2HODA 1LGHB 1RF1A 1L0NK 2J2PA 2N1TD 1ZV8A 2YMYA 1JUNA 4C7RA 3NMDA 3BVHC 3KPEA 2R32A 1HVVA 3CI9A 3H6PA 5APVA 2A45G 2H43A 5CJ4A 1Z3SA 1FZGB 2I1KA 5AVRB 5AVZB 3TSIA 3RK3D 2GY7A 3BASA 2WSCH 1IC2A 1ZLLA 1FZBC 1LWUB 2KB7P 2P67A 2XZRA 3M9BA 1RE3B 1AFOA 4R9TA 2Z5IA 4WY4A 2FYUK 2JJLA 2MJZA 1H8AA 1OWAA 4JF7A 5KLVK 2IFNA 2WZ7A 3P32A 1FZCB 2P2UA 4C7NB 2J61B 4O9BA 1SFCC 2J59M 3LIEA 3A2AA 3MIWA 1IO4A 5AVXB 2VRSA 3TK1A 1KQLA 2OYIA 1LTSC 3LIDA 1GW4A 2NPSA 1JTHA 2LKMA 2WT7B 1T8ZA 3U59A 2P7JA 1FICA 3GHGC 2XNXA 3RL0C 1RF0B 1Z56A 1SFCD 5AVUB 2JEEA 1N7SA 1RF1C 1LT9A 1GZLA 2O01H 2W27A 1FOSF 3A3YB 1URQD 1L4AB 2HFED 3HE5B 2A45I 3V2PA 3TNUB 1NU1K 2WITA 1SP4A 5APQA 3VOPA 2J0GA 1RE4A 3M0DC 2H7HA 4W80A 5BU5A 3GHGB 2YO3A 1GU5A 3RL0B 1JOCA 3M9QA 3H32B 3L37A 5AVYB 4W7YA 4RESB 3VMZA 3EQ2A 3PP5A 2YKPA 2HODB 1RF1B 1NAFA 5AW6B 2WPQA 4GKGA 1NWQA 4EPUA 2HG5D 3CLQA 2Q7CA 1IFDA 3A5TA 1GL2A 2H43B 3VN0A 1WRGA 2IX7C 3I5CA 2WWWA 3B5NA 1A02J 3BRTB 2HLOA 1JC9A 4NYTA 2XNXC 4N3YB 3TNUA 3RK2B 3U1CA 2C0XA 1NTMK 4WY4B 1KILD 5APUA 1S9KE 1N73A 1FZDA 4LLHA 4M7FA 1X79B 2JHIF 1FZGC 1KZUB 4WBAA 1YTZI 3G3ZA 2OYIB 3VYIA 3H32A 2NPSB 1JTHB 3MUDA 2BASA 3MD0A 5CCHA 4JZCA 3HRNA 1HTLC 1S9KD 2ZFCA 3A7OA 1JY3P 2J64A 1FAVA 2J60A 2XNXB 4AUWA 2WNPF 1JY3N 4I6MC 3HD7A 2GM4A 3WMM0 1M1JA 1G1JA 5CHXA 1SVFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LT9 C;  1RE3 A;  2Q9I B;  1LTJ A;  1LT9 B;  1FZE A;  1FZC A;  2A45 H;  1FIC A;  3GHG C;  2J3F A;  2Z4E A;  2J61 A;  1RF0 C;  2XNX A;  2J3F D;  3E1I C;  4JYO X;  1RF0 B;  1RE4 C;  2JHH C;  2HPC C;  1RE4 B;  2OYH A;  3HUS A;  2HPC B;  1N86 C;  2Q9I A;  1RF1 C;  1LT9 A;  1JY2 O;  2A45 I;  2FFD B;  1JY2 P;  2J3O A;  2J1G A;  1FZB A;  1Z3U A;  1N73 C;  1RF0 A;  1FZF C;  2JHK F;  2J0G A;  1RE4 A;  1FZA C;  2HPC A;  3FIB A;  2J3G A;  3GHG B;  3E1I B;  1FIB A;  3H32 C;  2FFD A;  1W2E A;  3H32 B;  2HOD C;  1N86 B;  2HLO C;  2HOD B;  1RF1 B;  2HLO B;  4EPU A;  3GHG A;  1M1J C;  1JY2 N;  1LWU C;  3E1I A;  1N73 B;  1FID A;  1RE3 C;  4M7H A;  1FZF B;  1LTJ C;  2H43 C;  2J0H A;  4R9J A;  1FZA B;  2JHM F;  2H43 B;  1N86 A;  1FZE C;  1FZC C;  2D39 A;  2HOD A;  1RF1 A;  1JC9 A;  2J2P A;  2HLO A;  4NYT A;  2XNX C;  2OYH C;  3HUS C;  3BVH C;  1N73 A;  1FZD A;  2J3U A;  2Q9I C;  3HUS B;  3BVH B;  1FZF A;  4M7F A;  2JHI F;  2A45 G;  1FZG C;  2H43 A;  1FZA A;  1Z3S A;  1FZG B;  2FIB A;  2OYI C;  2GY7 A;  2J0Y A;  1M1J B;  2OYI B;  1FZB C;  1LWU B;  1FZB B;  3H32 A;  1RE3 B;  2J5Z A;  4ZFG A;  4R9T A;  1LTJ B;  2JHL F;  1JY3 O;  4JZC A;  3BVH A;  1FZE B;  2Z4E C;  1FZC B;  2J61 B;  2Z4E B;  1JY3 P;  2J64 A;  1FZG A;  2J60 A;  2XNX B;  2FFD C;  2WNP F;  1JY3 N;  1M1J A;  2OYI A;  1T3U A;  2OYH B;  1LWU A; 
