2OYHC

Crystal structure of fragment d of gammad298,301a fibrinogen with the peptide ligand gly-his-arg-pro-amide
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
299
structure length
299
Chain Sequence
YEASILTHDSSIRYLQEIYNSNNQKIVNLKEKVAQLEAQCQEPCKDTVQIHDITGKDCQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQSAIPYALRVELEDWNGRTSTADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDAPSAKFFTSHNGMQFSTWDNDNDKFEGNCAEQDGSGWWMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIPFNRLTI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibrinogen alpha chain
publication title Probing the gamma2 Calcium-Binding Site: Studies with gammaD298,301A Fibrinogen Reveal Changes in the gamma294-301 Loop that Alter the Integrity of the "a" Polymerization Site.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
total genus 89
structure length 299
sequence length 299
chains with identical sequence F
ec nomenclature
pdb deposition date 2007-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2oyhC01
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 2oyhC02
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 2oyhC03
1FZFC 2OYIC 1RF0A 2J61A 1FIBA 1FZBC 1N86C 1T3UA 1RE3B 1LT9C 3GHGB 1FZFA 2OYHC 2OYIA 2J0HA 2JHKF 2HLOB 3BVHC 3HUSC 1LT9A 2OYHA 2Q9IC 2J2PA 2J3OA 1N73C 2A45I 2H43C 2J3FD 1FICA 1LWUC 3BVHA 1JY3O 3HUSA 4NYTA 2HPCC 2Q9IA 1JY3P 1RE4B 1RF1B 2J64A 1FZAC 2Z4EB 2A45H 1FZGB 1FZEC 2H43A 2J1GA 1JY3N 1LWUA 1FZCC 1Z3UA 2OYHB 1M1JB 2HPCA 2J0GA 1FZBA 2HODB 3E1IC 1FZAA 1N86A 2FIBA 2FFDC 1FZDA 3H32B 1JC9A 1JY2P 1FZCA 4JZCA 1RF0B 2J61B 4R9JA 4JYOX 1W2EA 1FIDA 3FIBA 1JY2N 3E1IA 1RE3C 2FFDA 2J3FA 2D39A 3GHGC 1FZFB 2OYIB 1LTJC 2JHIF 1Z3SA 2HLOC 2JHLF 4R9TA 2HPCB 1N73A 1FZBB 2WNPF 1N86B 4ZFGA 1RE3A 2JHMF 1LT9B 4M7FA 3GHGA 2XNXC 1LTJA 2HLOA 1JY2O 1FZEA 3BVHB 3HUSB 2A45G 2JHHC 4M7HA 2J3UA 2XNXA 1RE4C 2Q9IB 1RF1C 2J0YA 2J60A 2Z4EC 1N73B 1FZGC 2J3GA 2H43B 1LWUB 1M1JC 1LTJB 1RE4A 1RF1A 2HODC 2Z4EA 1FZAB 4EPUA 1FZGA 1FZEB 3H32C 1FZCB 1RF0C 1M1JA 2XNXB 2J5ZA 2HODA 2GY7A 3E1IB 2FFDB 3H32A
chains in the Genus database with same CATH superfamily
3H1LE 1SQXK 1OFCX 3C1LA 5KLIC 4EI2A 1T3UA 3PLNA 3G6EP 3PHLA 1NU1J 2FKWB 1H0TA 3HD7C 1VQKP 1L0LJ 1SQQK 2I1JA 1KQFB 4I2LC 3HUSC 1A02F 1YIJP 4PV1C 1H89A 2M3EA 5AW9B 1RQVA 1DD4A 4WY4B 2R32A 3AEFC 4PD4D 3L75D 2JWAA 4Z1MH 1WMKA 2CPSA 2JJLA 2ZVNB 2SPZA 3VP8A 1T3JA 1M1JB 2E74D 1LP1B 1JY2P 1KYOI 1FIDA 3I56P 3FIBA 1YJWP 3B5NB 1Q86Q 1OVVA 4D6TD 2QJPB 3VMZA 1S5LH 2HFED 2HPCB 5KAFE 1HJ0A 3T97B 3GHGA 3Q5PA 5APWA 3ZDMA 2E43A 4WY4C 1BE3E 3L36A 2LXBA 3N4XA 1VF5D 2Q9IB 4HB1A 2IZ0A 3CXHD 2C0XA 4HJGH 3CMEP 3GF7A 5KAIE 1M1JC 1SFCB 3H1IE 4C46A 2Z4EA 1ZXGA 1KMIZ 1NAFA 2QG4A 2WSCJ 3H1JG 2OYOA 1FE6A 3B5NC 2Y0DA 3RK2B 2IBZE 1L0LD 1EDKA 3H1LJ 2QJPC 3R2PA 2QE7H 1FOSE 2J61A 1BDDA 4U3FE 3IF4A 2JWDA 2YIUB 3KQGA 2HLOB 2J58A 2V7QH 2WZ7A 1NJIQ 1K8AQ 2YMKA 2OYHA 2Q9IC 1GW4A 2J2PA 3EFFK 1URQB 1SFCC 3GLMA 1L4AA 3FWNA 2H43A 1HH0A 1Z3UA 4DT0A 1YTZI 1GD2E 2FIBA 1BCCE 4YTPC 3RK2C 4ZKUA 3H6PA 3WMM0 2Y0CA 1UIXA 1P84D 1K9MQ 2YIUC 1FZFB 3CWBG 2JHIF 4QMAA 2HLOC 3WU2H 1DX7A 3BCCG 1N73A 3G3ZA 1NTZG 1NTMG 2MJZA 2RH0A 2UWJE 2YNYA 3M9QA 1BE3J 2ZAEB 5AVXB 1URQC 3M0DA 3CI9A 3HE4B 5AW1B 1U57A 2P10A 4GOFA 4YXWH 3H1IJ 1IFIA 3H1LD 4EPUA 1FZEB 3VN0A 2O01N 3L35A 5KLVD 4JYCA 4EOTA 1FZFC 3L75G 1FIBA 1J2JB 3USSA 2ZVOB 4U3FJ 4H44D 2WTYA 3Q2YA 4W7YA 2NPSA 3SWYA 1N7LA 1JMMA 1S4XA 2H88C 4OWFA 1SQVE 5KJ7A 2ITAA 1CW5A 4PV1D 2QJKB 2KSJA 2KP8A 3OW2O 2BEQD 2G8YA 1FZEC 1R8EA 1JY3N 1KORA 4A7PA 2C9NY 3LW5H 2M0BA 3AE3C 3VMXA 1BCCJ 1N8RQ 1Q2NA 1QL1A 1KZUB 1QL2A 5APTA 1JC9A 4JZCA 3PJSK 2J59M 4PD4I 2AEMA 3PRJA 1YI2P 1EXJA 1J1EB 2C9LY 3AE8C 1JTHA 1MKMA 1HGZA 5CHXA 3TNUA 5CJ0A 1OW6A 5GTHE 1L0NE 1X79B 1L0LG 1MFZA 4IFFA 2J0YA 1Q90D 4WY4D 1LTGC 1K04A 1HF9A 3P8MC 2AXCA 3V6IA 2KZIA 1IK7A 1NGMB 4BXLA 5CBNA 1EDJA 3V5BA 2J5ZA 4NPDA 2FYZA 3PTZA 2MKVA 3CXHI 5AVQB 1J1EC 1S1CX 3SFDC 2QJYB 1RE3B 1JCCA 2POHA 2M5AA 2Y0EA 3RBXA 1LTBC 2AXTH 3RK3B 1SQVJ 3L73D 3S4RA 1CZQA 1PGJA 1T2KC 4KJMA 1G2CA 5BVZA 1SFCD 4HYTB 3V2NA 1FZBA 1KTMA 4N3YB 2E42A 1L0LK 3P32A 5APVA 1BDCA 3K5BA 4JF7A 4NPEA 3TYYA 1HVVA 2RKLA 5GTIE 3L72E 2QJYC 1RE3C 2FFDA 1PP9E 1EXIA 1KYOH 4W80A 5APQA 3H1LG 3WUUA 2E74C 4OVNF 4ZFGA 2H8PD 1MUUA 2XNXC 4AQRD 1NYHA 1L0NJ 3CCUP 1KILA 4TT3H 1P84I 3ABVC 1KN7A 3RK3E 1URQD 4BRYB 2AEJA 4UB8H 5DJUB 1RE4A 1OZHA 1U7JA 3HE5B 4EYYQ 