2OYHC

Crystal structure of fragment d of gammad298,301a fibrinogen with the peptide ligand gly-his-arg-pro-amide
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
299
structure length
299
Chain Sequence
YEASILTHDSSIRYLQEIYNSNNQKIVNLKEKVAQLEAQCQEPCKDTVQIHDITGKDCQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQSAIPYALRVELEDWNGRTSTADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDAPSAKFFTSHNGMQFSTWDNDNDKFEGNCAEQDGSGWWMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIPFNRLTI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Probing the gamma2 Calcium-Binding Site: Studies with gammaD298,301A Fibrinogen Reveal Changes in the gamma294-301 Loop that Alter the Integrity of the "a" Polymerization Site.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
molecule keywords Fibrinogen alpha chain
total genus 89
structure length 299
sequence length 299
chains with identical sequence F
ec nomenclature
pdb deposition date 2007-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2oyhC01
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 2oyhC02
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 2oyhC03
1LWUB 3HUSC 3H32B 1FZAC 2J3UA 2Z4EB 3BVHB 1LTJC 1JY2N 4JZCA 2J3OA 2A45H 2HPCB 1RE4A 2JHIF 2J2PA 1FZCB 2J1GA 1RF1B 1T3UA 2Q9IC 1FZDA 1FICA 2H43A 2OYIA 1FZGC 1RE4B 2HLOA 3E1IC 4R9TA 1FZCC 1N73A 2JHMF 2A45I 2WNPF 1M1JC 3BVHA 4NYTA 2HPCC 2OYIC 4EPUA 1LWUA 2XNXB 2HLOB 1RE3B 1LWUC 2H43B 3BVHC 2J0GA 1N73C 2J0HA 1FZCA 3E1IA 3HUSA 3GHGA 2HPCA 1FZGA 1M1JA 1Z3SA 3GHGC 2Z4EC 2Q9IA 1FZFC 2HLOC 3H32A 1JY3O 1N86A 1N86B 4M7HA 2FIBA 2H43C 1RE4C 1LT9C 1JY3P 2J60A 1FZBB 1N73B 1M1JB 3GHGB 2JHKF 3E1IB 4M7FA 2FFDB 2OYIB 1LTJA 2HODB 2HODA 1FIBA 1Z3UA 1LTJB 2J3GA 2J61A 2J5ZA 2A45G 2OYHA 2J64A 1JY2O 1RF0B 2J3FA 1RE3C 2XNXA 1JC9A 4JYOX 1FZBA 2GY7A 2OYHC 1FIDA 2HODC 1RF0A 1RF1C 2Q9IB 1W2EA 1FZEB 2OYHB 1FZFB 2D39A 2J61B 4R9JA 1FZAA 2JHLF 1FZGB 3HUSB 1JY3N 1RF1A 1RF0C 1FZBC 1LT9B 1FZEC 2FFDA 1LT9A 2J3FD 1FZEA 1N86C 2J0YA 1FZAB 3H32C 2JHHC 4ZFGA 1FZFA 1JY2P 3FIBA 1RE3A 2XNXC 2FFDC 2Z4EA
chains in the Genus database with same CATH superfamily
2I1KA 5GTIE 1EDJA 3H32B 1L0LD 3D6ZA 1Q86Q 1ZRTE 3Q5PA 1OFCX 3RGUA 2OTJP 1TU3F 4Z1MH 4CPGA 3P8CE 4DZOA 1SQPE 1ZR4A 3RL0D 1M90Q 1G1JA 1VQKP 4PJ0E 2E76B 3F89A 1LTGC 3MUDA 1VF5D 1SS1A 2FKWB 3CC7P 1MV8A 3P32A 1A02F 4WBAA 1SQVG 1NU1G 2HLOC 1PP9E 3H32A 3Q5SA 4I2LC 4HKZH 1Y9BA 3I5CA 3HE5B 1VQ4P 2JHKF 1X79B 1PGOA 3TGUG 4WVZA 2J61A 3H1KD 5KJ7D 3OW2O 1P84E 3IFMA 2E43A 1JC9A 4ZKUA 2GY7A 1IFJA 2PGDA 3A0HH 1VQ7P 2Q9IB 1FZFB 2D39A 2W83C 2I8DA 2YNYA 3MGNA 3H1LE 3II6A 1S3JA 1XTGB 2YKOA 1QX8A 1N7SC 3VOPA 3L37A 1G2CB 1VQNP 2J3OA 4N3YB 3HD7A 4PV1B 2H43A 1X22A 2NPSC 3TYYA 4EOTA 1HGVA 1JB0J 1BCCG 3CI9A 3ABVC 1M1KQ 1DIPA 2R5DA 1FOSF 4GODA 2XNXB 1KV4A 1L0NE 2HLOB 4KJMA 3P8CD 1KZUB 3H1HG 1SLQA 2O1JA 1J1DB 3PTZA 3RK2C 2ZT9C 1M1JA 2KK7A 1Q7YQ 2IX7C 2P58A 1KYOE 2AEMA 2WZ7A 4PD4D 4JYCA 3L72G 3CWBD 1NTZK 1LTSC 1SP4A 1MFZA 4GIFA 4M7FA 5CCGD 3USSA 5KLIC 1T3JA 2FYZA 4W7ZA 3NMDA 4UB6E 1PPJD 4QMAA 2K37A 1AQ5A 1FZEB 4PV1C 2LKMA 1USEA 3RK3C 1SQQK 1CW5A 3B5NA 1LT9B 3AEGC 4H13D 4OH8B 1FZEC 3W67A 5KJ7A 1KMIZ 1L0LE 4ZFGA 4WWIA 1SQXD 5TISE 3L75G 2JWAA 3MTUE 5B5EE 2KLUA 1IFNA 1FZAC 1NKNA 4JPZB 1IFMA 1OX3A 2WSCH 2QRXA 1YTZI 2ZT9B 4GDOA 3H1HD 2OYIA 1U57A 2ZVNB 4PD4E 1S5LX 4C7RA 2ZVOB 3AE1C 4MN4C 2XZRA 1NTKK 4GKGA 4IFFA 1SFCA 2BCCJ 1S9KD 1SQBD 1VQMP 1U7JA 2KIKA 1FJKA 3CC4P 4R4MA 2L5GB 2E74C 2M8RA 1G2CA 1Z3SA 2HYNA 3SWKA 1YHQP 1BGYG 2E42A 1MKMA 2NPSA 3RK3B 1BGYD 1SFCB 1SQBG 3FXEA 3RK2B 1N73B 4N6JA 4IOIH 2Q3EA 1T6AA 2OYIB 2HG5D 3P7KA 1LTJB 2YXRB 1PP9G 1DD3A 3LW5H 2JR8A 1SQPG 3VP9A 3CWBE 4JYOX 2O01H 4UB6H 2K9YA 1EXJA 4OGQD 2GUSA 3B5ND 3U1CA 4WY4C 3B8EB 1NTKD 2J61B 4R9JA 1OVRA 1KQSO 4W80A 3OAKA 1LT9A 3GMAA 3PLNA 3MHVA 4KT0J 2QG4A 2YO3A 2XU6A 2C9LY 1E5WA 5KAFE 1G1IA 1PL5A 3H1KE 1IFPA 3TGUJ 4GOFA 3CPWO 2FYUG 1FZCC 1N73A 1KN7A 2POHA 3CX5H 4EPUA 1DH3A 2R44A 3AE5C 3H1IG 1U7MA 2AEJA 3H1LD 1QL1A 1N7SA 1N73C 2QVAA 2KSEA 3M06A 3TGUD 3CC2P 4LGDE 3M0DA 2E5TA 3HRNA 4I7ZC 2Q7CA 5APVA 1M56D 1J2JB 1RHZB 2YIUB 2A45G 1GL2B 1BGYE 1MFTA 1LJ2A 2N1TC 3LIEA 1KFNA 3E1RA 2E75B 2Q3IA 3BRTB 1NTZG 3PHLA 1IK7A 1KB9I 1KQLA 3H1HJ 1FAVA 2IYPA 3OA7A 1NAFA 5AVSB 2PP6A 3A5TA 3Q2YA 4W7YA 1HJBA 1S72P 3H1LG 2XKMA 1RQUA 1EXIA 3HUSC 3G4SP 2J3UA 4HB1A 2Z4EB 4LLHA 4XA4A 2GA1A 5AVVB 2V7QH 2A45H 1VQ6P 2IYOA 5KKZC 1FC2C 