#chains in the Genus database with same CATH topology
 1SQV J;  2XV5 A;  1LT9 B;  2DW3 A;  1JEK A;  3CCQ P;  2A45 H;  2J3F A;  1RF0 C;  2POH A;  1G2C B;  1RE4 B;  2OYH A;  1CW5 A;  4YXD C;  2CPB A;  2QG4 A;  1LTI C;  1L4A C;  2Z5H A;  4XA4 A;  1BDD A;  1P84 I;  1NU1 G;  3M06 A;  4ASW A;  1JMM A;  3O6Q A;  1W2B O;  1U57 A;  3H1K D;  4RJT A;  1X8Y A;  1OMI A;  1MZ9 A;  5BVZ A;  2WSS H;  2W6A A;  3M91 A;  5APY A;  2WSE H;  3L74 J;  5CCH C;  2ZT9 C;  1FBM A;  1HH0 A;  3H1L D;  4KT0 J;  1L0L J;  3HE4 A;  3B5N B;  2HLO B;  3L75 D;  3R4Y A;  3CXH D;  1SQP J;  2QE7 H;  1M1K Q;  3CCS P;  1M8O B;  5AW0 B;  1N73 B;  3L71 G;  1N2D C;  1GTW A;  4UB6 E;  1S3J A;  1FJP A;  1FZE C;  2N1T A;  2QM8 A;  1Q81 Q;  1LTG C;  1CI6 A;  3H1J D;  1FZF A;  2FYN B;  3D6Z A;  1HJB A;  1SQV E;  2YXQ B;  2FIB A;  3PH0 A;  3HD7 B;  1M1J B;  1NKN A;  4PD4 I;  3AEC C;  3PLN A;  2W90 A;  1NTZ J;  4GOE A;  3R2P A;  1PP9 D;  4HH2 A;  2KSJ A;  3BAT A;  2D2C C;  4HKZ H;  4IOI H;  2KOG A;  3AE9 C;  2OYH B;  1N7S C;  3B8E B;  1L0N J;  4JYO X;  3O6Q B;  1S1C X;  5BU8 B;  1CZQ A;  2QJK C;  1KFM A;  1N86 C;  2KIK A;  4UB6 H;  1VPC A;  1VQ4 P;  1URQ A;  1EQ7 A;  1OVU A;  1YQ4 C;  1QEX A;  3FWN A;  4RO0 A;  4EI2 A;  1L0L E;  1VQ8 P;  2W83 C;  5AW4 B;  4W7Z A;  1SQP E;  4Z1M H;  5CBN A;  1R5L A;  1M7L A;  3HE4 B;  2W6J H;  3OAK A;  1FIB A;  1PGJ A;  2P58 A;  5GTH E;  2N1T B;  4Y99 C;  1AV1 A;  1KFN A;  2BCC D;  1CI6 B;  4H0L D;  1FZF B;  3KYQ A;  3AEG C;  3S1K A;  2E5Y A;  5KAF E;  4JYB A;  4JQ0 D;  2L5G B;  2E74 D;  4M3L A;  3V4Q A;  3HUS C;  3L4F A;  2RKL A;  5H2F H;  3WUT A;  3OA7 A;  2LXC B;  4IL6 E;  1BSN A;  1VDF A;  4PJ0 E;  1VQM P;  1JY3 O;  3FXD A;  2RN0 A;  1VF5 B;  5AVQ B;  1LWU A;  1M56 D;  1RE3 A;  2A06 G;  1URQ B;  5GTH H;  3CWB D;  2J61 A;  1NH4 A;  3E1I C;  1GMJ A;  2FXO A;  3RK2 D;  3V2N A;  2HPC C;  1IJD B;  4WY4 D;  1SQB D;  2I8D A;  1EDL A;  5KAF H;  1JY2 O;  1NTK G;  2R5D A;  2B88 A;  1FZB A;  2R44 A;  1GK4 A;  2NPS D;  4C46 A;  4N78 D;  5KJ7 D;  2BEZ F;  1SQQ G;  4A7P A;  3G71 P;  1M90 Q;  4PV1 C;  3P7K A;  2JR8 A;  1DH3 A;  3N4X A;  3AE2 C;  3GHG A;  5AVS B;  1X9V A;  5APS A;  1OVR A;  2FYU G;  3CC4 P;  2HOD A;  5KLV G;  3L74 D;  3GG2 A;  1EZV I;  3CX5 E;  3CD6 P;  4H13 C;  3BVH C;  2R32 A;  1HVV A;  3H6P A;  5APV A;  2A45 G;  2I1K A;  5AVR B;  1R8E A;  2WSC H;  1ZLL A;  3ABV C;  1LWU B;  2QIW A;  4OGQ C;  1RE3 B;  2YIU C;  2FYU K;  2JJL A;  2MJZ A;  1H8A A;  4JF7 A;  3CPW O;  5KLV K;  3K5B A;  2P2U A;  2J61 B;  3TGU D;  3A2A A;  3TK1 A;  2OYI A;  1KB9 D;  3AEA C;  1S5L X;  2YXR B;  1BE3 J;  2KLU A;  1BCC D;  2W8Z A;  3H1I G;  1YJN P;  2P7J A;  1FIC A;  2KXP B;  1NTZ D;  1NTM D;  1LJ2 A;  