2R3CA 2I8DA 3KYQA 1IZNB 3H32A 4DZOA 2Y9ZA 3JC22 3II6A 3KDPB 4RESB 3E7KA 1SQVD 4OGQB 1KD1Q 2QA4P 5E79E 3I5CA 1S5LE 3A3YB 3L74D 4CPGA 3HTKA 2N9YB 1Y9BA 1BE3G 3KPEA 3AECC 2W6BA 2KNCA 3FWLA 1KILE 1FZGB 5KLVK 1N86A 3CL3D 1HUCA 4IL6E 3L72J 1S72P 1JY2N 1PP9J 4OGQC 3AEAC 4ZNCA 1L0ND 1LTJC 1JCDA 4EIJA 3A0BH 2ZFCA 1HGVA 1EZVE 3RGUA 3CCEP 1JMBA 2HR3A 4M7HA 3MUDC 1SQPD 3O6QB 1FZGC 2JDIH 2J3GA 2B89A 1N7SA 5CCGD 2N1TD 1S3JA 1FZAB 2KLUA 2GM4A 2ZYGA 2KS1A 3LIEA 1JO5A 1TU3F 1NKNA 1HJBA 1YJ9P 5EFWB 1BCCG 3B4SA 4BWNA 1VQ7P 2QVAA 3FGAD 5B66H 2JO1A 5KKZC 3CWBD 2YXRB 2KB7P 3BCCD 1NTKK 2KXPB 3HD7A 4H44C 4ZMDA 2J3FD 4JBZA 3B71A 3HUSA 2FYUE 3CC7P 1FZAC 3AE9C 4GDOA 1T2KD 3L72D 1PP9D 3D6YA 2LXCB 2GUSA 1S9KE 2NZ2A 3P8CE 3I55P 1PFIA 2OGUA 2B9BA 3BRVB 2XNDH 2KZJA 2KSEA 2B87A 1IO4A 4RO0A 4GIFA 1YQ3C 1Y8AA 3WUVA 1FS0E 2FYNB 4PD4H 2WPVB 3R4YA 1KC8Q 1GMJA 2HG5D 2HYNA 3RK3D 1JY2O 3V4WA 2V7QJ 3KXDA 3MD0A 1SQVG 3HRNA 2XU6A 4WY4A 2IDBA 5K5GB 3L74G 4C7RA 5B5EH 3IR9A 1QX8A 1M1JA 4I6MC 1LP1A 1USDA 2FXMA 3SFEC 5AVZB 2YKPA 3B5NA 1PPJE 1XTGB 2CPBA 3CXHH 2J0HA 3VP9A 1SQBE 3T97A 1BGYE 1NU1D 2L5GB 1DIPA 1GW3A 1UIIA 2FYUJ 1VQLP 1L0NG 4GT1A 2P2UA 2HPCC 2Q9IA 3AEGC 1GU4A 3PH0A 1AJYA 2Y9YA 1SFCA 2OYHB 4R4LA 1SQXE 4R9JA 1SQPG 1YITP 1W2EA 1Z56A 1PGPA 2Q3IA 1R5SA 1QVGO 2OYIB 1T8ZA 1SQQE 3TSIA 1OIPA 4OGQD 3V2PA 1LT9B 4M7FA 4YXDC 2OTKE 2HLOA 2AXTE 1HBWA 4HH2A 3BVHB 2PGDA 1GL2D 1ZLLA 1N73B 3H1HE 1CI6B 3H25A 2O3JA 1LWUB 1URQA 3AE1C 1IFDA 1P84H 4AYCA 3A0HH 2OQQA 1QVFO 1YYCA 3W68A 3IFMA 1LTAC 3LW5J 3CX5D 1LT1A 2V4HA 3E1IB 2XKMA 2OYIC 1M1KQ 2XV5A 2IFNA 2W27A 2KIKA 3L72G 1LT9C 1SP4A 4H13B 1FZFA 1PP9G 4K35A 2WSCH 3NTNA 1RH5B 1G1JA 2FYUD 5APUA 1E5WA 3BVHC 1SQBJ 1BGYJ 1SQPK 2FXPA 1N73C 1JM0A 1LWUC 2WSEJ 2KI7B 3HE4A 1RF1B 4GOEA 3TGUE 1IFPA 1ZOYC 2YKOA 5AVVB 2PP6A 2HODB 3E1IC 1IC2A 1GTWA 1SQXJ 3OJAB 2WSSH 1GDTA 2LR2A 1SQQJ 4H13C 3AE6C 3B8EB 2N1TB 1NTZK 1NTMK 5CMZA 4JPZB 4IFDK 2P67A 1X22A 1RF1C 1JUNA 3MIWA 3L70E 3H1HJ 4UB6H 4KT0J 1AV1A 1BE3D 4Y99B 4XE5B 2HODC 3VTPC 1FZCB 1PPJD 1NU1G 2FXOA 1FC2C 3CC4P 1AFOA 2IYOA 3H1ID 1USEA 3A5TA 2QJKC 5CCGC 1NVOA 2PAJA 4LGDE 2N1TC 1JNMA 1KFNA 3L71E 1VQ6P 3SSUA 1BGYD 2W6JH 2JP3A 3H1JE 1LTTC 1N2DC 3TF5A 1VQ9P 2IBZD 1HWTC 1FBMA 3JCUE 2B88A 4U3FD 4C7NB 1EZVG 1FICA 2M5AB 4NYTA 4Y99C 2R5DA 4WWIA 3TGUJ 1OMIA 4B86A 1KB9E 1FZCC 2PRRA 1VPCA 1YHQP 2J0GA 3PP5A 1RF0B 2W8ZA 1NKZB 3H1KE 1VQ5P 1BCCD 5AVSB 2GUVA 5AVRB 1VQ4P 3CPWO 1FZBB 5B66E 1RE3A 2JHMF 2WPQA 1KQGB 3H1HD 5H2FE 1NU1K 1WRGA 3E1RA 4GKGA 2IFMA 2A45G 3G4SP 4K3AA 3L70J 2XNXA 2WSFJ 2BCCE 1AQ5A 4N78E 3RK3C 1FDOA 2FYUG 1GK4A 3IN6A 2IZ1A 2YO3A 1LGHB 1KILB 2WWWA 1RF0C 4WBAA 4GODA 3M06A 2IYPA 5TJHA 1G1IA 3L71J 2OARA 1FZBC 3OAKA 1LJ2A 1ZR4A 3H1JJ 2R3SA 1OX3A 4TLFA 1NHLA 3JSVC 2E5TA 3CX5I 3TGUD 4PD4E 2QEXP 2OTLP 3A2AA 2A45I 1H8AA 2WMMA 3GF3A 2QM8A 4U7JA 1M7LA 1KILC 2ZXEB 4BRYA 1OVRA 3HTKB 2K9JA 3M9BA 1PIXA 2ZXXA 1ZR2A 1ZV8A 1MV8A 5B5EE 3HE5A 5AVTB 4D6TE 1VQNP 1FZDA 1Q82Q 1MFTA 2R44A 2ZYAA 5AW8B 2O01J 1GL2B 4ASWA 3H1KJ 5CCHC 2JR8A 1ZMEC 1FU1A 2ZT9B 2Q6QA 1MZ9A 1N86B 3L70D 1EC5A 1PPJG 5AVWB 4H13D 2YMYA 1LTJA 3H1IG 2Z5HA 3D6ZA 1BGYG 2W83C 1ZW0A 3UIAA 2BCCJ 2NPSD 2H89C 2IBZG 3VOPA 3MUDA 4M3LA 1LNQA 5GTHH 1FZGA 4U3FG 2GA1A 2M8RA 3L71D 1M90Q 1GL2C 5KJ7D 1M57D 2IPPA 1ZP0C 2WT7B 1JOCA 3KHUA 1N7SB 1LTIC 1SQXG 1Y47A 3BATA 1D7MA 1N86C 2P58A 2JEEA 3CCSP 2P1JA 2KK7A 1YBKA 4LC1A 3BRTB 3IAOA 1EQ7A 1Q7YQ 1JB0J 1CSBA 3W67A 1KB9D 1AA0A 3D70A 3WUTA 1YQ4C 2IBZI 3H1KD 3H1HG 1FAVA 1ZN5A 1QLED 3WU2E 3RL0D 1P84E 2L91A 4D6TJ 1FZAA 3RL0g 3A0HE 3CC2P 5C39A 3Q5SA 3CCJP 3F89A 1VQPP 2K1AA 1H0TB 3TDKA 1XTCC 2E75D 2JHLF 3V2QA 2BASA 2K88A 2QRXA 1DH3A 5GTIH 1W2BO 3KZIH 5AVUB 2B87B 2D2CB 1M8OB 1Q81Q 1VQOP 1NOHA 2ZJSE 5KLVE 2P7JA 3MGNA 1GZLA 3TGUG 5DJTB 2Q1KA 2K37A 1EDLA 4WB4A 4KHXA 4JQ0D 1BSNA 2QIWA 3GHGB 2QM7A 5AW0B 4H0LB 1FJKA 2D2CC 1EDIA 2E76B 5TISH 1WT6A 3BASA 2W6AA 4IFMA 5E79H 3U1CA 2Z4EB 4UB6E 2FYNC 1HTLC 3L70G 2QSIA 2O1JA 3F5HA 2HPCA 3U59A 2WITA 1KILD 2A06E 2J61B 3TK1A 5APXA 2C0WA 3VMYA 2D39A 3GHGC 1NH4A 3AEDC 4L75A 3CCQP 3CD6P 4R9TA 5CCHD 1NTKE 2O1KA 3L71G 4H0LC 4L74A 1FDMA 3V2RA 2E76C 4IL6H 3AE2C 1VQ8P 4MN4C 1EZVD 1SQVK 1L4AB 2Z4EC 4PJ0H 4XFJA 2H43B 2CK3H 5APSA 5AW7B 5KLVJ 2OTJP 1LTSC 3C9IA 1RHZB 2WVRA 5M1BA 3VMAA 1NO4A 3ITKA 3H1KG 3L73E 1YJNP 2OYHC 5CJ4A 2OYIA 2ZT9D 1W5CE 2IX7C 1DEEG 4IOIH 3D71A 1IFNA 2BEZF 1K73Q 2XDJA 1LT9A 1L4AC 3GW6A 2E5YA 1FDIA 2H43C 3CX5H 3BVHA 1L0NK 