3KZIE 1L4AC 2RH0A 2D2CB 1EZVG 1FZGC 5AVYB 2P67A 4H44C 1NHLA 1L2PA 1LWUC 1LTAC 1PZQA 1OW6A 1JCDA 1UIXA 3BVHC 1SQXK 2J0HA 1QGKB 1YBKA 1BSNA 1D7MA 3E1IA 5E79H 1ZLLA 1T2KC 1NTKG 3VYIA 3GF7A 1NVOA 1LT9C 3SFEC 3H1JD 2B9BA 1URQB 3BCCJ 2QSIA 3GHGB 1LTJA 3R2PA 1SQXE 1Q81Q 2Y9YA 2HODB 1PGPA 2FYNC 1VF5B 3EFGA 3FXDA 1KTMA 1BDCA 1IO4A 3A2AA 1OIPA 2YIUC 3CCJP 4ZMDA 5DJTB 1GL2D 4NPEA 1L4AB 1W2EA 5AVXB 3K5BA 2ZYGA 1RF0C 3WMM0 2FFDA 2J0YA 5H2FE 4I1LA 4Y99C 1VQPP 4K35A 1VQ5P 1FZFA 1SQPK 1BGYJ 3C8VA 5CHXA 3Q1MA 3GG2A 1LWUB 2FYUD 1YYCA 2E74B 3BVHB 4NPDA 2Y0EA 5L8RJ 2JHIF 2AEFA 1FZCB 2JEEA 3A0BH 3JCUE 3HD7B 3EWKA 4PD4I 4HJGH 2O01N 2WSFJ 2BCCD 4JYBA 1M1JC 1KB9H 2K3RA 3BCCD 3H1JJ 1IZNB 2OYIC 1LWUA 3PRJA 2FYNB 2WPRA 2QJYB 1VF5C 1NTZE 2B89A 2PFXA 1L0ND 5AW9B 2OTLP 4I7ZB 1JEKA 4TLFA 1AFOA 2Z4EC 1L4AA 4IFMA 4U3FJ 1SQPD 1SVFA 1SQXG 3CXHH 1JY3P 2R3SA 1EZVI 2HR3A 2CPBA 1FIBA 1Z3UA 2E76C 2OYHA 2J64A 2FY8A 2FYUE 1RF0B 3L70J 2M5AB 4Y99B 1KILE 2P7JA 2BEZF 1HGZA 2ZXXA 1HJ0A 1BCCE 1N86C 2H88C 1SQVE 2OQQA 4KHXA 3ITKA 2WPSA 4DCKA 3S4RA 1NH4A 1NOHA 3CXHE 1S1CX 2H7HA 3M9QA 3H25A 1P84H 2Y9ZA 5AVUB 1HTLC 1RF1B 1T3UA 1EQ7A 2JP3A 1R8EA 1KILD 2NPSD 1SQVK 3S9OA 4R9TA 3L73J 2A06E 3CCSP 1K9MQ 1OZHA 1ZW0A 1EDIA 2QIWA 3HD7C 1CSBA 2QJPB 3CCLP 3G71P 3JC22 1HWTC 2ZT9D 1DD4A 4IL6X 3H1LJ 1NKZB 2W27A 1JY3O 4UB8E 3CXHI 1PIXA 3F5HA 5BU5A 3E1IB 3NFQA 2IDBA 5M1BA 5APTA 3S1KA 2KI7B 5AW7B 2YO2A 3SSUA 1ZN5A 3AECC 1FZBA 3M9BA 3CCUP 1JUNA 5CCGA 1RF0A 3H1KJ 3V4QA 4DJGA 4HYTB 1OMIA 2IBZE 3RK3D 1S4XA 3CX5I 1FDOA 2QJKC 3RBXA 3Q5RA 2J3FD 3GF3A 2WPQA 3VP8A 1NTKJ 2Z4EA 5AW0B 5BU8B 1PPJE 4ZKPA 3BCCG 3HE4B 3CX5E 2OYOA 1PPJG 2HPCB 5B5EH 2J2PA 3CCQP 2UWJE 2R5BA 1KORA 2WSCJ 2RKLA 2WSEH 1FICA 1CI6B 2QJPC 3E7KA 5KLVD 4DT0A 3A7OA 3M0DC 3L75D 1GW4A 3H1ID 3M0AA 3AE8C 3SFDC 3V2PA 1NU1K 1PGQA 4D6TJ 3CCRP 1FZCA 5GTHE 1K05A 1SFCD 1NAYA 3B71A 1KILA 1YIJP 1L0LG 2H8PD 4OVNF 3L75J 3IN6A 2Z5IA 3RK3E 4XE5B 2ZXEB 4RO0A 2IZ0A 1IFDA 1RY3A 2E75D 3N7NA 2FFDB 1JMMA 1VQOP 2N9YB 3L74D 3PP5A 3HTKA 3IAOA 1GDTA 3A0BE 1AVOA 3W68A 1JY2O 3D70A 3H1JG 1NTZD 4WY4A 4U7JA 3M91A 4WY4D 4UB8H 3HTKB 1FZAA 1N7LA 2FXMA 1RF1A 5KLVE 3MZWB 1QEXA 3O6QB 1H8AA 1KYOI 2IFMA 2CK3H 1P84I 1SQXJ 4YTPC 2FBWC 2OARA 1KYOH 1E79H 2Q6QA 2A06D 5GTHH 2Q9IC 1EZVD 4YPCA 1PP9J 4YXWH 5AW5B 3KYQA 2J5UA 3WU2H 2XDJA 3T97A 1URQD 3OJAB 4K3AA 4R4LA 5TJHA 4H0LC 1KYOD 2XNDH 3TNUA 2ZAEB 1A02J 1J1EB 2L91A 1VDFA 2Q1KA 2HPCA 1NO4A 1FS0E 1JCCA 5KAFH 1SQQJ 4RKUJ 5GTIH 4C46A 2NPSB 2IPPA 1NTMJ 3L74J 2C0WA 4XFJA 3L71D 1KD1Q 1SQVD 2V4HA 1VPCA 1IFIA 2DW3A 2WT7B 2KUBA 3L73G 3WU2E 4M3LA 2N1TD 2Y0CA 3FX0A 1ZRTD 1M57D 3O8ZA 4PJ0H 1HH0A 3BATA 2WSEJ 1WT6A 4IL6E 3VTPC 4ASVA 2AXTH 2MJZA 5AW6B 1PP9D 3C9IA 1IC2A 3Q3DA 4BRYB 3I55P 1J1EC 4EI2A 3L70D 5C39A 2G3AA 4JBZA 1PFIA 1JY2N 3FWLA 1RE4A 3KPEA 4BXLA 1L4AD 1VQ9P 3AEEC 2WITA 2MKVA 3JSVC 1M7LA 5AW3B 1YJNP 2JHMF 1CZQA 1JTHA 1AA0A 3IF4A 4NYTA 1Q82Q 4H44D 1NTZJ 2AXTE 2JO1A 1GU4A 1CI6A 2QA4P 2WMMA 5KTBA 3M9HA 5AVWB 3UIAA 1NYHA 3GHGA 5H2FH 2WWWA 1URQA 2IFNA 1QLED 5AW4B 1LTBC 1T2KD 5KKZB 2Q9IA 2KOGA 3G3ZA 5K5GB 1RH5B 1P84D 1RE4C 3TGUE 2J60A 1DEBA 2IBZG 1EC5A 4B86A 1JNMA 1SQBE 1GTWA 1NTKE 1SQBK 4H0LB 4D6TD 1L0NK 3L70E 2XV5A 2JDIH 3R4YA 2M5AA 2OTKE 3T97B 1JM0A 5AW1B 1GL2C 1KQFB 2D2CD 3O6QA 2RMZA 1FDMA 2N1TB 3TF5A 2K9JB 1ZOYC 3FWNA 4ZNCA 3L75E 1FZAB 3L72D 1L0LJ 4IL6H 1OVVA 1RE3A 2XNXC 3L71J 1BE3E 2QM8A 2N9BA 3AE7C 3EQ2A 3L74E 3CMEP 1HF9A 1LP1A 3RL0B 3H1JE 1YQ3C 4OWFA 3SWFA 2C0XA 3A0HE 2WPVB 1RE4B 1J1DC 1GU5A 3LW5J 1JTHB 3V4WA 4AYCA 5KLVK 1H0TA 2C9NY 1DX7A 1NTMK 2NRGA 4EIJA 5CJ4A 2V7QJ 2FXOA 1OWAA 3MD0A 1FZGA 2WVRA 1FBMA 1BSHA 2HFED 1ZP0C 1MZ9A 5CCHC 2B87A 4YXDC 2H43C 2W90A 2BEQD 1QVFO 3MP7B 3JCUH 3VMAA 5APXA 1YJWP 3TK1A 2E5YA 2J3GA 2E76D 3WUUA 1PGJA 2QJYC 4Y28J 2W8ZA 1QL2A 1L0NG 5TISH 1N2DC 2JHLF 1JO5A 2KXPB 1RQVA 3HUSB 3TDKA 1UIIA 3WUTA 3AE3C 4WB4A 4PD4H 1BE3G 1S2EA 2N1TA 3L35A 3D6YA 4AUWA 3C1LA 1SQQG 1USDA 2O3JA 4U3FG 5AVZB 1X8YA 1LTJC 5AW2B 2W6AA 3PJSK 4TT3H 3KDPB 2J1GA 1LTTC 3EFFK 1VQ8P 1FZDA 4OGQB 1KILC 1OW8A 3QWOC 3L70G 1GD2E 3RBZA 4HH2A 1K8AQ 3RL0C 3CLQA 3HD7D 3LIDA 4DOJA 2YKQA 2WTYA 3TSIA 2H43B 2YKPA 2FXPA 1T8ZA 1H89A 1Q2NA 1XTCC 1ZV8A 3GHGC 3AE4C 1FZFC 4WY4B 2KNCA 2FIBA 5KLVJ 4BWNA 4H44B 4RJTA 2AXCA 3A3YB 1L0LK 5KJ7C 1HBWA 1ZR2A 4N78E 3NXSA 1SQQD 3VMYA 2KYVA 3U1AA 1KILB 4AQRD 1JMBA 1FZBC 5KAIE 3H6PA 1ZMEC 5CMZA 3HE5A 1X0TA 1BDDA 1X9VA 1HUCA 2G8YA 1ZXGA 1EDKA 1OXZA 1IK9A 