3KZI E;  2JEE A;  4R4M A;  3L73 G;  2HFE D;  2A45 I;  1SP4 A;  2QA4 P;  2ITA A;  4UB8 H;  1L0N D;  2H7H A;  3H1K J;  2ZAE B;  1DD4 A;  2G3A A;  3GHG B;  1U7J A;  4D6T G;  1GU5 A;  4EYY Q;  2QJP B;  1KYO E;  1QVF O;  4RES B;  2QEX P;  3PP5 A;  2HOD B;  1IK7 A;  3H1L J;  2HG5 D;  3GW6 A;  3GMA A;  3A5T A;  2WWW A;  3BRT B;  3TNU A;  4TLF A;  1RH5 B;  2C0X A;  2IZ0 A;  1KIL D;  3V6I A;  1FZG C;  3H1J J;  1BE3 E;  1KV4 A;  2OYI B;  3VYI A;  2JO1 A;  4YXW H;  3MD0 A;  4JZC A;  1S9K D;  1NU1 D;  1PP9 J;  2WNP F;  5TJH A;  1G1J A;  3A0H E;  1SQV G;  2FXP A;  1AJY A;  4JYC A;  1OFC X;  3H1K E;  2WPV B;  1FDO A;  5K5G B;  1BDC A;  4H44 D;  3CC2 P;  4U7J A;  2ZXE B;  4EOT A;  4YTP C;  5GTI E;  3B5N C;  4XFJ A;  2FKW B;  4IFM A;  3D71 A;  3L71 D;  2J1G A;  3H1L E;  1N73 C;  2QM7 A;  1WMK A;  1SQV K;  3CXH E;  5KJ7 A;  4L74 A;  1QL2 A;  1H89 A;  3RK3 B;  4H0L B;  4WB4 A;  1EDI A;  3H32 C;  1ZR2 A;  1L4A D;  3L72 D;  3L70 J;  4AYC A;  3KDP B;  2FYN C;  1YBK A;  4DCK A;  2KZJ A;  2E74 B;  3HD7 C;  1M1J C;  1G2C A;  3H1J E;  1AQ5 A;  3IF4 A;  2BCC J;  4JBZ A;  3C9I A;  2M0B A;  2E42 A;  1VQP P;  1JO5 A;  1JMB A;  3E7K A;  5APW A;  2OYH C;  1PP9 E;  1L0L K;  1HGV A;  4EIJ A;  1SQP K;  1EDK A;  2MKV A;  3TYY A;  1KD1 Q;  1DD3 A;  3MTU E;  2KP8 A;  3VMY A;  1G1I A;  1QL1 A;  2K1A A;  4KHX A;  3P8M C;  1IFN A;  1K04 A;  1MFT A;  2GUS A;  4XE5 B;  1E79 H;  2PAJ A;  2YMK A;  3Q2Y A;  1SQB J;  1JM0 A;  2N1T C;  3AE6 C;  1ZME C;  2BEQ D;  1RHZ B;  4I1L A;  1NVO A;  2IPP A;  1XTC C;  1Z3U A;  2OYO A;  3FWL A;  1FZF C;  1YYC A;  2J58 A;  3RL0 g;  2BCC E;  2K37 A;  5E79 H;  2J3G A;  1SQX G;  1Q82 Q;  2FFD A;  4B86 A;  4GOF A;  1BGY G;  3M0D A;  2O01 N;  3BRV B;  4M7H A;  1GL2 D;  1NYH A;  3L36 A;  1J1E B;  1HUC A;  4LC1 A;  2R3C A;  1SQX K;  1IK9 A;  1T3J A;  1VF5 C;  1KTM A;  2E76 D;  2NZ2 A;  1KIL A;  1PV3 A;  2A06 D;  4TT3 H;  1EDJ A;  1X0T A;  1PPJ D;  1URQ C;  3T97 A;  3SFD C;  1E5W A;  1R5S A;  3GF7 A;  1OW8 A;  3CCV P;  4AQR D;  3VTP C;  3SFE C;  2M5A A;  2O01 J;  3PTZ A;  2JHL F;  3CWB E;  1NTK D;  3SWF A;  2Z4E C;  1YJ9 P;  3V5B A;  1SQB E;  1VQN P;  2WPS A;  3TGU J;  2I1J A;  4HB1 A;  1DX7 A;  1SQQ D;  1PL5 A;  1AQT A;  1BCC J;  3Q3D A;  2WPR A;  2E43 A;  1JB0 J;  3H1H G;  4N78 E;  2JHH C;  1NTM J;  4DOJ A;  3SSU A;  3CMA P;  2QJY C;  2FFD B;  1UIX A;  3P8C D;  1MUU A;  3CCL P;  1RF0 A;  5KKZ C;  1J1D B;  4N6J A;  3MGN A;  4ZKU A;  2JKV A;  3C8V A;  2FBW C;  1KQS O;  1L4A A;  1UII A;  1HGZ A;  3G4S P;  5AW3 B;  2YKQ A;  3IR9 A;  5CCG D;  2QVA A;  4OWF A;  2GUV A;  3L74 E;  1T2K D;  2P10 A;  3AEE C;  1VQ6 P;  3EWK A;  1YTZ T;  2IFM A;  1GK6 A;  2NRG A;  1KIL B;  1PIX A;  1LWU C;  1RE3 