4DCKA 1X9VA 2J64A 2A45H 1CI6A 1LWUA 4L76A 3CLQA 1KYOE 2VRSA 1OWAA 2BCCG 3L4FA 2Q5UA 3M0AA 1KB9I 4JYOX 3E1IA 1OW8A 3G9RA 2NPSB 1N7SD 1S9KD 1NTKJ 3P8CD 3QH9A 2WNPF 1S2EA 5BU8B 1ZRTE 3M0DC 5AVYB 4UB8E 3OA7A 3FX0A 1FZEA 2YKQA 2J5UA 2J3UA 1VQMP 5AW4B 1OW7A 4RJTA 1RF1A 3AE5C 3LIDA 3EFGA 4NPFX 3HD7D 3AE4C 4DOJA 2HODA 1AVOA 2NPSC 3U1AA 3MZWB 4D6TG 3L74E 2WPSA 3GMAA 5KAFH 1X8YA 3L73J 1JTHB 5KJ7C 3TNUB 2PFXA 1QGKB 5CCGA 3NFQA 3RL0B 2N1TA 3MTUE 4W7ZA 3FXDA 3O8ZA 1VL2A 2J3OA 3M9HA 2WPRA 4EDFA 5KAIH 5L8RJ 3Q3DA 1AQTA 2D2CD 1IK9A 2E75B 5CBOA 1SQBD 1DEBA 2A06D 1PV3A 4ZKPA 2J1GA 4I1LA 4Y28J 3A0BE 1NTKD 3AEEC 4YPCA 1FZCA 3CCLP 2R5BA 1J1DB 2WSEH 2ZYDA 2J3FA 2K9YA 1Z3SA 1SQXD 3RL0C 1BSHA 3L37A 3GG2A 1SQPE 1SQQD 1T6AA 3S1KA 4H0LD 4C7NA 2E75C 2E76D 3P7KA 3CCMP 1G2CB 3N7NA 3B5ND 5BU5A 1FOSF 4DJGA 3S9OA 2E74B 1IJDB 1J1DC 2XNXB 2Z5IA 3M91A 3MP7B 2WQYC 2FFDB 1EZVI 3CWBE 3L74J 2KOGA 3SWFA 1IFJA 3BCCE 1KFMA 1RF0A 1NTZE 4O9BA 1NTME 3NXSA 2XZRA 1KQSO 2JHKF 4N6JA 1GK6A 1R5LA 1VDFA 1VF5B 1GU5A 1KYOD 4OH8B 3KZIE 3RK2D 1JY3O 1DD3A 2K3RA 3A7OA 1L4AD 1JY3P 1RE4B 4RKUJ 1X0TA 3EQ2A 4HKZH 3VYIA 1OVUA 2M3BA 5KLVG 2FFDC 3H32B 3L75E 3FXEA 2DW3A 2RMZA 1ZRTD 1AVYA 2RN0A 3AE7C 1JEKA 1YTZT 4R4MA 2K9JB 4XA4A 5AW5B 3RBZA 5CCHA 1PZQA 1M56D 1SQPJ 2KUBA 1VF5C 3G71P 2JHHC 1SLQA 2I1KA 1RE4C 2KNCB 1RY3A 5TISE 2Q3EA 2FYUK 1LTJB 4L73A 3MHVA 1H88A 4I7ZB 5APYA 3SWKA 3H32C 3CXHE 3EWKA 1IFMA 5AW6B 2GY7A 3CWBJ 1NAYA 2WSFH 3BCCJ 1K05A 1NTZJ 1SQBG 1NTMJ 1GL2A 2A06G 1A02J 1NU1E 3Q1MA 2G3AA 3C8VA 1L0LE 1SS1A 1NTKG 2N9BA 2KLVA 3CMAP 2LKMA 3H1JD 1QEXA 1KV4A 3CCVP 1OXZA 3V4QA 2ZT9C 1KQLA 2W90A 2KYVA 4PJ0E 4I7ZC 2KS1B 3JCUH 1NWQA 5KKZB 2FY8A 3CCRP 1SQQG 2NRGA 2H7HA 3L75J 3Q5RA 2FBWC 4AUWA 1PGQA 1S5LX 2AEFA 4WVZA 1SVFA 4H44B 5KTBA 4JYBA 1KB9H 2WT7A 3O6QA 1U7MA 3AEBC 1RQUA 1E79H 5KLIB 1L2PA 3HD7B 3QWOC 3L73G 2O01H 4LLHA 3HUSB 5AW3B 1N7SC 4PV1B 1SQBK 4ASVA 2JKVA 2YO2A 2J60A 5AW2B 2Q7CA 2YXQB 3CX5E 4IL6X 5H2FH 1FJPA 1NTZD 1NTMD 1PGOA 2BCCD 4N78D 3NMDA 1PL5A
chains in the Genus database with same CATH topology
3II6A 5CCGC 2PAJA 1SQXK 4LGDE 2N1TC 3KDPB 1JNMA 1KFNA 1NO4A 4RESB 1T3UA 2FKWB 3HD7C 1LTTC 1N2DC 2OYHC 5CJ4A 2OYIA 1HWTC 3I5CA 1FBMA 1SQQK 2IX7C 3A3YB 2I1JA 4I2LC 1IFNA 3HUSC 2XDJA 1A02F 3HTKA 4C7NB 1LT9A 1H89A 5AW9B 1L4AC 3A5TA 2H43C 4WY4B 1FICA 3BVHA 1L0NK 2R32A 3KPEA 4Y99C 4NYTA 2R5DA 2W6BA 1X9VA 2J64A 2A45H 1FZGB 4B86A 1CI6A 2CPSA 1LWUA 2JJLA 1FZCC 1VPCA 3CLQA 2VRSA 3VP8A 1T3JA 1M1JB 1OWAA 3L4FA 2J0GA 2Q5UA 5KLVK 1N86A 3PP5A 3CL3D 3M0AA 1HUCA 1JY2P 1RF0B 4JYOX 1FIDA 3FIBA 1NKZB 1JY2N 3B5NB 3E1IA 2NPSB 1N7SD 2GUVA 5AVSB 1LTJC 1JCDA 1S9KD 3VMZA 2HFED 3P8CD 5AVRB 2HPCB 4EIJA 1FZBB 2WNPF 2ZFCA 5BU8B 1HGVA 1RE3A 2JHMF 2WPQA 3M0DC 5AVYB 3GHGA 1NU1K 3OA7A 1WRGA 1FZEA 5APWA 2YKQA 4GKGA 4WY4C 2E43A 2IFMA 3L36A 2A45G 3N4XA 4M7HA 2J3UA 2XNXA 2Q9IB 2C0XA 1FZGC 2J3GA 5AW4B 1AQ5A 4N78E 1N7SA 1M1JC 1SFCB 3RK3C 5CCGD 1GK4A 2N1TD 4C46A 1RF1A 2Z4EA 1FZAB 3LIDA 2YO3A 1LGHB 2GM4A 3EFGA 1KILB 3LIEA 2WWWA 1JO5A 1RF0C 3HD7D 1NAFA 4WBAA 1NKNA 3B5NC 4DOJA 2HODA 3M06A 1HJBA 1G1IA 3RK2B 2NPSC 3U1AA 3R2PA 1FOSE 2J61A 2WPSA 2OARA 1FZBC 3OAKA 1X8YA 1ZR4A 1JTHB 5KJ7C 3TNUB 5CCGA 3KQGA 2HLOB 2KB7P 3NFQA 3RL0B 2N1TA 1NHLA 2J58A 1NTKK 3MTUE 2WZ7A 4W7ZA 3O8ZA 3HD7A 2OYHA 2Q9IC 1GW4A 2J2PA 3A2AA 2J3OA 3M9HA 2A45I 2WPRA 2J3FD 3HUSA 1URQB 1SFCC 1H8AA 1IK9A 1DEBA 1L4AA 1FZAC 4ZKPA 2QM8A 2H43A 1M7LA 2J1GA 1KILC 2ZXEB 4I1LA 1T2KD 3HTKB 3M9BA 1HH0A 1Z3UA 1ZR2A 1ZV8A 1YTZI 1GD2E 1MV8A 2FIBA 3HE5A 5AVTB 2GUSA 3RK2C 1S9KE 1FZDA 5AW8B 1FZCA 3P8CE 1PFIA 1GL2B 2R5BA 3BRVB 1J1DB 2WSEH 4ZKUA 3H6PA 3WMM0 5CCHC 2J3FA 1FZFB 2JHIF 1Z3SA 1IO4A 2HLOC 1FU1A 1DX7A 3RL0C 3G3ZA 4GIFA 1N73A 1MZ9A 1N86B 2MJZA 3L37A 5AVWB 2YNYA 3M9QA 2YMYA 2HG5D 1LTJA 2HYNA 3RK3D 1JY2O 3V4WA 2Z5HA 5AVXB 1URQC 4C7NA 3M0DA 3CI9A 3MD0A 3HE4B 5AW1B 3P7KA 1G2CB 3N7NA 3B5ND 3HRNA 3UIAA 2XU6A 4WY4A 5BU5A 2NPSD 1FOSF 3VOPA 3MUDA 4M3LA 1IFIA 4C7RA 4EPUA 1FZGA 3IR9A 1FZEB 2M8RA 1GL2C 5KJ7D 3VN0A 1IJDB 1J1DC 1M1JA 4I6MC 2XNXB 2Z5IA 3M91A 2IPPA 3L35A 2FFDB 4JYCA 2WT7B 4EOTA 1JOCA 1FZFC 2KOGA 3SWFA 1IFJA 1N7SB 1KFMA 1RF0A 2FXMA 1LTIC 1FIBA 4O9BA 5AVZB 3NXSA 1J2JB 2XZRA 3BATA 2YKPA 3B5NA 1XTGB 1N86C 2JEEA 2WTYA 2CPBA 2P1JA 4W7YA 2NPSA 3SWYA 1N7LA 2J0HA 2JHKF 1JMMA 4N6JA 4LC1A 3BRTB 1GK6A 3VP9A 1EQ7A 1VDFA 3T97A 1CSBA 5KJ7A 1GU5A 2L5GB 4OH8B 1CW5A 1GW3A 3RK2D 1JY3O 4GT1A 2P2UA 3A7OA 1L4AD 1JY3P 2KSJA 2Q9IA 