1YTZT 1H0TB 3U59A 3L72J 2B88A 1N7SD 4L73A 2WT7A 5CJ0A 3CXHD 5CCHA 2PRRA 4EDFA 5APUA 3CCVP 2ZYDA 1LP1B 3CWBG 1VQLP 2RN0A 2M3BA 2OGUA 1NGMB 1NWQA 1Q90D 1Y8AA 3KQGA 3H1KG 5KLIB 4A7PA 1DEEG 2BCCE 1GZLA 3VMXA 1GMJA 5APWA 3RK2D 3HUSA 1SFCC 4L74A 2M0BA 2R32A 3L71G 2ZYAA 1N86B 4M7HA 1FZBB 1M1JB 2P2UA 2E75C 4NPFX 3V2NA 5CCGC 3FGAD 2KLVA 4LC1A 3CX5D 1S9KE 2A06G 1YI2P 1BCCD 5CBOA 1FIDA 2H89C 2B87B 1GL2A 4PV1D 2ZJSE 2KB7P 2Y0DA 1FZGB 3H1IE 3N4XA 1HVVA 2W6BA 4D6TG 4H13C 2QM7A 1R5LA 2K88A 2FFDC 3AEDC 3CMAP 4EYYQ 1SQBJ 1N8RQ 4JZCA 1MUUA 2O1KA 3B5NB 1SQPJ 1URQC 3CCEP 3AEFC 5AVQB 4H0LD 1KC8Q 2W6JH 1RE3B 1Y47A 1L0NJ 1PV3A 2E74D 2J0GA 1NJIQ 3RL0g 1R5SA 1BE3J 1NTMD 2K9JA 5DJUB 1FJPA 1FOSE 3V5BA 3TNUB 1NU1D 1LT1A 3B4SA 3MUDC 5EFWB 2WQYC 1WRGA 3MIWA 1W2BO 2YMYA 5B66H 2O01J 3L73E 4RESB 2LR2A 2FYUJ 2J3FA 1RE3C 2XNXA 3AE6C 1EZVE 5E79E 2OYHC 1FU1A 2HODC 3H1IJ 4OGQC 2LXBA 3B5NC 2OYHB 3VN0A 3D71A 3L72E 4GOEA 2NZ2A 3NTNA 1AQTA 1BE3D 1FE6A 1VL2A 2JHHC 2YXQB 1SQVJ 4C7NB 1NU1J 2M3EA 4I6MC 4L75A 1OVUA 3H1HE 2JKVA 5KLVG 2WSSH 1NTMG 3BCCE 3L74G 3L4FA 1EDLA 4JQ0D 3V6IA 1NTME 5B66E 2GUVA 1SQQE 1OW7A 4L76A 1W5CE 1S5LH 3I56P 1YQ4C 3P8MC 2HLOA 3E1IC 3AEAC 2KS1A 3BVHA 2HPCC 1AVYA 2KS1B 1JOCA 4BRYA 3G6EP 1LGHB 4U3FE 1Z56A 2JJLA 5KAIH 3KXDA 1N86A 1KQGB 3WUVA 3V2QA 4C7NA 4JF7A 1KFMA 2ITAA 3IR9A 3PH0A 2P1JA 1S5LE 2HODA 2KZJA 3KZIH 3CWBJ 3SWYA 3HE4A 2JWDA 2PAJA 3CL3D 2ZFCA 2Q5UA 2K1AA 1BCCJ 3KHUA 1RF1C 2D2CC 1GW3A 1KB9D 1YJ9P 3L73D 5BVZA 1YITP 1JY3N 2WSFH 2J59M 1WMKA 2CPSA 5CBNA 3L36A 1QVGO 1FDIA 1K73Q 1GK4A 2KSJA 3QH9A 2R3CA 5AW8B 1AV1A 2GM4A 1LNQA 3AE2C 2VRSA 2BASA 2IZ1A 2J58A 5APYA 3G9RA 5APSA 4IFDK 2WNPF 2A45I 2QEXP 5APQA 1KB9E 2KP8A 3ZDMA 4D6TE 1K04A 3VMZA 1LTIC 5AVRB 2FYUK 1AJYA 1IJDB 4ASWA 3BRVB 5CCHD 2IBZI 2KNCB 2IBZD 2I1JA 2YMKA 4H13B 2QJKB 4U3FD 3BASA 2P10A 4N78D 2LXCB 3CCMP 4GT1A 2J5ZA 3V2RA 3AE9C 2QE7H 1H88A 2BCCG 3CD6P 4O9BA 3GW6A 1M8OB 2SPZA 2Z5HA 3AEBC 1GK6A 5AVTB 1NU1E 1N7SB 3L71E 2KZIA 3H32C 1JY2P 3FIBA 1FZEA 3GLMA
chains in the Genus database with same CATH topology
2I1KA 1OXZA 1IK9A 1YTZT 2IFMA 3H32B 3HUSC 2J3UA 3U59A 2Z4EB 4LLHA 1N7SD 2OARA 4XA4A 2WT7A 5AVVB 2A45H 5CJ0A 5CCHA 1L4AC 2Q9IC 5APUA 3P8CE 5AW5B 3KYQA 1FZGC 4DZOA 1ZR4A 2M3BA 2XDJA 3T97A 5AVYB 1URQD 3OJAB 1NWQA 2P67A 3RL0D 1G1JA 1NHLA 3KQGA 3TNUA 1A02J 1J1EB 1LTGC 3MUDA 1LWUC 1LTAC 1JCDA 1VDFA 3BVHC 1SQXK 2FKWB 2J0HA 1GZLA 1MV8A 3VMXA 3RK2D 5APWA 3E1IA 3HUSA 3P32A 1SFCC 1NO4A 2HPCA 1A02F 1JCCA 4WBAA 1ZLLA 2R32A 1T2KC 3VYIA 2HLOC 3H32A 1N86B 4M7HA 4C46A 2NPSB 4I2LC 1LT9C 2IPPA 1FZBB 3I5CA 1M1JB 1URQB 3HE5B 2P2UA 2C0WA 3GHGB 2JHKF 1X79B 3V2NA 1LTJA 3R2PA 5CCGC 2HODB 1VPCA 1IFIA 2KLVA 2J61A 4LC1A 5KJ7D 1S9KE 3EFGA 3IFMA 2WT7B 2E43A 1JC9A 4M3LA 4ZKUA 2N1TD 2GY7A 1IFJA 1FIDA 1IO4A 3A2AA 1GL2D 3O8ZA 1L4AB 2Q9IB 1W2EA 5AVXB 1GL2A 1HH0A 1FZFB 2D39A 2KB7P 3BATA 1FZGB 1WT6A 3N4XA 3VTPC 1HVVA 2YNYA 1RF0C 2W6BA 3WMM0 2MJZA 2FFDA 5AW6B 3C9IA 2QM7A 3MGNA 2J0YA 1IC2A 4I1LA 4Y99C 3II6A 1FZFA 1SQPK 1XTGB 2FFDC 1J1EC 5CHXA 1LWUB 1YYCA 3BVHB 2YKOA 1PFIA 1N7SC 1JY2N 3VOPA 3L37A 1G2CB 4JZCA 2J3OA 1MUUA 1RE4A 2JHIF 3KPEA 1FZCB 4N3YB 2JEEA 2O1KA 1L4AD 3HD7B 3HD7A 3B5NB 2H43A 2NPSC 2WITA 3TYYA 1M7LA 4JYBA 5AW3B 2JHMF 1M1JC 1CZQA 1URQC 4EOTA 1HGVA 1JTHA 4NYTA 5AVQB 2OYIC 3CI9A 1LWUA 2R5DA 1FOSF 2XNXB 2HLOB 1RE3B 2WPRA 1GU4A 1CI6A 3P8CD 1KZUB 1SLQA 2O1JA 1J1DB 2J0GA 5KTBA 3M9HA 5AW9B 5AVWB 3UIAA 3RK2C 3GHGA 1FJPA 1AFOA 2WWWA 1M1JA 1URQA 2IFNA 2Z4EC 5AW4B 1LTBC 1FOSE 1T2KD 2IX7C 1L4AA 3TNUB 2KOGA 3V5BA 2Q9IA 4IFMA 3G3ZA 2WZ7A 1RE4C 1SVFA 1JY3P 4JYCA 2J60A 1DEBA 1NTZK 1LTSC 1WRGA 4B86A 3MIWA 1SP4A 1MFZA 4GIFA 1JNMA 4M7FA 2CPBA 2YMYA 5CCGD 1FIBA 1Z3UA 1GTWA 4RESB 1SQBK 1T3JA 2OYHA 2J64A 2FYZA 1L0NK 2XV5A 4W7ZA 1RF0B 2J3FA 1RE3C 2XNXA 3NMDA 2OYHC 4Y99B 1FU1A 2HODC 5AW1B 1GL2C 2P7JA 1AQ5A 1FZEB 3B5NC 2LKMA 3RK3C 1HGZA 3VN0A 2OYHB 1FDMA 1SQQK 2N1TB 1CW5A 3NTNA 3B5NA 1LT9B 4OH8B 1FZEC 1N86C 5KJ7A 1FZAB 2JHHC 4ZFGA 4C7NB 1RE3A 4KHXA 2XNXC 2WPSA 4I6MC 3MTUE 1IFNA 1NH4A 1FZAC 1NOHA 2QM8A 2N9BA 1NKNA 1IFMA 3EQ2A 2WSCH 2H7HA 1YTZI 3M9QA 3L4FA 3RL0B 5AVUB 1HTLC 1RF1B 1T3UA 2GUVA 1EQ7A 3SWFA 2C0XA 2OYIA 1KILD 2NPSD 3P8MC 1RE4B 2HLOA 1SQVK 4C7RA 3E1IC 1J1DC 4R9TA 2XZRA 1GU5A 1NTKK 3BVHA 4GKGA 4IFFA 1SFCA 2HPCC 1JTHB 3V4WA 4AYCA 5KLVK 1S9KD 3HD7C 2C9NY 1DX7A 1CSBA 1NTMK 1JOCA 4EIJA 1FJKA 2L5GB 5CJ4A 1LGHB 1Z56A 1HWTC 2M8RA 1OWAA 3MD0A 1FZGA 1FBMA 1G2CA 1Z3SA 