C;  2V7Q J;  3T97 B;  2KSE A;  1RF1 A;  1KQG B;  3L70 D;  1OW6 A;  2M5A B;  2YMY A;  3JCU E;  5TIS E;  1X22 A;  3H1I D;  5L8R J;  3TGU E;  2IBZ D;  5CJ4 A;  1KB9 E;  3TSI A;  3RK3 D;  2K9J A;  1K73 Q;  3BAS A;  1FZB C;  2P67 A;  2XZR A;  1PGP A;  3M9B A;  1BCC E;  4MN4 C;  1AFO A;  4U3F G;  2J5U A;  2OTL P;  1NTZ E;  1NTM E;  1SFC C;  2J59 M;  1NU1 J;  3MIW A;  4H44 B;  1IO4 A;  5AVX B;  2L91 A;  2K9Y A;  1VQK P;  1JTH A;  1HJ0 A;  1T8Z A;  2PRR A;  3B71 A;  4D6T D;  3GHG C;  2XNX A;  1L0N E;  1RF0 B;  1FE6 A;  1KYO I;  2JP3 A;  1T6A A;  5AVU B;  1N7S A;  2QSI A;  1IZN B;  2O01 H;  2W27 A;  3BCC D;  1L4A B;  3B4S A;  3TF5 A;  2WIT A;  3JCU H;  3L71 J;  5KAI E;  2IDB A;  5BU5 A;  3M9Q A;  3F5H A;  4ASV A;  3RBZ A;  3L72 J;  1RF1 B;  1EZV G;  1NAF A;  1L2P A;  4GKG A;  2OQQ A;  1KIL E;  5B66 E;  2E5T A;  3LW5 J;  3L75 G;  1GL2 A;  3VN0 A;  2K9J B;  4IL6 H;  1A02 J;  2IYP A;  4N3Y B;  4YPC A;  2FY8 A;  2IYO A;  3U1C A;  1DIP A;  4PJ0 H;  2B9B A;  1S9K E;  1FZD A;  1NU1 E;  4LLH A;  4M7F A;  1X79 B;  1DEE G;  1KZU B;  2HR3 A;  3AE7 C;  1VQ7 P;  3H1J G;  4WBA A;  3AE3 C;  1EC5 A;  1JTH B;  1HTL C;  1YIT P;  2ZFC A;  3A7O A;  1YIJ P;  2XND H;  2XNX B;  2KNC A;  1JY3 N;  4I6M C;  1SVF A;  1NHL A;  1N7S B;  1Q7Y Q;  3L71 E;  5AW1 B;  3CCE P;  1PFI A;  5B66 H;  4H0L C;  1IFI A;  1DEB A;  3HTK A;  1WT6 A;  2QJK B;  3OJA B;  4Y28 J;  3L72 E;  2E74 C;  1ZN5 A;  3ITK A;  1IFJ A;  5CMZ A;  2HPC A;  2OAR A;  1Q86 Q;  1HWT C;  1HBW A;  1GL2 B;  5CCG A;  4BWN A;  2KK7 A;  2P1J A;  1CSB A;  1KMI Z;  2KUB A;  3KXD A;  1MV8 A;  4OVN F;  5CJ0 A;  2E75 D;  2PP6 A;  2E76 B;  2YKO A;  2O1J A;  3CX5 H;  4HJG H;  3RL0 D;  2H43 C;  3WUV A;  1Y8A A;  3Q5S A;  2Q3I A;  3I56 P;  3MP7 B;  4GIF A;  3RK2 C;  3AE8 C;  4WY4 C;  3Q5P A;  1P84 D;  2J3U A;  3HUS B;  1ZRT D;  5B5E E;  1GW3 A;  2IZ1 A;  2KNC B;  2AEF A;  3S4R A;  2NPS C;  2Q1K A;  2J5Z A;  2KS1 A;  2ZVO B;  3S9O A;  3BVH A;  3M9H A;  1NTK J;  1VQL P;  2V4H A;  1GU4 A;  1LTA C;  3HTK B;  3KZI H;  5AVW B;  1LT9 C;  1LTJ A;  1SQQ J;  1ZR4 A;  3CWB G;  1RE4 C;  2HPC B;  1BGY D;  3KQG A;  2Q9I A;  2ZYG A;  2KYV A;  4EDF A;  1VQO P;  1KYO H;  2WMM A;  1HF9 A;  3M0A A;  4PD4 D;  1FOS E;  2JHK F;  2FYU J;  5KLV J;  4BRY B;  1ZOY C;  2FYZ A;  1RQV A;  1OX3 A;  3V2Q A;  5APX A;  2HLO C;  1SQB K;  2AXT E;  3NFQ A;  5C39 A;  2A06 E;  2R5B A;  4I7Z B;  4DZO A;  1PPJ E;  1Y47 A;  1IFP A;  2LXB A;  3VMA A;  3PHL A;  1GD2 E;  2CK3 H;  2JDI H;  3MUD C;  1NTK E;  1OZH A;  4GT1 A;  2KS1 B;  1QX8 A;  3L74 G;  3USS A;  3BVH B;  4L75 A;  1M57 D;  1L0L G;  1MFZ A;  1FU1 A;  1FZA A;  3H1I J;  1SQP G;  2AEJ A;  3H1H D;  3CL3 D;  2WSE J;  3A0H H;  1SQQ E;  3VP9 