1RE4B 2HPCC 2KP8A 1GU4A 1FZEC 3EQ2A 1JY3N 1FAVA 1ZN5A 2C9NY 3VYIA 3LW5H 1SFCA 2OYHB 3VMXA 3RL0D 2M3BA 1FZAA 1QL1A 2FFDC 1KZUB 1QL2A 3H32B 5APTA 1JC9A 4JZCA 4R9JA 1W2EA 1Z56A 2Q3IA 2J59M 1YTZT 1XTCC 2OYIB 1T8ZA 1J1EB 4XA4A 2JHLF 3TSIA 5AW5B 2C9LY 5CCHA 3V2PA 3V2QA 1JTHA 2BASA 1HGZA 5CHXA 1LT9B 4M7FA 3TNUA 5CJ0A 2HLOA 1DH3A 1HBWA 4HH2A 1X79B 3BVHB 2JHHC 1SLQA 5AVUB 1GL2D 1MFZA 1ZLLA 1RE4C 2I1KA 4IFFA 2J0YA 1RY3A 1N73B 1CI6B 4WY4D 1LTGC 1LWUB 1URQA 1IFDA 3P8MC 1NOHA 2FYUK 1LTJB 2P7JA 4AYCA 3MGNA 1H88A 1GZLA 5APYA 3H32C 1YYCA 3IFMA 1LTAC 1IFMA 3V5BA 5AW6B 2J5ZA 2GY7A 3E1IB 4WB4A 4KHXA 2FYZA 2WSFH 2XKMA 2OYIC 5AVQB 1GL2A 2XV5A 1J1EC 2IFNA 2W27A 1RE3B 1JCCA 2POHA 1LT9C 1A02J 1SP4A 3GHGB 1FZFA 1LTBC 2WSCH 3RK3B 3NTNA 2QM7A 1G1JA 5APUA 1E5WA 3BVHC 5AW0B 2N9BA 2KLVA 1FJKA 1SQPK 2LKMA 1N73C 1CZQA 1WT6A 3BASA 1OXZA 3V4QA 1LWUC 2W6AA 1T2KC 4IFMA 3HE4A 1KQLA 1RF1B 3U1CA 2Z4EB 1G2CA 2KYVA 1HTLC 5BVZA 1NWQA 2O1JA 1SFCD 2YKOA 4HYTB 5AVVB 2HPCA 3V2NA 1FZBA 2PP6A 2HODB 3U59A 2WITA 3E1IC 1IC2A 4N3YB 2H7HA 2E42A 1L0LK 1KILD 3P32A 1GTWA 5APVA 4AUWA 2J61B 3OJAB 3TK1A 4JF7A 3TYYA 1HVVA 5APXA 1SVFA 5KTBA 4JYBA 1RE3C 2FFDA 1GDTA 2WT7A 2C0WA 3VMYA 2D39A 3GHGC 1NH4A 4W80A 5APQA 4R9TA 3B8EB 2N1TB 1NTZK 5CCHD 1NTMK 5CMZA 4ZFGA 2O1KA 2H8PD 1FDMA 3HD7B 1MUUA 2XNXC 3V2RA 4AQRD 2O01H 4LLHA 4IFDK 2P67A 1KILA 3HUSB 5AW3B 1N7SC 1SQBK 2YO2A 1RF1C 1SQVK 3MIWA 1L4AB 5AW2B 1JUNA 2J60A 2Z4EC 2H43B 1URQD 2Q7CA 5APSA 5AW7B 4Y99B 1FJPA 4XE5B 1RE4A 2HODC 3HE5B 3VTPC 2R3CA 1LTSC 1FZCB 3KYQA 3C9IA 4N78D 1AFOA 3NMDA 3H32A 4DZOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FZF C;  2OYI C;  1RF0 A;  2J61 A;  1FIB A;  1FZB C;  1N86 C;  1T3U A;  1RE3 B;  1LT9 C;  3GHG B;  1FZF A;  2OYH C;  2OYI A;  2J0H A;  2JHK F;  2HLO B;  3BVH C;  3HUS C;  1LT9 A;  2OYH A;  2Q9I C;  2J2P A;  2J3O A;  1N73 C;  2A45 I;  2H43 C;  2J3F D;  1FIC A;  1LWU C;  3BVH A;  1JY3 O;  3HUS A;  4NYT A;  2HPC C;  2Q9I A;  1JY3 P;  1RE4 B;  1RF1 B;  2J64 A;  1FZA C;  2Z4E B;  2A45 H;  1FZG B;  1FZE C;  2H43 A;  2J1G A;  1JY3 N;  1LWU A;  1FZC C;  1Z3U A;  2OYH B;  1M1J B;  2HPC A;  2J0G A;  1FZB A;  2HOD B;  3E1I C;  1FZA A;  1N86 A;  2FIB A;  2FFD C;  1FZD A;  3H32 B;  1JC9 A;  1JY2 P;  1FZC A;  4JZC A;  1RF0 B;  2J61 B;  4R9J A;  4JYO X;  1W2E A;  1FID A;  3FIB A;  1JY2 N;  3E1I A;  1RE3 C;  2FFD A;  2J3F A;  2D39 A;  3GHG C;  1FZF B;  2OYI B;  1LTJ C;  2JHI F;  1Z3S A;  2HLO C;  2JHL F;  4R9T A;  2HPC B;  1N73 A;  1FZB B;  2WNP F;  1N86 B;  4ZFG A;  1RE3 A;  2JHM F;  1LT9 B;  4M7F A;  3GHG A;  2XNX C;  1LTJ A;  2HLO A;  1JY2 O;  1FZE A;  3BVH B;  3HUS B;  2A45 G;  2JHH C;  4M7H A;  2J3U A;  2XNX A;  1RE4 C;  2Q9I B;  1RF1 C;  2J0Y A;  2J60 A;  2Z4E C;  1N73 B;  1FZG C;  2J3G A;  2H43 B;  1LWU B;  1M1J C;  1LTJ B;  1RE4 A;  1RF1 A;  2HOD C;  2Z4E A;  1FZA B;  4EPU A;  1FZG A;  1FZE B;  3H32 C;  1FZC B;  1RF0 C;  1M1J A;  2XNX B;  2J5Z A;  2HOD A;  2GY7 A;  3E1I B;  2FFD B;  3H32 A; 
#chains in the Genus database with same CATH topology
 3H1L E;  1SQX K;  1OFC X;  3C1L A;  5KLI C;  4EI2 A;  1T3U A;  3PLN A;  3G6E P;  3PHL A;  1NU1 J;  2FKW B;  1H0T A;  3HD7 C;  1VQK P;  1L0L J;  1SQQ K;  2I1J A;  1KQF B;  4I2L C;  3HUS C;  1A02 F;  1YIJ P;  4PV1 C;  1H89 A;  2M3E A;  5AW9 B;  1RQV A;  1DD4 A;  4WY4 B;  2R32 A;  3AEF C;  4PD4 D;  3L75 D;  2JWA A;  4Z1M H;  1WMK A;  2CPS A;  2JJL A;  2ZVN B;  2SPZ A;  3VP8 A;  1T3J A;  1M1J B;  2E74 D;  1LP1 B;  1JY2 P;  1KYO I;  1FID A;  3I56 P;  3FIB A;  1YJW P;  3B5N B;  1Q86 Q;  1OVV A;  4D6T D;  2QJP B;  3VMZ A;  1S5L H;  2HFE D;  2HPC B;  5KAF E;  1HJ0 A;  3T97 B;  3GHG A;  3Q5P A;  5APW A;  3ZDM A;  2E43 A;  4WY4 C;  1BE3 E;  3L36 A;  2LXB A;  3N4X A;  1VF5 D;  2Q9I B;  4HB1 A;  2IZ0 A;  3CXH D;  2C0X A;  4HJG H;  3CME P;  3GF7 A;  5KAI E;  1M1J C;  1SFC B;  3H1I E;  4C46 A;  2Z4E A;  1ZXG A;  1KMI Z;  1NAF A;  2QG4 A;  2WSC J;  3H1J G;  2OYO A;  1FE6 A;  3B5N C;  2Y0D A;  3RK2 B;  2IBZ E;  1L0L D;  1EDK A;  3H1L J;  2QJP C;  3R2P A;  2QE7 H;  1FOS E;  2J61 A;  1BDD A;  4U3F E;  3IF4 A;  2JWD A;  2YIU B;  3KQG A;  2HLO B;  2J58 A;  2V7Q H;  2WZ7 A;  1NJI Q;  1K8A Q;  2YMK A;  2OYH A;  2Q9I C;  1GW4 A;  2J2P A;  3EFF K;  1URQ B;  1SFC C;  3GLM A;  1L4A A;  3FWN A;  2H43 A;  1HH0 A;  1Z3U A;  4DT0 A;  1YTZ I;  1GD2 E;  2FIB A;  1BCC E;  4YTP C;  3RK2 C;  4ZKU A;  3H6P A;  3WMM 0;  2Y0C