2HYNA 2JJLA 2HFED 2E42A 1MZ9A 2NPSA 5CCHC 1NKZB 2W27A 3RK3B 1JY3O 1N86A 2H43C 1SFCB 3V2QA 3RK2B 1N73B 4C7NA 4N6JA 4JF7A 1KFMA 5BU5A 3E1IB 3IR9A 3NFQA 2OYIB 2HG5D 2P1JA 5APXA 2HODA 3TK1A 3P7KA 5APTA 1LTJB 1H8AA 2J3GA 3SWYA 3HE4A 3LW5H 5AW7B 3VP9A 2PAJA 2YO2A 3CL3D 1ZN5A 4JYOX 2ZFCA 1FZBA 3M9BA 2O01H 2Q5UA 1JUNA 5CCGA 1RF0A 1RF1C 3V4QA 2GUSA 3B5ND 3U1CA 1QL2A 4HYTB 4WY4C 1GW3A 3RK3D 3B8EB 2J61B 1N2DC 2JHLF 4R9JA 1JO5A 5BVZA 3HUSB 1JY3N 2WSFH 4W80A 2J59M 3OAKA 4WB4A 1LT9A 2J3FD 2CPSA 2N1TA 2WPQA 3L35A 3VP8A 4AUWA 2Z4EA 2YO3A 2XU6A 3L36A 5AW0B 2C9LY 5BU8B 1GK4A 2KSJA 5AVZB 1X8YA 1LTJC 4ZKPA 2R3CA 5AW2B 5AW8B 1E5WA 2W6AA 1G1IA 3HE4B 2HPCB 2GM4A 2J2PA 2R5BA 3KDPB 2J1GA 1LTTC 1FZDA 2WSEH 1FICA 2VRSA 1CI6B 2BASA 1KILC 2J58A 5APYA 5APSA 1FZCC 4IFDK 1GD2E 3A7OA 1N73A 2WNPF 2A45I 3M0DC 4HH2A 5APQA 3RL0C 2KP8A 2POHA 1GW4A 3CLQA 3M0AA 4EPUA 1DH3A 3HD7D 3V2PA 3LIDA 4DOJA 2YKQA 1NU1K 2WTYA 3TSIA 2H43B 2YKPA 3VMZA 1QL1A 1T8ZA 1N7SA 1H89A 1XTCC 1N73C 1LTIC 1FZCA 3M06A 1ZV8A 1SFCD 1KILA 4LGDE 3M0DA 2FYUK 3GHGC 5AVRB 2H8PD 1IJDB 3HRNA 1FZFC 3BRVB 4WY4B 5CCHD 2Z5IA 2I1JA 2FIBA 4XE5B 2Q7CA 2ZXEB 5APVA 1J2JB 1IFDA 3BASA 1RY3A 3N7NA 2FFDB 1JMMA 4N78D 3PP5A 3A3YB 3HTKA 4GT1A 1GDTA 2J5ZA 2A45G 3V2RA 1L0LK 5KJ7C 1GL2B 1JY2O 1HBWA 1ZR2A 4N78E 1H88A 3NXSA 2N1TC 3LIEA 1KFNA 3VMYA 2Q3IA 3BRTB 4WY4A 2KYVA 3U1AA 4O9BA 3M91A 4WY4D 3HTKB 1FZAA 1KILB 4AQRD 1N7LA 1KQLA 2Z5HA 1FAVA 2FXMA 1RF1A 1GK6A 5AVTB 1FZBC 3H6PA 5CMZA 1N7SB 3OA7A 1NAFA 3H32C 3HE5A 5AVSB 2PP6A 3A5TA 4W7YA 1JY2P 3FIBA 1HJBA 1X9VA 1FZEA 1HUCA 2XKMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LWU B;  3HUS C;  3H32 B;  1FZA C;  2J3U A;  2Z4E B;  3BVH B;  1LTJ C;  1JY2 N;  4JZC A;  2J3O A;  2A45 H;  2HPC B;  1RE4 A;  2JHI F;  2J2P A;  1FZC B;  2J1G A;  1RF1 B;  1T3U A;  2Q9I C;  1FZD A;  1FIC A;  2H43 A;  2OYI A;  1FZG C;  1RE4 B;  2HLO A;  3E1I C;  4R9T A;  1FZC C;  1N73 A;  2JHM F;  2A45 I;  2WNP F;  1M1J C;  3BVH A;  4NYT A;  2HPC C;  2OYI C;  4EPU A;  1LWU A;  2XNX B;  2HLO B;  1RE3 B;  1LWU C;  2H43 B;  3BVH C;  2J0G A;  1N73 C;  2J0H A;  1FZC A;  3E1I A;  3HUS A;  3GHG A;  2HPC A;  1FZG A;  1M1J A;  1Z3S A;  3GHG C;  2Z4E C;  2Q9I A;  1FZF C;  2HLO C;  3H32 A;  1JY3 O;  1N86 A;  1N86 B;  4M7H A;  2FIB A;  2H43 C;  1RE4 C;  1LT9 C;  1JY3 P;  2J60 A;  1FZB B;  1N73 B;  1M1J B;  3GHG B;  2JHK F;  3E1I B;  4M7F A;  2FFD B;  2OYI B;  1LTJ A;  2HOD B;  2HOD A;  1FIB A;  1Z3U A;  1LTJ B;  2J3G A;  2J61 A;  2J5Z A;  2A45 G;  2OYH A;  2J64 A;  1JY2 O;  1RF0 B;  2J3F A;  1RE3 C;  2XNX A;  1JC9 A;  4JYO X;  1FZB A;  2GY7 A;  2OYH C;  1FID A;  2HOD C;  1RF0 A;  1RF1 C;  2Q9I B;  1W2E A;  1FZE B;  2OYH B;  1FZF B;  2D39 A;  2J61 B;  4R9J A;  1FZA A;  2JHL F;  1FZG B;  3HUS B;  1JY3 N;  1RF1 A;  1RF0 C;  1FZB C;  1LT9 B;  1FZE C;  2FFD A;  1LT9 A;  2J3F D;  1FZE A;  1N86 C;  2J0Y A;  1FZA B;  3H32 C;  2JHH C;  4ZFG A;  1FZF A;  1JY2 P;  3FIB A;  1RE3 A;  2XNX C;  2FFD C;  2Z4E A; 
#chains in the Genus database with same CATH topology
 2I1K A;  5GTI E;  1EDJ A;  3H32 B;  1L0L D;  3D6Z A;  1Q86 Q;  1ZRT E;  3Q5P A;  1OFC X;  3RGU A;  2OTJ P;  1TU3 F;  4Z1M H;  4CPG A;  3P8C E;  4DZO A;  1SQP E;  1ZR4 A;  3RL0 D;  1M90 Q;  1G1J A;  1VQK P;  4PJ0 E;  2E76 B;  3F89 A;  1LTG C;  3MUD A;  1VF5 D;  1SS1 A;  2FKW B;  3CC7 P;  1MV8 A;  3P32 A;  1A02 F;  4WBA A;  1SQV G;  1NU1 G;  2HLO C;  1PP9 E;  3H32 A;  3Q5S A;  4I2L C;  4HKZ H;  1Y9B A;  3I5C A;  3HE5 B;  1VQ4 P;  2JHK F;  1X79 B;  1PGO A;  3TGU G;  4WVZ A;  2J61 A;  3H1K D;  5KJ7 D;  3OW2 O;  1P84 E;  3IFM A;  2E43 A;  1JC9 A;  4ZKU A;  2GY7 A;  1IFJ A;  2PGD A;  3A0H H;  1VQ7 P;  2Q9I B;  1FZF B;  2D39 A;  2W83 C;  2I8D A;  2YNY A;  3MGN A;  3H1L E;  3II6 A;  1S3J A;  1XTG B;  2YKO A;  1QX8 A;  1N7S C;  3VOP A;  3L37 A;  1G2C B;  1VQN P;  2J3O A;  4N3Y B;  3HD7 A;  4PV1 B;  2H43 A;  1X22 A;  2NPS C;  3TYY A;  4EOT A;  1HGV A;  1JB0 J;  1BCC G;  3CI9 A;  3ABV C;  1M1K Q;  1DIP A;  2R5D A;  1FOS F;  4GOD A;  2XNX B;  1KV4 A;  1L0N E;  2HLO B;  4KJM A;  3P8C D;  1KZU B;  3H1H G;  1SLQ A;  2O1J A;  1J1D B;  3PTZ A;  3RK2 C;  2ZT9 C;  1M1J A;  2KK7 A;  1Q7Y Q;  2IX7 C;  2P58 A;  1KYO E;  2AEM A;  2WZ7 A;  4PD4 D;  4JYC A;  3L72 G;  3CWB D;  1NTZ K;  1LTS C;  1SP4 A;  1MFZ A;  4GIF A;  4M7F A;  5CCG D;  3USS A;  5KLI C;  1T3J A;  2FYZ A;  4W7Z A;  3NMD A;  4UB6 E;  1PPJ D;  4QMA