A;  1LTJ B;  4KJM A;  5CCH D;  2ZT9 D;  1H88 A;  2KZI A;  3H25 A;  3L73 J;  1FZG A;  1NJI Q;  1KC8 Q;  2FFD C;  3IFM A;  1J1D C;  2Q9I B;  2K88 A;  5GTI H;  3MZW B;  3P8C E;  1LP1 A;  1FZC A;  1KOR A;  2N9B A;  2XDJ A;  4D6T J;  4K3A A;  3CXH H;  2Q5U A;  1NTZ G;  2WT7 A;  3BCC J;  3II6 A;  4WVZ A;  2H88 C;  1KIL C;  1AA0 A;  5AW7 B;  2SPZ A;  1A02 F;  2CPS A;  1L0N G;  3HE5 A;  4ZKP A;  3NTN A;  1OXZ A;  2D2C D;  1NTZ K;  2YNY A;  1OW7 A;  1N7S D;  3L70 E;  2KLV A;  4L73 A;  1KB9 I;  3QWO C;  3H1I E;  4U3F D;  4L76 A;  2IBZ E;  3FGA D;  3AEB C;  4R9J A;  3RK3 E;  1FZA B;  4WWI A;  1LGH B;  1L0N K;  3JSV C;  2Y0C A;  4H44 C;  4C7R A;  3NMD A;  3CI9 A;  1VQ5 P;  1ZP0 C;  1FZG B;  2Q6Q A;  5DJU B;  5AVZ B;  1KN7 A;  2GY7 A;  2M3E A;  2UWJ E;  2Z5I A;  4D6T E;  1Q2N A;  1OWA A;  1RQU A;  1LP1 B;  1FZC B;  2Y0D A;  4O9B A;  3LIE A;  4RKU J;  2N9Y B;  2VRS A;  1KQL A;  1AVY A;  3BCC E;  4DT0 A;  1K8A Q;  2WT7 B;  3U59 A;  1K9M Q;  4IL6 X;  2AXC A;  3QH9 A;  1FC2 C;  1SFC D;  4ZNC A;  1EZV D;  1EXJ A;  1RF1 C;  1LNQ A;  1FOS F;  3A3Y B;  3CCM P;  3V2P A;  3HE5 B;  2GA1 A;  3MHV A;  1NU1 K;  1AVO A;  3C1L A;  1QGK B;  5DJT B;  5APQ A;  4CPG A;  2E75 B;  2J0G A;  4QMA A;  4W80 A;  4JPZ B;  3RL0 B;  3SWK A;  3H32 B;  3L37 A;  4W7Y A;  2R3S A;  3VMZ A;  3EQ2 A;  3L72 G;  2LR2 A;  2WPQ A;  1NWQ A;  5KLI B;  1FS0 E;  1ZW0 A;  2Q3E A;  3CLQ A;  2Q7C A;  2FYU D;  5KLV D;  2IX7 C;  2ZYA A;  2XNX C;  3CX5 I;  1PGO A;  1OVV A;  3W68 A;  2QRX A;  2G8Y A;  2H89 C;  1U7M A;  2BAS A;  5CCH A;  3HRN A;  4PV1 D;  5H2F E;  1JY3 P;  2WVR A;  2J64 A;  1FAV A;  4AUW A;  5CHX A;  4ZMD A;  2WTY A;  3U1A A;  3OW2 O;  1FZE A;  1SQX J;  3Q5R A;  2Z4E A;  3D70 A;  1LT1 A;  1GL2 C;  4K35 A;  5CBO A;  1JCC A;  3L73 D;  4H13 D;  1BGY J;  2E76 C;  1W5C E;  2WSC J;  1JY2 P;  2J3O A;  1BE3 G;  4OGQ D;  2HYN A;  2QJP C;  1YHQ P;  3V4W A;  5AW2 B;  3W67 A;  2K3R A;  2HOD C;  2ZVN B;  3GF3 A;  1P84 E;  1QLE D;  5TIS H;  1FID A;  5KTB A;  2C9L Y;  1ZRT E;  1ZXG A;  1QVG O;  3H1K G;  2JHM F;  1KB9 H;  1N86 A;  2D39 A;  1SLQ A;  3CCJ P;  2ZT9 B;  2WSF J;  3EFG A;  3H1L G;  3VP8 A;  1PPJ G;  1K05 A;  1MKM A;  2XU6 A;  2OYI C;  1LTT C;  1TU3 F;  5AVV B;  3H1H J;  3ZDM A;  1SQX E;  4LGD E;  4ZFG A;  1PGQ A;  3CCR P;  2B89 A;  1FJK A;  3I55 P;  1FZE B;  2C9N Y;  2Z4E B;  1H0T A;  4NPE A;  2C0W A;  2YO2 A;  4GDO A;  1BGY E;  5CCG C;  1SQV D;  4NPF X;  3GLM A;  1YJW P;  1T2K C;  2O1K A;  2B87 A;  1P84 H;  2PGD A;  3N7N A;  3V2R A;  1NAY A;  4PD4 E;  1SFC A;  3G6E P;  2Y9Z A;  5KAI H;  3HUS A;  2V7Q H;  2H8P D;  1XTG B;  1NTK K;  1PP9 G;  3O8Z A;  4DJG A;  4I7Z C;  2D2C B;  2QJY B;  5EFW B;  3CXH I;  5KKZ B;  3RK3 