A;  1UIX A;  1P84 D;  1K9M Q;  2YIU C;  1FZF B;  3CWB G;  2JHI F;  4QMA A;  2HLO C;  3WU2 H;  1DX7 A;  3BCC G;  1N73 A;  3G3Z A;  1NTZ G;  1NTM G;  2MJZ A;  2RH0 A;  2UWJ E;  2YNY A;  3M9Q A;  1BE3 J;  2ZAE B;  5AVX B;  1URQ C;  3M0D A;  3CI9 A;  3HE4 B;  5AW1 B;  1U57 A;  2P10 A;  4GOF A;  4YXW H;  3H1I J;  1IFI A;  3H1L D;  4EPU A;  1FZE B;  3VN0 A;  2O01 N;  3L35 A;  5KLV D;  4JYC A;  4EOT A;  1FZF C;  3L75 G;  1FIB A;  1J2J B;  3USS A;  2ZVO B;  4U3F J;  4H44 D;  2WTY A;  3Q2Y A;  4W7Y A;  2NPS A;  3SWY A;  1N7L A;  1JMM A;  1S4X A;  2H88 C;  4OWF A;  1SQV E;  5KJ7 A;  2ITA A;  1CW5 A;  4PV1 D;  2QJK B;  2KSJ A;  2KP8 A;  3OW2 O;  2BEQ D;  2G8Y A;  1FZE C;  1R8E A;  1JY3 N;  1KOR A;  4A7P A;  2C9N Y;  3LW5 H;  2M0B A;  3AE3 C;  3VMX A;  1BCC J;  1N8R Q;  1Q2N A;  1QL1 A;  1KZU B;  1QL2 A;  5APT A;  1JC9 A;  4JZC A;  3PJS K;  2J59 M;  4PD4 I;  2AEM A;  3PRJ A;  1YI2 P;  1EXJ A;  1J1E B;  2C9L Y;  3AE8 C;  1JTH A;  1MKM A;  1HGZ A;  5CHX A;  3TNU A;  5CJ0 A;  1OW6 A;  5GTH E;  1L0N E;  1X79 B;  1L0L G;  1MFZ A;  4IFF A;  2J0Y A;  1Q90 D;  4WY4 D;  1LTG C;  1K04 A;  1HF9 A;  3P8M C;  2AXC A;  3V6I A;  2KZI A;  1IK7 A;  1NGM B;  4BXL A;  5CBN A;  1EDJ A;  3V5B A;  2J5Z A;  4NPD A;  2FYZ A;  3PTZ A;  2MKV A;  3CXH I;  5AVQ B;  1J1E C;  1S1C X;  3SFD C;  2QJY B;  1RE3 B;  1JCC A;  2POH A;  2M5A A;  2Y0E A;  3RBX A;  1LTB C;  2AXT H;  3RK3 B;  1SQV J;  3L73 D;  3S4R A;  1CZQ A;  1PGJ A;  1T2K C;  4KJM A;  1G2C A;  5BVZ A;  1SFC D;  4HYT B;  3V2N A;  1FZB A;  1KTM A;  4N3Y B;  2E42 A;  1L0L K;  3P32 A;  5APV A;  1BDC A;  3K5B A;  4JF7 A;  4NPE A;  3TYY A;  1HVV A;  2RKL A;  5GTI E;  3L72 E;  2QJY C;  1RE3 C;  2FFD A;  1PP9 E;  1EXI A;  1KYO H;  4W80 A;  5APQ A;  3H1L G;  3WUU A;  2E74 C;  4OVN F;  4ZFG A;  2H8P D;  1MUU A;  2XNX C;  4AQR D;  1NYH A;  1L0N J;  3CCU P;  1KIL A;  4TT3 H;  1P84 I;  3ABV C;  1KN7 A;  3RK3 E;  1URQ D;  4BRY B;  2AEJ A;  4UB8 H;  5DJU B;  1RE4 A;  1OZH A;  1U7J A;  3HE5 B;  4EYY Q;  2R3C A;  2I8D A;  3KYQ A;  1IZN B;  3H32 A;  4DZO A;  2Y9Z A;  3JC2 2;  3II6 A;  3KDP B;  4RES B;  3E7K A;  1SQV D;  4OGQ B;  1KD1 Q;  2QA4 P;  5E79 E;  3I5C A;  1S5L E;  3A3Y B;  3L74 D;  4CPG A;  3HTK A;  2N9Y B;  1Y9B A;  1BE3 G;  3KPE A;  3AEC C;  2W6B A;  2KNC A;  3FWL A;  1KIL E;  1FZG B;  5KLV K;  1N86 A;  3CL3 D;  1HUC A;  4IL6 E;  3L72 J;  1S72 P;  1JY2 N;  1PP9 J;  4OGQ C;  3AEA C;  4ZNC A;  1L0N D;  1LTJ C;  1JCD A;  4EIJ A;  3A0B H;  2ZFC A;  1HGV A;  1EZV E;  3RGU A;  3CCE P;  1JMB A;  2HR3 A;  4M7H A;  3MUD C;  1SQP D;  3O6Q B;  1FZG C;  2JDI H;  2J3G A;  2B89 A;  1N7S A;  5CCG D;  2N1T D;  1S3J A;  1FZA B;  2KLU A;  2GM4 A;  2ZYG A;  2KS1 A;  3LIE A;  1JO5 A;  1TU3 F;  1NKN A;  1HJB A;  1YJ9 P;  5EFW B;  1BCC G;  3B4S A;  4BWN A;  1VQ7 P;  2QVA A;  3FGA D;  5B66 H;  2JO1 A;  5KKZ C;  3CWB D;  2YXR B;  2KB7 P;  3BCC D;  1NTK K;  2KXP B;  3HD7 A;  4H44 C;  4ZMD A;  2J3F D;  4JBZ A;  3B71 A;  3HUS A;  2FYU E;  3CC7 P;  1FZA C;  3AE9 C;  4GDO A;  1T2K D;  3L72 D;  1PP9 D;  3D6Y A;  2LXC B;  2GUS A;  1S9K E;  2NZ2 A;  3P8C E;  3I55 P;  1PFI A;  2OGU A;  2B9B A;  3BRV B;  2XND H;  2KZJ A;  2KSE A;  2B87 A;  1IO4 A;  4RO0 A;  4GIF A;  1YQ3 C;  1Y8A A;  3WUV A;  1FS0 E;  2FYN B;  4PD4 H;  2WPV B;  3R4Y A;  1KC8 Q;  1GMJ A;  2HG5 D;  2HYN A;  3RK3 D;  1JY2 O;  3V4W A;  2V7Q J;  3KXD A;  3MD0 A;  1SQV G;  3HRN A;  2XU6 A;  4WY4 A;  2IDB A;  5K5G B;  3L74 G;  4C7R A;  5B5E H;  3IR9 A;  1QX8 A;  1M1J A;  4I6M C;  1LP1 A;  1USD A;  2FXM A;  3SFE C;  5AVZ B;  2YKP A;  3B5N A;  1PPJ E;  1XTG B;  2CPB A;  3CXH H;  2J0H A;  3VP9 A;  1SQB E;  3T97 A;  1BGY E;  1NU1 D;  2L5G B;  1DIP A;  1GW3 A;  1UII A;  2FYU J;  1VQL P;  1L0N G;  4GT1 A;  2P2U A;  2HPC C;  2Q9I A;  3AEG C;  1GU4 A;  3PH0 A;  1AJY A;  2Y9Y A;  1SFC A;  2OYH B;  4R4L A;  1SQX E;  4R9J A;  1SQP G;  1YIT P;  1W2E A;  1Z56 A;  1PGP A;  2Q3I A;  1R5S A;  1QVG O;  2OYI B;  1T8Z A;  1SQQ E;  3TSI A;  1OIP A;  4OGQ D;  3V2P A;  1LT9 B;  4M7F A;  4YXD C;  2OTK E;  2HLO A;  2AXT E;  1HBW A;  4HH2 A;  3BVH B;  2PGD A;  1GL2 D;  1ZLL A;  1N73 B;  3H1H E;  1CI6 B;  3H25 A;  2O3J A;  1LWU B;  1URQ A;  3AE1 C;  1IFD A;  1P84 H;  4AYC A;  3A0H H;  2OQQ A;  1QVF O;  1YYC A;  3W68 A;  3IFM A;  1LTA C;  3LW5 J;  3CX5 D;  1LT1 A;  2V4H A;  3E1I B;  2XKM A;  2OYI C;  1M1K Q;  2XV5 A;  2IFN A;  2W27 A;  2KIK