A;  2K37 A;  1AQ5 A;  1FZE B;  4PV1 C;  2LKM A;  1USE A;  3RK3 C;  1SQQ K;  1CW5 A;  3B5N A;  1LT9 B;  3AEG C;  4H13 D;  4OH8 B;  1FZE C;  3W67 A;  5KJ7 A;  1KMI Z;  1L0L E;  4ZFG A;  4WWI A;  1SQX D;  5TIS E;  3L75 G;  2JWA A;  3MTU E;  5B5E E;  2KLU A;  1IFN A;  1FZA C;  1NKN A;  4JPZ B;  1IFM A;  1OX3 A;  2WSC H;  2QRX A;  1YTZ I;  2ZT9 B;  4GDO A;  3H1H D;  2OYI A;  1U57 A;  2ZVN B;  4PD4 E;  1S5L X;  4C7R A;  2ZVO B;  3AE1 C;  4MN4 C;  2XZR A;  1NTK K;  4GKG A;  4IFF A;  1SFC A;  2BCC J;  1S9K D;  1SQB D;  1VQM P;  1U7J A;  2KIK A;  1FJK A;  3CC4 P;  4R4M A;  2L5G B;  2E74 C;  2M8R A;  1G2C A;  1Z3S A;  2HYN A;  3SWK A;  1YHQ P;  1BGY G;  2E42 A;  1MKM A;  2NPS A;  3RK3 B;  1BGY D;  1SFC B;  1SQB G;  3FXE A;  3RK2 B;  1N73 B;  4N6J A;  4IOI H;  2Q3E A;  1T6A A;  2OYI B;  2HG5 D;  3P7K A;  1LTJ B;  2YXR B;  1PP9 G;  1DD3 A;  3LW5 H;  2JR8 A;  1SQP G;  3VP9 A;  3CWB E;  4JYO X;  2O01 H;  4UB6 H;  2K9Y A;  1EXJ A;  4OGQ D;  2GUS A;  3B5N D;  3U1C A;  4WY4 C;  3B8E B;  1NTK D;  2J61 B;  4R9J A;  1OVR A;  1KQS O;  4W80 A;  3OAK A;  1LT9 A;  3GMA A;  3PLN A;  3MHV A;  4KT0 J;  2QG4 A;  2YO3 A;  2XU6 A;  2C9L Y;  1E5W A;  5KAF E;  1G1I A;  1PL5 A;  3H1K E;  1IFP A;  3TGU J;  4GOF A;  3CPW O;  2FYU G;  1FZC C;  1N73 A;  1KN7 A;  2POH A;  3CX5 H;  4EPU A;  1DH3 A;  2R44 A;  3AE5 C;  3H1I G;  1U7M A;  2AEJ A;  3H1L D;  1QL1 A;  1N7S A;  1N73 C;  2QVA A;  2KSE A;  3M06 A;  3TGU D;  3CC2 P;  4LGD E;  3M0D A;  2E5T A;  3HRN A;  4I7Z C;  2Q7C A;  5APV A;  1M56 D;  1J2J B;  1RHZ B;  2YIU B;  2A45 G;  1GL2 B;  1BGY E;  1MFT A;  1LJ2 A;  2N1T C;  3LIE A;  1KFN A;  3E1R A;  2E75 B;  2Q3I A;  3BRT B;  1NTZ G;  3PHL A;  1IK7 A;  1KB9 I;  1KQL A;  3H1H J;  1FAV A;  2IYP A;  3OA7 A;  1NAF A;  5AVS B;  2PP6 A;  3A5T A;  3Q2Y A;  4W7Y A;  1HJB A;  1S72 P;  3H1L G;  2XKM A;  1RQU A;  1EXI A;  3HUS C;  3G4S P;  2J3U A;  4HB1 A;  2Z4E B;  4LLH A;  4XA4 A;  2GA1 A;  5AVV B;  2V7Q H;  2A45 H;  1VQ6 P;  2IYO A;  5KKZ C;  1FC2 C;  3KZI E;  1L4A C;  2RH0 A;  2D2C B;  1EZV G;  1FZG C;  5AVY B;  2P67 A;  4H44 C;  1NHL A;  1L2P A;  1LWU C;  1LTA C;  1PZQ A;  1OW6 A;  1JCD A;  1UIX A;  3BVH C;  1SQX K;  2J0H A;  1QGK B;  1YBK A;  1BSN A;  1D7M A;  3E1I A;  5E79 H;  1ZLL A;  1T2K C;  1NTK G;  3VYI A;  3GF7 A;  1NVO A;  1LT9 C;  3SFE C;  3H1J D;  2B9B A;  1URQ B;  3BCC J;  2QSI A;  3GHG B;  1LTJ A;  3R2P A;  1SQX E;  1Q81 Q;  2Y9Y A;  2HOD B;  1PGP A;  2FYN C;  1VF5 B;  3EFG A;  3FXD A;  1KTM A;  1BDC A;  1IO4 A;  3A2A A;  1OIP A;  2YIU C;  3CCJ P;  4ZMD A;  5DJT B;  1GL2 D;  4NPE A;  1L4A B;  1W2E A;  5AVX B;  3K5B A;  2ZYG A;  1RF0 C;  3WMM 0;  2FFD A;  2J0Y A;  5H2F E;  4I1L A;  4Y99 C;  1VQP P;  4K35 A;  1VQ5 P;  1FZF A;  1SQP K;  1BGY J;  3C8V A;  5CHX A;  3Q1M A;  3GG2 A;  1LWU B;  2FYU D;  1YYC A;  2E74 B;  3BVH B;  4NPD A;  2Y0E A;  5L8R J;  2JHI F;  2AEF A;  1FZC B;  2JEE A;  3A0B H;  3JCU E;  3HD7 B;  3EWK A;  4PD4 I;  4HJG H;  2O01 N;  2WSF J;  2BCC D;  4JYB A;  1M1J C;  1KB9 H;  2K3R A;  3BCC D;  3H1J J;  1IZN B;  2OYI C;  1LWU A;  3PRJ A;  2FYN B;  2WPR A;  2QJY B;  1VF5 C;  1NTZ E;  2B89 A;  2PFX A;  1L0N D;  5AW9 B;  2OTL P;  4I7Z B;  1JEK A;  4TLF A;  1AFO A;  2Z4E C;  1L4A A;  4IFM A;  4U3F J;  1SQP D;  1SVF A;  1SQX G;  3CXH H;  1JY3 P;  2R3S A;  1EZV I;  2HR3 A;  2CPB A;  1FIB A;  1Z3U A;  2E76 C;  2OYH A;  2J64 A;  2FY8 A;  2FYU E;  1RF0 B;  3L70 J;  2M5A B;  4Y99 B;  1KIL E;  2P7J A;  2BEZ F;  1HGZ A;  2ZXX A;  1HJ0 A;  1BCC E;  1N86 C;  2H88 C;  1SQV E;  2OQQ A;  4KHX A;  3ITK A;  2WPS A;  4DCK A;  3S4R A;  1NH4 A;  1NOH A;  3CXH E;  1S1C X;  2H7H A;  3M9Q A;  3H25 A;  1P84 H;  2Y9Z A;  5AVU B;  1HTL C;  1RF1 B;  1T3U A;  1EQ7 A;  2JP3 A;  1R8E A;  1KIL D;  2NPS D;  1SQV K;  3S9O A;  4R9T A;  3L73 J;  2A06 E;  3CCS P;  1K9M Q;  1OZH A;  1ZW0 A;  1EDI A;  2QIW A;  3HD7 C;  1CSB A;  2QJP B;  3CCL P;  3G71 P;  3JC2 2;  1HWT C;  2ZT9 D;  1DD4 A;  4IL6 X;  3H1L J;  1NKZ B;  2W27 A;  1JY3 O;  4UB8 E;  3CXH I;  1PIX A;  3F5H A;  5BU5 A;  3E1I B;  3NFQ A;  2IDB A;  5M1B A;  5APT A;  3S1K A;  2KI7 B;  5AW7 B;  2YO2 A;  3SSU A;  1ZN5 A;  3AEC C;  1FZB A;  3M9B A;  3CCU P;  1JUN A;  5CCG A;  1RF0 A;  3H1K J;  3V4Q A;  4DJG A;  4HYT B;  1OMI A;  2IBZ E;  3RK3 D;  1S4X A;  3CX5 I;  1FDO A;  2QJK C;  3RBX A;  3Q5R A;  2J3F D;  3GF3 A;  2WPQ A;  3VP8 A;  1NTK J;  2Z4E A;  5AW0 