C;  1SQQ K;  2ZXX A;  1W2E A;  5APT A;  1L0L D;  1N86 B;  4UB8 E;  1SQP D;  1USE A;  2XKM A;  2OTJ P;  1JY2 N;  3E1I A;  4IFD K;  4U3F J;  1LTJ C;  2RH0 A;  3VMX A;  3H1H E;  1S2E A;  5M1B A;  3Q1M A;  5AW5 B;  5AW9 B;  1YQ3 C;  3RBX A;  3B5N D;  2M3B A;  4PD4 H;  2W6B A;  3WUU A;  3WU2 E;  1JCD A;  3L70 G;  2Q9I C;  4I2L C;  4Y99 B;  1H0T B;  4BRY A;  2IBZ G;  2J0Y A;  1FZB B;  2BCC G;  1NGM B;  3AEF C;  3G9R A;  2B87 B;  4NPD A;  3AED C;  2FXM A;  4OH8 B;  1LTB C;  1SFC B;  5AW8 B;  1NO4 A;  1T3U A;  3HD7 D;  3L35 A;  1RY3 A;  3NXS A;  2OGU A;  2WSF H;  4C7N A;  3A0B E;  2J3F D;  3FX0 A;  3LW5 H;  5KJ7 C;  1IFM A;  3PRJ A;  1NKZ B;  1VQ9 P;  1FDM A;  3CC7 P;  3BCC G;  3WU2 H;  3L75 J;  2AEM A;  2IBZ I;  1SQX D;  1NOH A;  1FZA C;  4R4L A;  1GDT A;  4IFF A;  3FIB A;  4U3F E;  3D6Y A;  3AE5 C;  1N7L A;  3E1I B;  4HYT B;  2M8R A;  1SQB G;  1FDI A;  3UIA A;  1JNM A;  3KHU A;  2PFX A;  5AVT B;  1J1E C;  1J2J B;  2J0H A;  5B5E H;  1FZC C;  3AE1 C;  2J2P A;  3A0B H;  2N1T D;  1ZV8 A;  1JUN A;  3IAO A;  3KPE A;  4PV1 B;  3E1R A;  2H43 A;  1Z3S A;  1USD A;  1IC2 A;  1OIP A;  2KB7 P;  4R9T A;  4WY4 A;  3CX5 D;  2IFN A;  2WZ7 A;  3P32 A;  4C7N B;  3TDK A;  3IN6 A;  1PZQ A;  4BXL A;  1EZV E;  1S5L E;  1LTS C;  3LID A;  4H13 B;  1GW4 A;  3F89 A;  2E75 C;  2Y0E A;  2NPS A;  2LKM A;  3L75 E;  2JWA A;  1D7M A;  3RL0 C;  1VF5 D;  2O3J A;  4OGQ B;  1Z56 A;  3EFF K;  2YIU B;  3FXE A;  3AE4 C;  1LT9 A;  1GZL A;  2Y9Y A;  1URQ D;  2JWD A;  5KLI C;  3TNU B;  3TGU G;  2ZYD A;  3VOP A;  1RE4 A;  3M0D C;  2AXT H;  3CME P;  2FYU E;  1KQF B;  1BCC G;  1BSH A;  2KI7 B;  2YO3 A;  2ZJS E;  3RGU A;  5KLV E;  1JOC A;  1Q90 D;  1NTM G;  5AVY B;  2YKP A;  1SS1 A;  5AW6 B;  5E79 E;  4EPU A;  1S5L H;  1IFD A;  2H43 B;  3PJS K;  1KYO D;  2RMZ A;  1WRG A;  3I5C A;  3B5N A;  1JC9 A;  1VL2 A;  2HLO A;  2WQY C;  4NYT A;  1S4X A;  3RK2 B;  2OTK E;  1NTM K;  4WY4 B;  1Y9B A;  3JC2 2;  5APU A;  1N73 A;  2JHI F;  1YTZ I;  1EXI A;  3G3Z A;  1S72 P;  3CWB J;  3H32 A;  2NPS B;  3MUD A;  4GOD A;  1N8R Q;  3CCU P;  2J60 A;  3L73 E;  3HD7 A;  2GM4 A;  3WMM 0;  1M1J A;  1BE3 D;  3SWY A;  1YI2 P; 
#chains in the Genus database with same CATH homology
 2WTY A;  1NHL A;  1N7S B;  2XV5 A;  3U1A A;  1LT9 B;  5AW1 B;  1FZE A;  4JYC A;  2A45 H;  2J3F A;  2Z4E A;  1PFI A;  1RF0 C;  2POH A;  1G2C B;  1IFI A;  1DEB A;  1GL2 C;  3HTK A;  1WT6 A;  1RE4 B;  1JCC A;  2OYH A;  2ZXE B;  1CW5 A;  4EOT A;  2CPB A;  3OJA B;  1LTI C;  3B5N C;  1L4A C;  2FKW B;  2Z5H A;  4XA4 A;  4IFM A;  1JY2 P;  2J3O A;  3M06 A;  2J1G A;  1JMM A;  1N73 C;  2QM7 A;  1ZN5 A;  1X8Y A;  1SQV K;  5KJ7 A;  1IFJ A;  2HYN A;  5CMZ A;  2HPC A;  1MZ9 A;  5BVZ A;  1QL2 A;  1H89 A;  3RK3 B;  2OAR A;  2W6A A;  4WB4 A;  3M91 A;  1HWT C;  5APY A;  1HBW A;  3H32 C;  1GL2 B;  1L4A D;  1ZR2 A;  3V4W A;  5AW2 B;  3SWY A;  2WSE H;  5CCG A;  2P1J A;  1CSB A;  5CCH C;  2HOD C;  1MV8 A;  1FBM A;  5CJ0 A;  1HH0 A;  3KDP B;  4AYC A;  2PP6 A;  3HE4 A;  3B5N B;  2HLO B;  2YKO A;  2O1J A;  3HD7 C;  1M1J C;  1G2C A;  1AQ5 A;  5AW0 B;  1N73 B;  1FID A;  5KTB A;  2C9L Y;  1N2D C;  3RL0 D;  2H43 C;  3C9I A;  1GTW A;  2JHM F;  2Q3I A;  1N86 A;  1FZE C;  1FJP A;  2D39 A;  1SLQ A;  4GIF A;  2N1T A;  2QM8 A;  3RK2 C;  2E42 A;  4WY4 C;  1JO5 A;  1LTG C;  1CI6 A;  5APW A;  2OYH C;  2J3U A;  3HUS B;  1FZF A;  3EFG A;  1L0L K;  1HGV A;  4EIJ A;  1HJB A;  1GW3 A;  3VP8 A;  2FIB A;  2XU6 A;  2OYI C;  1SQP K;  1LTT C;  3HD7 B;  1M1J B;  1NKN A;  5AVV B;  2NPS C;  2J5Z A;  4LGD E;  4ZFG A;  3TYY A;  3R2P A;  3MTU E;  3BVH A;  1FJK A;  1FZE B;  3M9H A;  4HH2 A;  2C9N Y;  2KP8 A;  2KSJ A;  2Z4E B;  3VMY A;  2C0W A;  1GU4 A;  2YO2 A;  3BAT A;  1G1I A;  1LTA C;  3HTK B;  2KOG A;  5CCG C;  1QL1 A;  2OYH B;  1N7S C;  5AVW B;  1T2K C;  1LT9 C;  4KHX A;  3P8M C;  1LTJ A;  1IFN A;  2O1K A;  3B8E B;  1ZR4 A;  3N7N A;  2GUS A;  3V2R A;  4XE5 B;  4JYO X;  2PAJ A;  1SFC A;  1RE4 C;  5BU8 B;  1CZQ A;  1KFM A;  3HUS A;  2HPC B;  3KQG A;  1N86 C;  2Q9I A;  1VPC A;  1URQ A;  2KYV A;  2N1T C;  1EQ7 A;  2H8P D;  1XTG B;  1NTK K;  4I1L A;  3O8Z A;  2IPP A;  1XTC C;  5AW4 B;  1Z3U A;  4W7Z A;  3M0A A;  1FZF C;  1FOS E;  2JHK F;  1M7L A;  3HE4 B;  1YYC A;  2J58 A;  3RK3 C;  1SQQ K;  3OAK A;  2J3G A;  1FIB A;  2FFD A;  2FYZ A;  1W2E A;  5APT A;  1N86 B;  3V2Q A;  5APX A;  4B86 A;  2HLO C;  1SQB K;  2N1T B;  4Y99 C;  3M0D A;  3NFQ A;  2XKM A;  1KFN A;  2R5B A;  4DZO A;  1CI6 B;  1JY2 N;  3E1I A;  4IFD K;  3BRV B;  4M7H A;  1FZF B;  1LTJ C;  1GL2 D;  3KYQ A;  3L36 A;  3VMX A;  1J1E B;  1HUC A;  4LC1 A;  1GD2 E;  2R3C A;  1SQX K;  4JYB A;  1IK9 A;  1T3J A;  5AW5 B;  5AW9 B;  2L5G B;  3B5N D;  2M3B A;  2W6B A;  4M3L A;  1KIL A;  3V4Q A;  4GT1 A;  1JCD A;  3HUS C;  2Q9I C;  3L4F A;  3BVH B;  4I2L C;  1MFZ A;  1URQ C;  3OA7 A;  3T97 A;  1FU1 A;  1FZA A;  4Y99 B;  1E5W A;  3CL3 D;  2J0Y A;  4AQR D;  3VTP C;  1VDF A;  3VP9 A;  1FZB B;  1LTJ B;  2JHL F;  1JY3 O;  3SWF A;  5CCH D;  2Z4E C;  1H88 A;  3V5B A;  1FZG A;  2FXM A;  4OH8 B;  2FFD C;  1LTB C;  1SFC B;  3IFM A;  2WPS A;  5AW8 B;  5AVQ B;  1NO4 A;  1T3U A;  3HD7 D;  2I1J A;  1LWU A;  1J1D C;  1RE3 A;  1DX7 A;  2Q9I B;  3L35 A;  1RY3 A;  1URQ B;  3NXS A;  3P8C E;  1FZC A;  2WSF H;  4C7N A;  2WPR A;  2E43 A;  2J61 A;  1NH4 A;  2N9B A;  2XDJ A;  2J3F D;  3E1I C;  4N78 E;  3RK2 D;  3V2N A;  5KJ7 C;  3LW5 H;  1IFM A;  2JHH C;  2HPC