A;  3L72 G;  1LT9 C;  1SP4 A;  4H13 B;  1FZF A;  1PP9 G;  4K35 A;  2WSC H;  3NTN A;  1RH5 B;  1G1J A;  2FYU D;  5APU A;  1E5W A;  3BVH C;  1SQB J;  1BGY J;  1SQP K;  2FXP A;  1N73 C;  1JM0 A;  1LWU C;  2WSE J;  2KI7 B;  3HE4 A;  1RF1 B;  4GOE A;  3TGU E;  1IFP A;  1ZOY C;  2YKO A;  5AVV B;  2PP6 A;  2HOD B;  3E1I C;  1IC2 A;  1GTW A;  1SQX J;  3OJA B;  2WSS H;  1GDT A;  2LR2 A;  1SQQ J;  4H13 C;  3AE6 C;  3B8E B;  2N1T B;  1NTZ K;  1NTM K;  5CMZ A;  4JPZ B;  4IFD K;  2P67 A;  1X22 A;  1RF1 C;  1JUN A;  3MIW A;  3L70 E;  3H1H J;  4UB6 H;  4KT0 J;  1AV1 A;  1BE3 D;  4Y99 B;  4XE5 B;  2HOD C;  3VTP C;  1FZC B;  1PPJ D;  1NU1 G;  2FXO A;  1FC2 C;  3CC4 P;  1AFO A;  2IYO A;  3H1I D;  1USE A;  3A5T A;  2QJK C;  5CCG C;  1NVO A;  2PAJ A;  4LGD E;  2N1T C;  1JNM A;  1KFN A;  3L71 E;  1VQ6 P;  3SSU A;  1BGY D;  2W6J H;  2JP3 A;  3H1J E;  1LTT C;  1N2D C;  3TF5 A;  1VQ9 P;  2IBZ D;  1HWT C;  1FBM A;  3JCU E;  2B88 A;  4U3F D;  4C7N B;  1EZV G;  1FIC A;  2M5A B;  4NYT A;  4Y99 C;  2R5D A;  4WWI A;  3TGU J;  1OMI A;  4B86 A;  1KB9 E;  1FZC C;  2PRR A;  1VPC A;  1YHQ P;  2J0G A;  3PP5 A;  1RF0 B;  2W8Z A;  1NKZ B;  3H1K E;  1VQ5 P;  1BCC D;  5AVS B;  2GUV A;  5AVR B;  1VQ4 P;  3CPW O;  1FZB B;  5B66 E;  1RE3 A;  2JHM F;  2WPQ A;  1KQG B;  3H1H D;  5H2F E;  1NU1 K;  1WRG A;  3E1R A;  4GKG A;  2IFM A;  2A45 G;  3G4S P;  4K3A A;  3L70 J;  2XNX A;  2WSF J;  2BCC E;  1AQ5 A;  4N78 E;  3RK3 C;  1FDO A;  2FYU G;  1GK4 A;  3IN6 A;  2IZ1 A;  2YO3 A;  1LGH B;  1KIL B;  2WWW A;  1RF0 C;  4WBA A;  4GOD A;  3M06 A;  2IYP A;  5TJH A;  1G1I A;  3L71 J;  2OAR A;  1FZB C;  3OAK A;  1LJ2 A;  1ZR4 A;  3H1J J;  2R3S A;  1OX3 A;  4TLF A;  1NHL A;  3JSV C;  2E5T A;  3CX5 I;  3TGU D;  4PD4 E;  2QEX P;  2OTL P;  3A2A A;  2A45 I;  1H8A A;  2WMM A;  3GF3 A;  2QM8 A;  4U7J A;  1M7L A;  1KIL C;  2ZXE B;  4BRY A;  1OVR A;  3HTK B;  2K9J A;  3M9B A;  1PIX A;  2ZXX A;  1ZR2 A;  1ZV8 A;  1MV8 A;  5B5E E;  3HE5 A;  5AVT B;  4D6T E;  1VQN P;  1FZD A;  1Q82 Q;  1MFT A;  2R44 A;  2ZYA A;  5AW8 B;  2O01 J;  1GL2 B;  4ASW A;  3H1K J;  5CCH C;  2JR8 A;  1ZME C;  1FU1 A;  2ZT9 B;  2Q6Q A;  1MZ9 A;  1N86 B;  3L70 D;  1EC5 A;  1PPJ G;  5AVW B;  4H13 D;  2YMY A;  1LTJ A;  3H1I G;  2Z5H A;  3D6Z A;  1BGY G;  2W83 C;  1ZW0 A;  3UIA A;  2BCC J;  2NPS D;  2H89 C;  2IBZ G;  3VOP A;  3MUD A;  4M3L A;  1LNQ A;  5GTH H;  1FZG A;  4U3F G;  2GA1 A;  2M8R A;  3L71 D;  1M90 Q;  1GL2 C;  5KJ7 D;  1M57 D;  2IPP A;  1ZP0 C;  2WT7 B;  1JOC A;  3KHU A;  1N7S B;  1LTI C;  1SQX G;  1Y47 A;  3BAT A;  1D7M A;  1N86 C;  2P58 A;  2JEE A;  3CCS P;  2P1J A;  2KK7 A;  1YBK A;  4LC1 A;  3BRT B;  3IAO A;  1EQ7 A;  1Q7Y Q;  1JB0 J;  1CSB A;  3W67 A;  1KB9 D;  1AA0 A;  3D70 A;  3WUT A;  1YQ4 C;  2IBZ I;  3H1K D;  3H1H G;  1FAV A;  1ZN5 A;  1QLE D;  3WU2 E;  3RL0 D;  1P84 E;  2L91 A;  4D6T J;  1FZA A;  3RL0 g;  3A0H E;  3CC2 P;  5C39 A;  3Q5S A;  3CCJ P;  3F89 A;  1VQP P;  2K1A A;  1H0T B;  3TDK A;  1XTC C;  2E75 D;  2JHL F;  3V2Q A;  2BAS A;  2K88 A;  2QRX A;  1DH3 A;  5GTI H;  1W2B O;  3KZI H;  5AVU B;  2B87 B;  2D2C B;  1M8O B;  1Q81 Q;  1VQO P;  1NOH A;  2ZJS E;  5KLV E;  2P7J A;  3MGN A;  1GZL A;  3TGU G;  5DJT B;  2Q1K A;  2K37 A;  1EDL A;  4WB4 A;  4KHX A;  4JQ0 D;  1BSN A;  2QIW A;  3GHG B;  2QM7 A;  5AW0 B;  4H0L B;  1FJK A;  2D2C C;  1EDI A;  2E76 B;  5TIS H;  1WT6 A;  3BAS A;  2W6A A;  4IFM A;  5E79 H;  3U1C A;  2Z4E B;  4UB6 E;  2FYN C;  1HTL C;  3L70 G;  2QSI A;  2O1J A;  3F5H A;  2HPC A;  3U59 A;  2WIT A;  1KIL D;  2A06 E;  2J61 B;  3TK1 A;  5APX A;  2C0W A;  3VMY A;  2D39 A;  3GHG C;  1NH4 A;  3AED C;  4L75 A;  3CCQ P;  3CD6 P;  4R9T A;  5CCH D;  1NTK E;  2O1K A;  3L71 G;  4H0L C;  4L74 A;  1FDM A;  3V2R A;  2E76 C;  4IL6 H;  3AE2 C;  1VQ8 P;  4MN4 C;  1EZV D;  1SQV K;  1L4A B;  2Z4E C;  4PJ0 H;  4XFJ A;  2H43 B;  2CK3 H;  5APS A;  5AW7 B;  5KLV J;  2OTJ P;  1LTS C;  3C9I A;  1RHZ B;  2WVR A;  5M1B A;  3VMA A;  1NO4 A;  3ITK A;  3H1K G;  3L73 E;  1YJN P;  2OYH C;  5CJ4 A;  2OYI A;  2ZT9 D;  1W5C E;  2IX7 C;  1DEE G;  4IOI H;  3D71 A;  1IFN A;  2BEZ F;  1K73 Q;  2XDJ A;  1LT9 A;  1L4A C;  3GW6 A;  2E5Y A;  1FDI A;  2H43 C;  3CX5 H;  3BVH A;  1L0N K;  4DCK A;  1X9V A;  2J64 A;  2A45 H;  1CI6 A;  1LWU A;  4L76 A;  3CLQ A;  1KYO E;  2VRS A;  1OWA A;  2BCC G;  3L4F A;  2Q5U A;  3M0A A;  1KB9 I;  4JYO X;  3E1I A;  1OW8 A;  