B;  5BU8 B;  1PPJ E;  4ZKP A;  3BCC G;  3HE4 B;  3CX5 E;  2OYO A;  1PPJ G;  2HPC B;  5B5E H;  2J2P A;  3CCQ P;  2UWJ E;  2R5B A;  1KOR A;  2WSC J;  2RKL A;  2WSE H;  1FIC A;  1CI6 B;  2QJP C;  3E7K A;  5KLV D;  4DT0 A;  3A7O A;  3M0D C;  3L75 D;  1GW4 A;  3H1I D;  3M0A A;  3AE8 C;  3SFD C;  3V2P A;  1NU1 K;  1PGQ A;  4D6T J;  3CCR P;  1FZC A;  5GTH E;  1K05 A;  1SFC D;  1NAY A;  3B71 A;  1KIL A;  1YIJ P;  1L0L G;  2H8P D;  4OVN F;  3L75 J;  3IN6 A;  2Z5I A;  3RK3 E;  4XE5 B;  2ZXE B;  4RO0 A;  2IZ0 A;  1IFD A;  1RY3 A;  2E75 D;  3N7N A;  2FFD B;  1JMM A;  1VQO P;  2N9Y B;  3L74 D;  3PP5 A;  3HTK A;  3IAO A;  1GDT A;  3A0B E;  1AVO A;  3W68 A;  1JY2 O;  3D70 A;  3H1J G;  1NTZ D;  4WY4 A;  4U7J A;  3M91 A;  4WY4 D;  4UB8 H;  3HTK B;  1FZA A;  1N7L A;  2FXM A;  1RF1 A;  5KLV E;  3MZW B;  1QEX A;  3O6Q B;  1H8A A;  1KYO I;  2IFM A;  2CK3 H;  1P84 I;  1SQX J;  4YTP C;  2FBW C;  2OAR A;  1KYO H;  1E79 H;  2Q6Q A;  2A06 D;  5GTH H;  2Q9I C;  1EZV D;  4YPC A;  1PP9 J;  4YXW H;  5AW5 B;  3KYQ A;  2J5U A;  3WU2 H;  2XDJ A;  3T97 A;  1URQ D;  3OJA B;  4K3A A;  4R4L A;  5TJH A;  4H0L C;  1KYO D;  2XND H;  3TNU A;  2ZAE B;  1A02 J;  1J1E B;  2L91 A;  1VDF A;  2Q1K A;  2HPC A;  1NO4 A;  1FS0 E;  1JCC A;  5KAF H;  1SQQ J;  4RKU J;  5GTI H;  4C46 A;  2NPS B;  2IPP A;  1NTM J;  3L74 J;  2C0W A;  4XFJ A;  3L71 D;  1KD1 Q;  1SQV D;  2V4H A;  1VPC A;  1IFI A;  2DW3 A;  2WT7 B;  2KUB A;  3L73 G;  3WU2 E;  4M3L A;  2N1T D;  2Y0C A;  3FX0 A;  1ZRT D;  1M57 D;  3O8Z A;  4PJ0 H;  1HH0 A;  3BAT A;  2WSE J;  1WT6 A;  4IL6 E;  3VTP C;  4ASV A;  2AXT H;  2MJZ A;  5AW6 B;  1PP9 D;  3C9I A;  1IC2 A;  3Q3D A;  4BRY B;  3I55 P;  1J1E C;  4EI2 A;  3L70 D;  5C39 A;  2G3A A;  4JBZ A;  1PFI A;  1JY2 N;  3FWL A;  1RE4 A;  3KPE A;  4BXL A;  1L4A D;  1VQ9 P;  3AEE C;  2WIT A;  2MKV A;  3JSV C;  1M7L A;  5AW3 B;  1YJN P;  2JHM F;  1CZQ A;  1JTH A;  1AA0 A;  3IF4 A;  4NYT A;  1Q82 Q;  4H44 D;  1NTZ J;  2AXT E;  2JO1 A;  1GU4 A;  1CI6 A;  2QA4 P;  2WMM A;  5KTB A;  3M9H A;  5AVW B;  3UIA A;  1NYH A;  3GHG A;  5H2F H;  2WWW A;  1URQ A;  2IFN A;  1QLE D;  5AW4 B;  1LTB C;  1T2K D;  5KKZ B;  2Q9I A;  2KOG A;  3G3Z A;  5K5G B;  1RH5 B;  1P84 D;  1RE4 C;  3TGU E;  2J60 A;  1DEB A;  2IBZ G;  1EC5 A;  4B86 A;  1JNM A;  1SQB E;  1GTW A;  1NTK E;  1SQB K;  4H0L B;  4D6T D;  1L0N K;  3L70 E;  2XV5 A;  2JDI H;  3R4Y A;  2M5A A;  2OTK E;  3T97 B;  1JM0 A;  5AW1 B;  1GL2 C;  1KQF B;  2D2C D;  3O6Q A;  2RMZ A;  1FDM A;  2N1T B;  3TF5 A;  2K9J B;  1ZOY C;  3FWN A;  4ZNC A;  3L75 E;  1FZA B;  3L72 D;  1L0L J;  4IL6 H;  1OVV A;  1RE3 A;  2XNX C;  3L71 J;  1BE3 E;  2QM8 A;  2N9B A;  3AE7 C;  3EQ2 A;  3L74 E;  3CME P;  1HF9 A;  1LP1 A;  3RL0 B;  3H1J E;  1YQ3 C;  4OWF A;  3SWF A;  2C0X A;  3A0H E;  2WPV B;  1RE4 B;  1J1D C;  1GU5 A;  3LW5 J;  1JTH B;  3V4W A;  4AYC A;  5KLV K;  1H0T A;  2C9N Y;  1DX7 A;  1NTM K;  2NRG A;  4EIJ A;  5CJ4 A;  2V7Q J;  2FXO A;  1OWA A;  3MD0 A;  1FZG A;  2WVR A;  1FBM A;  1BSH A;  2HFE D;  1ZP0 C;  1MZ9 A;  5CCH C;  2B87 A;  4YXD C;  2H43 C;  2W90 A;  2BEQ D;  1QVF O;  3MP7 B;  3JCU H;  3VMA A;  5APX A;  1YJW P;  3TK1 A;  2E5Y A;  2J3G A;  2E76 D;  3WUU A;  1PGJ A;  2QJY C;  4Y28 J;  2W8Z A;  1QL2 A;  1L0N G;  5TIS H;  1N2D C;  2JHL F;  1JO5 A;  2KXP B;  1RQV A;  3HUS B;  3TDK A;  1UII A;  3WUT A;  3AE3 C;  4WB4 A;  4PD4 H;  1BE3 G;  1S2E A;  2N1T A;  3L35 A;  3D6Y A;  4AUW A;  3C1L A;  1SQQ G;  1USD A;  2O3J A;  4U3F G;  5AVZ B;  1X8Y A;  1LTJ C;  5AW2 B;  2W6A A;  3PJS K;  4TT3 H;  3KDP B;  2J1G A;  1LTT C;  3EFF K;  1VQ8 P;  1FZD A;  4OGQ B;  1KIL C;  1OW8 A;  3QWO C;  3L70 G;  1GD2 E;  3RBZ A;  4HH2 A;  1K8A Q;  3RL0 C;  3CLQ A;  3HD7 D;  3LID A;  4DOJ A;  2YKQ A;  2WTY A;  3TSI A;  2H43 B;  2YKP A;  2FXP A;  1T8Z A;  1H89 A;  1Q2N A;  1XTC C;  1ZV8 A;  3GHG C;  3AE4 C;  1FZF C;  4WY4 B;  2KNC A;  2FIB A;  5KLV J;  4BWN A;  4H44 B;  4RJT A;  2AXC A;  3A3Y B;  1L0L K;  5KJ7 C;  1HBW A;  1ZR2 A;  4N78 E;  3NXS A;  1SQQ D;  3VMY A;  2KYV A;  3U1A A;  1KIL B;  4AQR D;  1JMB A;  1FZB C;  5KAI E;  3H6P A;  1ZME C;  5CMZ A;  3HE5 A;  1X0T A;  1BDD A;  1X9V A;  1HUC A;  2G8Y A;  1ZXG A;  1EDK A;  1OXZ A;  1IK9 A;  1YTZ T;  1H0T B;  3U59 A;  3L72 J;  2B88 A;  1N7S D;  4L73 A;  2WT7 A;  5CJ0 A;  3CXH D;  5CCH A;  2PRR A;  4EDF A;  5APU A;  3CCV P;  2ZYD A;  1LP1 B;  3CWB G;  1VQL P;  2RN0 A;  2M3B A;  2OGU A;  1NGM B;  1NWQ A;  1Q90 D;  1Y8A A;  3KQG A;  3H1K G;  5KLI B;  4A7P A;  1DEE G;  2BCC E;  1GZL A;  3VMX A;  1GMJ A;  5APW A;  3RK2 D;  3HUS A;  1SFC C;  4L74 A;  2M0B A;  2R32 A;  3L71 G;  2ZYA A;  1N86 B;  4M7H A;  1FZB B;  1M1J B;  2P2U A;  2E75 C;  4NPF X;  3V2N A;  5CCG C;  3FGA D;  2KLV A;  4LC1 A;  3CX5 D;  1S9K E;  2A06 G;  1YI2 P;  1BCC D;  5CBO A;  1FID A;  2H89 C;  2B87 B;  1GL2 A;  4PV1 D;  2ZJS E;  2KB7 P;  2Y0D A;  1FZG B;  3H1I E;  3N4X A;  1HVV A;  2W6B A;  4D6T G;  4H13 C;  2QM7 A;  1R5L A;  2K88 A;  2FFD C;  3AED C;  3CMA P;  4EYY Q;  1SQB J;  1N8R Q;  4JZC A;  1MUU A;  2O1K A;  3B5N B;  1SQP J;  1URQ C;  3CCE P;  3AEF C;  5AVQ B;  4H0L D;  1KC8 Q;  2W6J H;  1RE3 B;  1Y47 A;  1L0N J;  1PV3 A;  2E74 D;  2J0G A;  1NJI Q;  3RL0 g;  1R5S A;  1BE3 J;  1NTM D;  2K9J A;  5DJU B;  1FJP A;  1FOS E;  3V5B A;  3TNU B;  1NU1 D;  1LT1 A;  3B4S A;  3MUD C;  5EFW B;  2WQY C;  1WRG A;  3MIW A;  1W2B O;  2YMY A;  5B66 H;  2O01 J;  3L73 E;  4RES B;  2LR2 A;  2FYU J;  2J3F A;  1RE3 C;  2XNX A;  3AE6 C;  1EZV E;  5E79 E;  2OYH C;  1FU1 A;  2HOD C;  3H1I J;  4OGQ C;  2LXB A;  3B5N C;  2OYH B;  3VN0 A;  3D71 A;  3L72 E;  4GOE A;  2NZ2 A;  3NTN A;  1AQT A;  1BE3 D;  1FE6 A;  1VL2 A;  2JHH C;  2YXQ B;  1SQV J;  4C7N B;  1NU1 J;  2M3E A;  4I6M C;  4L75 A;  1OVU A;  3H1H E;  2JKV A;  5KLV G;  2WSS H;  1NTM G;  3BCC E;  3L74 G;  3L4F A;  1EDL A;  4JQ0 D;  3V6I A;  1NTM E;  5B66 E;  2GUV A;  1SQQ E;  1OW7 A;  4L76 A;  1W5C E;  1S5L H;  3I56 P;  1YQ4 C;  3P8M C;  2HLO A;  3E1I C;  3AEA C;  2KS1 A;  3BVH A;  2HPC C;  1AVY A;  2KS1 B;  1JOC A;  4BRY A;  3G6E P;  1LGH B;  4U3F E;  1Z56 A;  2JJL A;  5KAI H;  3KXD A;  1N86 A;  1KQG B;  3WUV A;  3V2Q A;  4C7N A;  4JF7 A;  1KFM A;  2ITA A;  3IR9 A;  3PH0 A;  2P1J A;  1S5L E;  2HOD A;  2KZJ A;  3KZI H;  3CWB J;  3SWY A;  3HE4 A;  2JWD A;  2PAJ A;  3CL3 D;  2ZFC A;  2Q5U A;  2K1A A;  1BCC J;  3KHU A;  1RF1 C;  2D2C C;  1GW3 A;  1KB9 D;  1YJ9 P;  3L73 D;  5BVZ A;  1YIT P;  1JY3 N;  2WSF H;  2J59 M;  1WMK A;  2CPS A;  5CBN A;  3L36 A;  1QVG O;  1FDI A;  1K73 Q;  1GK4 A;  2KSJ A;  3QH9 A;  2R3C A;  5AW8 B;  1AV1 A;  2GM4 A;  1LNQ A;  3AE2 C;  2VRS A;  2BAS A;  2IZ1 A;  2J58 A;  5APY A;  3G9R A;  5APS A;  4IFD K;  2WNP F;  2A45 I;  2QEX P;  5APQ A;  1KB9 E;  2KP8 A;  3ZDM A;  4D6T E;  1K04 A;  3VMZ A;  1LTI C;  5AVR B;  2FYU K;  1AJY A;  1IJD B;  4ASW A;  3BRV B;  5CCH D;  2IBZ I;  2KNC B;  2IBZ D;  2I1J A;  2YMK A;  4H13 B;  2QJK B;  4U3F D;  3BAS A;  2P10 A;  4N78 D;  2LXC B;  3CCM P;  4GT1 A;  2J5Z A;  3V2R A;  3AE9 C;  2QE7 H;  1H88 A;  2BCC G;  3CD6 P;  4O9B A;  3GW6 A;  1M8O B;  2SPZ A;  2Z5H A;  3AEB C;  1GK6 A;  5AVT B;  1NU1 E;  1N7S B;  3L71 E;  2KZI A;  3H32 C;  1JY2 P;  3FIB A;  1FZE A;  3GLM A; 
#chains in the Genus database with same CATH homology
 2I1K A;  1OXZ A;  1IK9 A;  1YTZ T;  2IFM A;  3H32 B;  3HUS C;  2J3U A;  3U59 A;  2Z4E B;  4LLH A;  1N7S D;  2OAR A;  4XA4 A;  2WT7 A;  5AVV B;  2A45 H;  5CJ0 A;  5CCH A;  1L4A C;  2Q9I C;  5APU A;  3P8C E;  5AW5 B;  3KYQ A;  1FZG C;  4DZO A;  1ZR4 A;  2M3B A;  2XDJ A;  3T97 A;  5AVY B;  1URQ D;  3OJA B;  1NWQ A;  2P67 A;  3RL0 D;  1G1J A;  1NHL A;  3KQG A;  3TNU A;  1A02 J;  1J1E B;  1LTG C;  3MUD A;  1LWU C;  1LTA C;  1JCD A;  1VDF A;  3BVH C;  1SQX K;  2FKW B;  2J0H A;  1GZL A;  1MV8 A;  3VMX A;  3RK2 D;  5APW A;  3E1I A;  3HUS A;  3P32 A;  1SFC C;  1NO4 A;  2HPC A;  1A02 F;  1JCC A;  4WBA A;  1ZLL A;  2R32 A;  1T2K C;  3VYI A;  2HLO C;  3H32 A;  1N86 B;  4M7H A;  4C46 A;  2NPS B;  4I2L C;  1LT9 C;  2IPP A;  1FZB B;  3I5C A;  1M1J B;  1URQ B;  3HE5 B;  2P2U A;  2C0W A;  3GHG B;  2JHK F;  1X79 B;  3V2N A;  1LTJ A;  3R2P A;  5CCG C;  2HOD B;  1VPC A;  1IFI A;  2KLV A;  2J61 A;  4LC1 A;  5KJ7 D;  1S9K E;  3EFG A;  3IFM A;  2WT7 B;  2E43 A;  1JC9 A;  4M3L A;  4ZKU A;  2N1T D;  2GY7 A;  1IFJ A;  1FID A;  1IO4 A;  3A2A A;  1GL2 D;  3O8Z A;  1L4A B;  2Q9I B;  1W2E A;  5AVX B;  1GL2 A;  1HH0 A;  1FZF B;  2D39 A;  2KB7 P;  3BAT A;  1FZG B;  1WT6 A;  3N4X A;  3VTP C;  1HVV A;  2YNY A;  1RF0 C;  2W6B A;  3WMM 0;  2MJZ A;  2FFD A;  5AW6 B;  3C9I A;  2QM7 A;  3MGN A;  2J0Y A;  1IC2 A;  4I1L A;  4Y99 C;  3II6 A;  1FZF A;  1SQP K;  1XTG B;  2FFD C;  1J1E C;  5CHX A;  1LWU B;  1YYC A;  3BVH B;  2YKO A;  1PFI A;  1N7S C;  1JY2 N;  3VOP A;  3L37 A;  1G2C B;  