C;  1IJD B;  4WY4 D;  2Q5U A;  4DOJ A;  1NKZ B;  1FDM A;  1JY2 O;  2WT7 A;  3II6 A;  2FFD B;  1KIL C;  2R5D A;  5AW7 B;  3P8C D;  1MUU A;  1FZB A;  1RF0 A;  1GK4 A;  1J1D B;  2NPS D;  4N6J A;  4C46 A;  4N78 D;  3MGN A;  1NOH A;  4ZKU A;  1FZA C;  1A02 F;  5KJ7 D;  1GDT A;  2CPS A;  4IFF A;  3FIB A;  1L4A A;  1N7L A;  3HE5 A;  3E1I B;  1HGZ A;  4ZKP A;  3NTN A;  4HYT B;  1OXZ A;  5AW3 B;  2YKQ A;  3IR9 A;  1NTZ K;  2YNY A;  5CCG D;  2M8R A;  2GUV A;  1N7S D;  2KLV A;  3P7K A;  1T2K D;  1DH3 A;  3N4X A;  3UIA A;  1JNM A;  1YTZ T;  2IFM A;  1GK6 A;  3GHG A;  1KIL B;  5AVS B;  1LWU C;  1X9V A;  1RE3 C;  5AVT B;  5APS A;  1J1E C;  1J2J B;  2J0H A;  4R9J A;  1FZA B;  1FZC C;  2HOD A;  1LGH B;  1RF1 A;  1L0N K;  2J2P A;  2N1T D;  1ZV8 A;  2YMY A;  1JUN A;  4C7R A;  3NMD A;  3BVH C;  3KPE A;  2R32 A;  1HVV A;  3CI9 A;  3H6P A;  5APV A;  2A45 G;  2H43 A;  5CJ4 A;  1Z3S A;  1FZG B;  2I1K A;  5AVR B;  5AVZ B;  3TSI A;  3RK3 D;  2GY7 A;  3BAS A;  2WSC H;  1IC2 A;  1ZLL A;  1FZB C;  1LWU B;  2KB7 P;  2P67 A;  2XZR A;  3M9B A;  1RE3 B;  1AFO A;  4R9T A;  2Z5I A;  4WY4 A;  2FYU K;  2JJL A;  2MJZ A;  1H8A A;  1OWA A;  4JF7 A;  5KLV K;  2IFN A;  2WZ7 A;  3P32 A;  1FZC B;  2P2U A;  4C7N B;  2J61 B;  4O9B A;  1SFC C;  2J59 M;  3LIE A;  3A2A A;  3MIW A;  1IO4 A;  5AVX B;  2VRS A;  3TK1 A;  1KQL A;  2OYI A;  1LTS C;  3LID A;  1GW4 A;  2NPS A;  1JTH A;  2LKM A;  2WT7 B;  1T8Z A;  3U59 A;  2P7J A;  1FIC A;  3GHG C;  2XNX A;  3RL0 C;  1RF0 B;  1Z56 A;  1SFC D;  5AVU B;  2JEE A;  1N7S A;  1RF1 C;  1LT9 A;  1GZL A;  2O01 H;  2W27 A;  1FOS F;  3A3Y B;  1URQ D;  1L4A B;  2HFE D;  3HE5 B;  2A45 I;  3V2P A;  3TNU B;  1NU1 K;  2WIT A;  1SP4 A;  5APQ A;  3VOP A;  2J0G A;  1RE4 A;  3M0D C;  2H7H A;  4W80 A;  5BU5 A;  3GHG B;  2YO3 A;  1GU5 A;  3RL0 B;  1JOC A;  3M9Q A;  3H32 B;  3L37 A;  5AVY B;  4W7Y A;  4RES B;  3VMZ A;  3EQ2 A;  3PP5 A;  2YKP A;  2HOD B;  1RF1 B;  1NAF A;  5AW6 B;  2WPQ A;  4GKG A;  1NWQ A;  4EPU A;  2HG5 D;  3CLQ A;  2Q7C A;  1IFD A;  3A5T A;  1GL2 A;  2H43 B;  3VN0 A;  1WRG A;  2IX7 C;  3I5C A;  2WWW A;  3B5N A;  1A02 J;  3BRT B;  2HLO A;  1JC9 A;  4NYT A;  2XNX C;  4N3Y B;  3TNU A;  3RK2 B;  3U1C A;  2C0X A;  1NTM K;  4WY4 B;  1KIL D;  5APU A;  1S9K E;  1N73 A;  1FZD A;  4LLH A;  4M7F A;  1X79 B;  2JHI F;  1FZG C;  1KZU B;  4WBA A;  1YTZ I;  3G3Z A;  2OYI B;  3VYI A;  3H32 A;  2NPS B;  1JTH B;  3MUD A;  2BAS A;  3MD0 A;  5CCH A;  4JZC A;  3HRN A;  1HTL C;  1S9K D;  2ZFC A;  3A7O A;  1JY3 P;  2J64 A;  1FAV A;  2J60 A;  2XNX B;  4AUW A;  2WNP F;  1JY3 N;  4I6M C;  3HD7 A;  2GM4 A;  3WMM 0;  1M1J A;  1G1J A;  5CHX A;  1SVF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...