3G9R A;  2NPS B;  1N7S D;  1S9K D;  1NTK J;  3P8C D;  3QH9 A;  2WNP F;  1S2E A;  5BU8 B;  1ZRT E;  3M0D C;  5AVY B;  4UB8 E;  3OA7 A;  3FX0 A;  1FZE A;  2YKQ A;  2J5U A;  2J3U A;  1VQM P;  5AW4 B;  1OW7 A;  4RJT A;  1RF1 A;  3AE5 C;  3LID A;  3EFG A;  4NPF X;  3HD7 D;  3AE4 C;  4DOJ A;  2HOD A;  1AVO A;  2NPS C;  3U1A A;  3MZW B;  4D6T G;  3L74 E;  2WPS A;  3GMA A;  5KAF H;  1X8Y A;  3L73 J;  1JTH B;  5KJ7 C;  3TNU B;  2PFX A;  1QGK B;  5CCG A;  3NFQ A;  3RL0 B;  2N1T A;  3MTU E;  4W7Z A;  3FXD A;  3O8Z A;  1VL2 A;  2J3O A;  3M9H A;  2WPR A;  4EDF A;  5KAI H;  5L8R J;  3Q3D A;  1AQT A;  2D2C D;  1IK9 A;  2E75 B;  5CBO A;  1SQB D;  1DEB A;  2A06 D;  1PV3 A;  4ZKP A;  2J1G A;  4I1L A;  4Y28 J;  3A0B E;  1NTK D;  3AEE C;  4YPC A;  1FZC A;  3CCL P;  2R5B A;  1J1D B;  2WSE H;  2ZYD A;  2J3F A;  2K9Y A;  1Z3S A;  1SQX D;  3RL0 C;  1BSH A;  3L37 A;  3GG2 A;  1SQP E;  1SQQ D;  1T6A A;  3S1K A;  4H0L D;  4C7N A;  2E75 C;  2E76 D;  3P7K A;  3CCM P;  1G2C B;  3N7N A;  3B5N D;  5BU5 A;  1FOS F;  4DJG A;  3S9O A;  2E74 B;  1IJD B;  1J1D C;  2XNX B;  2Z5I A;  3M91 A;  3MP7 B;  2WQY C;  2FFD B;  1EZV I;  3CWB E;  3L74 J;  2KOG A;  3SWF A;  1IFJ A;  3BCC E;  1KFM A;  1RF0 A;  1NTZ E;  4O9B A;  1NTM E;  3NXS A;  2XZR A;  1KQS O;  2JHK F;  4N6J A;  1GK6 A;  1R5L A;  1VDF A;  1VF5 B;  1GU5 A;  1KYO D;  4OH8 B;  3KZI E;  3RK2 D;  1JY3 O;  1DD3 A;  2K3R A;  3A7O A;  1L4A D;  1JY3 P;  1RE4 B;  4RKU J;  1X0T A;  3EQ2 A;  4HKZ H;  3VYI A;  1OVU A;  2M3B A;  5KLV G;  2FFD C;  3H32 B;  3L75 E;  3FXE A;  2DW3 A;  2RMZ A;  1ZRT D;  1AVY A;  2RN0 A;  3AE7 C;  1JEK A;  1YTZ T;  4R4M A;  2K9J B;  4XA4 A;  5AW5 B;  3RBZ A;  5CCH A;  1PZQ A;  1M56 D;  1SQP J;  2KUB A;  1VF5 C;  3G71 P;  2JHH C;  1SLQ A;  2I1K A;  1RE4 C;  2KNC B;  1RY3 A;  5TIS E;  2Q3E A;  2FYU K;  1LTJ B;  4L73 A;  3MHV A;  1H88 A;  4I7Z B;  5APY A;  3SWK A;  3H32 C;  3CXH E;  3EWK A;  1IFM A;  5AW6 B;  2GY7 A;  3CWB J;  1NAY A;  2WSF H;  3BCC J;  1K05 A;  1NTZ J;  1SQB G;  1NTM J;  1GL2 A;  2A06 G;  1A02 J;  1NU1 E;  3Q1M A;  2G3A A;  3C8V A;  1L0L E;  1SS1 A;  1NTK G;  2N9B A;  2KLV A;  3CMA P;  2LKM A;  3H1J D;  1QEX A;  1KV4 A;  3CCV P;  1OXZ A;  3V4Q A;  2ZT9 C;  1KQL A;  2W90 A;  2KYV A;  4PJ0 E;  4I7Z C;  2KS1 B;  3JCU H;  1NWQ A;  5KKZ B;  2FY8 A;  3CCR P;  1SQQ G;  2NRG A;  2H7H A;  3L75 J;  3Q5R A;  2FBW C;  4AUW A;  1PGQ A;  1S5L X;  2AEF A;  4WVZ A;  1SVF A;  4H44 B;  5KTB A;  4JYB A;  1KB9 H;  2WT7 A;  3O6Q A;  1U7M A;  3AEB C;  1RQU A;  1E79 H;  5KLI B;  1L2P A;  3HD7 B;  3QWO C;  3L73 G;  2O01 H;  4LLH A;  3HUS B;  5AW3 B;  1N7S C;  4PV1 B;  1SQB K;  4ASV A;  2JKV A;  2YO2 A;  2J60 A;  5AW2 B;  2Q7C A;  2YXQ B;  3CX5 E;  4IL6 X;  5H2F H;  1FJP A;  1NTZ D;  1NTM D;  1PGO A;  2BCC D;  4N78 D;  3NMD A;  1PL5 A; 
#chains in the Genus database with same CATH homology
 3II6 A;  5CCG C;  2PAJ A;  1SQX K;  4LGD E;  2N1T C;  3KDP B;  1JNM A;  1KFN A;  1NO4 A;  4RES B;  1T3U A;  2FKW B;  3HD7 C;  1LTT C;  1N2D C;  2OYH C;  5CJ4 A;  2OYI A;  1HWT C;  3I5C A;  1FBM A;  1SQQ K;  2IX7 C;  3A3Y B;  2I1J A;  4I2L C;  1IFN A;  3HUS C;  2XDJ A;  1A02 F;  3HTK A;  4C7N B;  1LT9 A;  1H89 A;  5AW9 B;  1L4A C;  3A5T A;  2H43 C;  4WY4 B;  1FIC A;  3BVH A;  1L0N K;  2R32 A;  3KPE A;  4Y99 C;  4NYT A;  2R5D A;  2W6B A;  1X9V A;  2J64 A;  2A45 H;  1FZG B;  4B86 A;  1CI6 A;  2CPS A;  1LWU A;  2JJL A;  1FZC C;  1VPC A;  3CLQ A;  2VRS A;  3VP8 A;  1T3J A;  1M1J B;  1OWA A;  3L4F A;  2J0G A;  2Q5U A;  5KLV K;  1N86 A;  3PP5 A;  3CL3 D;  3M0A A;  1HUC A;  1JY2 P;  1RF0 B;  4JYO X;  1FID A;  3FIB A;  1NKZ B;  1JY2 N;  3B5N B;  3E1I A;  2NPS B;  1N7S D;  2GUV A;  5AVS B;  1LTJ C;  1JCD A;  1S9K D;  3VMZ A;  2HFE D;  3P8C D;  5AVR B;  2HPC B;  4EIJ A;  1FZB B;  2WNP F;  2ZFC A;  5BU8 B;  1HGV A;  1RE3 A;  2JHM F;  2WPQ A;  3M0D C;  5AVY B;  3GHG A;  1NU1 K;  3OA7 A;  1WRG A;  1FZE A;  5APW A;  2YKQ A;  4GKG A;  4WY4 C;  2E43 A;  2IFM A;  3L36 A;  2A45 G;  3N4X A;  4M7H A;  2J3U A;  2XNX A;  2Q9I B;  2C0X A;  1FZG C;  2J3G A;  5AW4 B;  1AQ5 A;  4N78 E;  1N7S A;  1M1J C;  1SFC B;  3RK3 C;  5CCG D;  1GK4 A;  2N1T D;  4C46 A;  1RF1 A;  2Z4E A;  1FZA B;  3LID A;  2YO3 A;  1LGH B;  2GM4 A;  3EFG A;  1KIL B;  3LIE A;  2WWW A;  1JO5 A;  1RF0 C;  3HD7 D;  1NAF A;  4WBA A;  1NKN A;  3B5N C;  4DOJ A;  2HOD A;  3M06 A;  1HJB A;  1G1I A;  3RK2 B;  