4JZC A;  2J3O A;  1MUU A;  1RE4 A;  2JHI F;  3KPE A;  1FZC B;  4N3Y B;  2JEE A;  2O1K A;  1L4A D;  3HD7 B;  3HD7 A;  3B5N B;  2H43 A;  2NPS C;  2WIT A;  3TYY A;  1M7L A;  4JYB A;  5AW3 B;  2JHM F;  1M1J C;  1CZQ A;  1URQ C;  4EOT A;  1HGV A;  1JTH A;  4NYT A;  5AVQ B;  2OYI C;  3CI9 A;  1LWU A;  2R5D A;  1FOS F;  2XNX B;  2HLO B;  1RE3 B;  2WPR A;  1GU4 A;  1CI6 A;  3P8C D;  1KZU B;  1SLQ A;  2O1J A;  1J1D B;  2J0G A;  5KTB A;  3M9H A;  5AW9 B;  5AVW B;  3UIA A;  3RK2 C;  3GHG A;  1FJP A;  1AFO A;  2WWW A;  1M1J A;  1URQ A;  2IFN A;  2Z4E C;  5AW4 B;  1LTB C;  1FOS E;  1T2K D;  2IX7 C;  1L4A A;  3TNU B;  2KOG A;  3V5B A;  2Q9I A;  4IFM A;  3G3Z A;  2WZ7 A;  1RE4 C;  1SVF A;  1JY3 P;  4JYC A;  2J60 A;  1DEB A;  1NTZ K;  1LTS C;  1WRG A;  4B86 A;  3MIW A;  1SP4 A;  1MFZ A;  4GIF A;  1JNM A;  4M7F A;  2CPB A;  2YMY A;  5CCG D;  1FIB A;  1Z3U A;  1GTW A;  4RES B;  1SQB K;  1T3J A;  2OYH A;  2J64 A;  2FYZ A;  1L0N K;  2XV5 A;  4W7Z A;  1RF0 B;  2J3F A;  1RE3 C;  2XNX A;  3NMD A;  2OYH C;  4Y99 B;  1FU1 A;  2HOD C;  5AW1 B;  1GL2 C;  2P7J A;  1AQ5 A;  1FZE B;  3B5N C;  2LKM A;  3RK3 C;  1HGZ A;  3VN0 A;  2OYH B;  1FDM A;  1SQQ K;  2N1T B;  1CW5 A;  3NTN A;  3B5N A;  1LT9 B;  4OH8 B;  1FZE C;  1N86 C;  5KJ7 A;  1FZA B;  2JHH C;  4ZFG A;  4C7N B;  1RE3 A;  4KHX A;  2XNX C;  2WPS A;  4I6M C;  3MTU E;  1IFN A;  1NH4 A;  1FZA C;  1NOH A;  2QM8 A;  2N9B A;  1NKN A;  1IFM A;  3EQ2 A;  2WSC H;  2H7H A;  1YTZ I;  3M9Q A;  3L4F A;  3RL0 B;  5AVU B;  1HTL C;  1RF1 B;  1T3U A;  2GUV A;  1EQ7 A;  3SWF A;  2C0X A;  2OYI A;  1KIL D;  2NPS D;  3P8M C;  1RE4 B;  2HLO A;  1SQV K;  4C7R A;  3E1I C;  1J1D C;  4R9T A;  2XZR A;  1GU5 A;  1NTK K;  3BVH A;  4GKG A;  4IFF A;  1SFC A;  2HPC C;  1JTH B;  3V4W A;  4AYC A;  5KLV K;  1S9K D;  3HD7 C;  2C9N Y;  1DX7 A;  1CSB A;  1NTM K;  1JOC A;  4EIJ A;  1FJK A;  2L5G B;  5CJ4 A;  1LGH B;  1Z56 A;  1HWT C;  2M8R A;  1OWA A;  3MD0 A;  1FZG A;  1FBM A;  1G2C A;  1Z3S A;  2HYN A;  2JJL A;  2HFE D;  2E42 A;  1MZ9 A;  2NPS A;  5CCH C;  1NKZ B;  2W27 A;  3RK3 B;  1JY3 O;  1N86 A;  2H43 C;  1SFC B;  3V2Q A;  3RK2 B;  1N73 B;  4C7N A;  4N6J A;  4JF7 A;  1KFM A;  5BU5 A;  3E1I B;  3IR9 A;  3NFQ A;  2OYI B;  2HG5 D;  2P1J A;  5APX A;  2HOD A;  3TK1 A;  3P7K A;  5APT A;  1LTJ B;  1H8A A;  2J3G A;  3SWY A;  3HE4 A;  3LW5 H;  5AW7 B;  3VP9 A;  2PAJ A;  2YO2 A;  3CL3 D;  1ZN5 A;  4JYO X;  2ZFC A;  1FZB A;  3M9B A;  2O01 H;  2Q5U A;  1JUN A;  5CCG A;  1RF0 A;  1RF1 C;  3V4Q A;  2GUS A;  3B5N D;  3U1C A;  1QL2 A;  4HYT B;  4WY4 C;  1GW3 A;  3RK3 D;  3B8E B;  2J61 B;  1N2D C;  2JHL F;  4R9J A;  1JO5 A;  5BVZ A;  3HUS B;  1JY3 N;  2WSF H;  4W80 A;  2J59 M;  3OAK A;  4WB4 A;  1LT9 A;  2J3F D;  2CPS A;  2N1T A;  2WPQ A;  3L35 A;  3VP8 A;  4AUW A;  2Z4E A;  2YO3 A;  2XU6 A;  3L36 A;  5AW0 B;  2C9L Y;  5BU8 B;  1GK4 A;  2KSJ A;  5AVZ B;  1X8Y A;  1LTJ C;  4ZKP A;  2R3C A;  5AW2 B;  5AW8 B;  1E5W A;  2W6A A;  1G1I A;  3HE4 B;  2HPC B;  2GM4 A;  2J2P A;  2R5B A;  3KDP B;  2J1G A;  1LTT C;  1FZD A;  2WSE H;  1FIC A;  2VRS A;  1CI6 B;  2BAS A;  1KIL C;  2J58 A;  5APY A;  5APS A;  1FZC C;  4IFD K;  1GD2 E;  3A7O A;  1N73 A;  2WNP F;  2A45 I;  3M0D C;  4HH2 A;  5APQ A;  3RL0 C;  2KP8 A;  2POH A;  1GW4 A;  3CLQ A;  3M0A A;  4EPU A;  1DH3 A;  3HD7 D;  3V2P A;  3LID A;  4DOJ A;  2YKQ A;  1NU1 K;  2WTY A;  3TSI A;  2H43 B;  2YKP A;  3VMZ A;  1QL1 A;  1T8Z A;  1N7S A;  1H89 A;  1XTC C;  1N73 C;  1LTI C;  1FZC A;  3M06 A;  1ZV8 A;  1SFC D;  1KIL A;  4LGD E;  3M0D A;  2FYU K;  3GHG C;  5AVR B;  2H8P D;  1IJD B;  3HRN A;  1FZF C;  3BRV B;  4WY4 B;  5CCH D;  2Z5I A;  2I1J A;  2FIB A;  4XE5 B;  2Q7C A;  2ZXE B;  5APV A;  1J2J B;  1IFD A;  3BAS A;  1RY3 A;  3N7N A;  2FFD B;  1JMM A;  4N78 D;  3PP5 A;  3A3Y B;  3HTK A;  4GT1 A;  1GDT A;  2J5Z A;  2A45 G;  3V2R A;  1L0L K;  5KJ7 C;  1GL2 B;  1JY2 O;  1HBW A;  1ZR2 A;  4N78 E;  1H88 A;  3NXS A;  2N1T C;  3LIE A;  1KFN A;  3VMY A;  2Q3I A;  3BRT B;  4WY4 A;  2KYV A;  3U1A A;  4O9B A;  3M91 A;  4WY4 D;  3HTK B;  1FZA A;  1KIL B;  4AQR D;  1N7L A;  1KQL A;  2Z5H A;  1FAV A;  2FXM A;  1RF1 A;  1GK6 A;  5AVT B;  1FZB C;  3H6P A;  5CMZ A;  1N7S B;  3OA7 A;  1NAF A;  3H32 C;  3HE5 A;  5AVS B;  2PP6 A;  3A5T A;  4W7Y A;  1JY2 P;  3FIB A;  1HJB A;  1X9V A;  1FZE A;  1HUC A;  2XKM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...