2NPS C;  3U1A A;  3R2P A;  1FOS E;  2J61 A;  2WPS A;  2OAR A;  1FZB C;  3OAK A;  1X8Y A;  1ZR4 A;  1JTH B;  5KJ7 C;  3TNU B;  5CCG A;  3KQG A;  2HLO B;  2KB7 P;  3NFQ A;  3RL0 B;  2N1T A;  1NHL A;  2J58 A;  1NTK K;  3MTU E;  2WZ7 A;  4W7Z A;  3O8Z A;  3HD7 A;  2OYH A;  2Q9I C;  1GW4 A;  2J2P A;  3A2A A;  2J3O A;  3M9H A;  2A45 I;  2WPR A;  2J3F D;  3HUS A;  1URQ B;  1SFC C;  1H8A A;  1IK9 A;  1DEB A;  1L4A A;  1FZA C;  4ZKP A;  2QM8 A;  2H43 A;  1M7L A;  2J1G A;  1KIL C;  2ZXE B;  4I1L A;  1T2K D;  3HTK B;  3M9B A;  1HH0 A;  1Z3U A;  1ZR2 A;  1ZV8 A;  1YTZ I;  1GD2 E;  1MV8 A;  2FIB A;  3HE5 A;  5AVT B;  2GUS A;  3RK2 C;  1S9K E;  1FZD A;  5AW8 B;  1FZC A;  3P8C E;  1PFI A;  1GL2 B;  2R5B A;  3BRV B;  1J1D B;  2WSE H;  4ZKU A;  3H6P A;  3WMM 0;  5CCH C;  2J3F A;  1FZF B;  2JHI F;  1Z3S A;  1IO4 A;  2HLO C;  1FU1 A;  1DX7 A;  3RL0 C;  3G3Z A;  4GIF A;  1N73 A;  1MZ9 A;  1N86 B;  2MJZ A;  3L37 A;  5AVW B;  2YNY A;  3M9Q A;  2YMY A;  2HG5 D;  1LTJ A;  2HYN A;  3RK3 D;  1JY2 O;  3V4W A;  2Z5H A;  5AVX B;  1URQ C;  4C7N A;  3M0D A;  3CI9 A;  3MD0 A;  3HE4 B;  5AW1 B;  3P7K A;  1G2C B;  3N7N A;  3B5N D;  3HRN A;  3UIA A;  2XU6 A;  4WY4 A;  5BU5 A;  2NPS D;  1FOS F;  3VOP A;  3MUD A;  4M3L A;  1IFI A;  4C7R A;  4EPU A;  1FZG A;  3IR9 A;  1FZE B;  2M8R A;  1GL2 C;  5KJ7 D;  3VN0 A;  1IJD B;  1J1D C;  1M1J A;  4I6M C;  2XNX B;  2Z5I A;  3M91 A;  2IPP A;  3L35 A;  2FFD B;  4JYC A;  2WT7 B;  4EOT A;  1JOC A;  1FZF C;  2KOG A;  3SWF A;  1IFJ A;  1N7S B;  1KFM A;  1RF0 A;  2FXM A;  1LTI C;  1FIB A;  4O9B A;  5AVZ B;  3NXS A;  1J2J B;  2XZR A;  3BAT A;  2YKP A;  3B5N A;  1XTG B;  1N86 C;  2JEE A;  2WTY A;  2CPB A;  2P1J A;  4W7Y A;  2NPS A;  3SWY A;  1N7L A;  2J0H A;  2JHK F;  1JMM A;  4N6J A;  4LC1 A;  3BRT B;  1GK6 A;  3VP9 A;  1EQ7 A;  1VDF A;  3T97 A;  1CSB A;  5KJ7 A;  1GU5 A;  2L5G B;  4OH8 B;  1CW5 A;  1GW3 A;  3RK2 D;  1JY3 O;  4GT1 A;  2P2U A;  3A7O A;  1L4A D;  1JY3 P;  2KSJ A;  2Q9I A;  1RE4 B;  2HPC C;  2KP8 A;  1GU4 A;  1FZE C;  3EQ2 A;  1JY3 N;  1FAV A;  1ZN5 A;  2C9N Y;  3VYI A;  3LW5 H;  1SFC A;  2OYH B;  3VMX A;  3RL0 D;  2M3B A;  1FZA A;  1QL1 A;  2FFD C;  1KZU B;  1QL2 A;  3H32 B;  5APT A;  1JC9 A;  4JZC A;  4R9J A;  1W2E A;  1Z56 A;  2Q3I A;  2J59 M;  1YTZ T;  1XTC C;  2OYI B;  1T8Z A;  1J1E B;  4XA4 A;  2JHL F;  3TSI A;  5AW5 B;  2C9L Y;  5CCH A;  3V2P A;  3V2Q A;  1JTH A;  2BAS A;  1HGZ A;  5CHX A;  1LT9 B;  4M7F A;  3TNU A;  5CJ0 A;  2HLO A;  1DH3 A;  1HBW A;  4HH2 A;  1X79 B;  3BVH B;  2JHH C;  1SLQ A;  5AVU B;  1GL2 D;  1MFZ A;  1ZLL A;  1RE4 C;  2I1K A;  4IFF A;  2J0Y A;  1RY3 A;  1N73 B;  1CI6 B;  4WY4 D;  1LTG C;  1LWU B;  1URQ A;  1IFD A;  3P8M C;  1NOH A;  2FYU K;  1LTJ B;  2P7J A;  4AYC A;  3MGN A;  1H88 A;  1GZL A;  5APY A;  3H32 C;  1YYC A;  3IFM A;  1LTA C;  1IFM A;  3V5B A;  5AW6 B;  2J5Z A;  2GY7 A;  3E1I B;  4WB4 A;  4KHX A;  2FYZ A;  2WSF H;  2XKM A;  2OYI C;  5AVQ B;  1GL2 A;  2XV5 A;  1J1E C;  2IFN A;  2W27 A;  1RE3 B;  1JCC A;  2POH A;  1LT9 C;  1A02 J;  1SP4 A;  3GHG B;  1FZF A;  1LTB C;  2WSC H;  3RK3 B;  3NTN A;  2QM7 A;  1G1J A;  5APU A;  1E5W A;  3BVH C;  5AW0 B;  2N9B A;  2KLV A;  1FJK A;  1SQP K;  2LKM A;  1N73 C;  1CZQ A;  1WT6 A;  3BAS A;  1OXZ A;  3V4Q A;  1LWU C;  2W6A A;  1T2K C;  4IFM A;  3HE4 A;  1KQL A;  1RF1 B;  3U1C A;  2Z4E B;  1G2C A;  2KYV A;  1HTL C;  5BVZ A;  1NWQ A;  2O1J A;  1SFC D;  2YKO A;  4HYT B;  5AVV B;  2HPC A;  3V2N A;  1FZB A;  2PP6 A;  2HOD B;  3U59 A;  2WIT A;  3E1I C;  1IC2 A;  4N3Y B;  2H7H A;  2E42 A;  1L0L K;  1KIL D;  3P32 A;  1GTW A;  5APV A;  4AUW A;  2J61 B;  3OJA B;  3TK1 A;  4JF7 A;  3TYY A;  1HVV A;  5APX A;  1SVF A;  5KTB A;  4JYB A;  1RE3 C;  2FFD A;  1GDT A;  2WT7 A;  2C0W A;  3VMY A;  2D39 A;  3GHG C;  1NH4 A;  4W80 A;  5APQ A;  4R9T A;  3B8E B;  2N1T B;  1NTZ K;  5CCH D;  1NTM K;  5CMZ A;  4ZFG A;  2O1K A;  2H8P D;  1FDM A;  3HD7 B;  1MUU A;  2XNX C;  3V2R A;  4AQR D;  2O01 H;  4LLH A;  4IFD K;  2P67 A;  1KIL A;  3HUS B;  5AW3 B;  1N7S C;  1SQB K;  2YO2 A;  1RF1 C;  1SQV K;  3MIW A;  1L4A B;  5AW2 B;  1JUN A;  2J60 A;  2Z4E C;  2H43 B;  1URQ D;  2Q7C A;  5APS A;  5AW7 B;  4Y99 B;  1FJP A;  4XE5 B;  1RE4 A;  2HOD C;  3HE5 B;  3VTP C;  2R3C A;  1LTS C;  1FZC B;  3KYQ A;  3C9I A;  4N78 D;  1AFO A;  3NMD A;  3H32 A;  4DZO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...