2OYHC

Crystal structure of fragment d of gammad298,301a fibrinogen with the peptide ligand gly-his-arg-pro-amide
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
299
structure length
299
Chain Sequence
YEASILTHDSSIRYLQEIYNSNNQKIVNLKEKVAQLEAQCQEPCKDTVQIHDITGKDCQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQSAIPYALRVELEDWNGRTSTADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDAPSAKFFTSHNGMQFSTWDNDNDKFEGNCAEQDGSGWWMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIPFNRLTI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Probing the gamma2 Calcium-Binding Site: Studies with gammaD298,301A Fibrinogen Reveal Changes in the gamma294-301 Loop that Alter the Integrity of the "a" Polymerization Site.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
molecule keywords Fibrinogen alpha chain
total genus 89
structure length 299
sequence length 299
chains with identical sequence F
ec nomenclature
pdb deposition date 2007-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2oyhC01
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 2oyhC02
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 2oyhC03
1RE3B 2XNXC 1T3UA 1JY3P 1RF1C 1N73A 2OYHA 1RF0C 3GHGC 3H32B 2Z4EB 3E1IB 2A45I 1JY3N 1Z3UA 1FZEC 1FZDA 1FZCB 1FZBA 1RF1B 1FZAB 2H43B 2J1GA 2J3FA 1LT9B 3H32C 3HUSA 2Z4EC 1FZEA 1FZAA 2J3OA 1JY2N 2J64A 4NYTA 2A45H 3BVHA 2Q9IB 2FFDB 4JYOX 2OYHC 2HODA 1JY3O 1N73C 1N86B 2HLOB 1JY2P 1LT9C 2FIBA 2HODB 2A45G 4JZCA 4R9JA 1FZGB 2HPCA 1LWUC 2GY7A 2JHKF 4ZFGA 2Q9IC 4M7FA 2XNXB 2J3GA 1FZCA 1RE4C 3FIBA 1M1JA 2HLOC 2FFDA 2JHIF 1FZFB 2J5ZA 3GHGB 1RF0B 2J0GA 2D39A 2FFDC 2HLOA 3HUSB 1RE4A 4R9TA 1FZEB 2Q9IA 2J2PA 1LWUA 2H43A 1LTJC 2OYIC 1N86A 2J3UA 2OYHB 1LT9A 1W2EA 3E1IA 1FZFA 1FZGA 1M1JB 1JY2O 2HODC 1RE3C 1RE3A 1JC9A 2J3FD 2J0HA 2JHLF 1FZGC 1FZBB 3E1IC 1FZFC 3BVHC 1N73B 1N86C 1LTJA 2OYIA 1FZAC 2H43C 3HUSC 3H32A 2Z4EA 4EPUA 1FIBA 2J0YA 4M7HA 2J61B 2WNPF 1LWUB 1Z3SA 1FZBC 2JHMF 2HPCB 3BVHB 1RE4B 1M1JC 1RF0A 3GHGA 1FZCC 1FICA 1FIDA 1LTJB 2OYIB 1RF1A 2J60A 2XNXA 2HPCC 2JHHC 2J61A
chains in the Genus database with same CATH superfamily
2K3RA 3HD7D 1SQBJ 2OYHA 1SQXE 4L74A 3K5BA 5AVVB 2RN0A 2MKVA 4N78D 4OGQC 3H1KD 3CCUP 2R44A 1JTHA 2Z5IA 1ZW0A 1HH0A 1DD3A 1K05A 3H1JD 3CMAP 3OA7A 2HODA 1H8AA 1NTZK 1QL1A 3ZDMA 2Y0DA 2W6JH 2KLUA 5EFWB 5CHXA 2E75B 1SQQE 1QVGO 1KQLA 1FZFB 1OFCX 2BCCD 2KOGA 1KN7A 3WMM0 3G3ZA 2V7QH 3MHVA 1L4AA 2XZRA 2LXCB 1HGVA 5KLVJ 3VMXA 2OYIC 1M7LA 1EC5A 3L73G 1L0NK 3VP8A 1RE3A 2O1KA 1ZXGA 1KYOD 4U7JA 1QGKB 1LTJA 2WPVB 3EFGA 1Z3SA 3H1LJ 1S1CX 4U3FG 2Q6QA 2AEFA 3H25A 2GUVA 1PGPA 1ZOYC 1OWAA 3Q1MA 2C9LY 4GT1A 2J60A 2D2CB 1SP4A 5KKZB 3T97A 1QEXA 1ZLLA 5CBNA 1VQ7P 4D6TE 1N73A 1J1EC 3H32B 2Z4EB 1JY3N 3MIWA 1PV3A 1YJNP 1EZVE 1NU1D 4L76A 1KILB 3WU2E 1OVRA 1S2EA 3CXHI 2M3EA 2W6AA 1K8AQ 1CSBA 2C9NY 1X22A 2AEMA 2PFXA 2IZ1A 4R9JA 5APUA 4JYBA 3CC7P 1EXIA 1M57D 3P8CE 2KZJA 2JKVA 5C39A 4R4LA 1NVOA 1SFCB 2WWWA 4JYCA 1M90Q 2IYOA 1SQXG 2E5TA 1KILC 2O3JA 3AEEC 3I55P 1FZFA 1FBMA 3CXHE 3L70J 3D6ZA 1KORA 1NU1G 2JO1A 1GL2B 1NTMG 4W7ZA 3ABVC 3V6IA 1DEEG 1SQPE 1T6AA 4PD4D 3V2RA 1T3JA 3CCRP 1FZCC 1VDFA 3IFMA 2E42A 1NTKK 2XNXA 1SQQG 2OTKE 2Q5UA 2R32A 3TGUJ 1S9KD 1L4AB 1OW6A 2HG5D 1SQXK 3D71A 1USEA 4WY4C 4EYYQ 4ZMDA 3P8MC 1HTLC 2I1KA 4DJGA 2QIWA 4LGDE 1ZR4A 4IL6H 3AEGC 1SFCA 3MUDA 3BATA 2ZYGA 1GW4A 4NYTA 2FFDB 3CMEP 1XTCC 2KI7B 3HE4A 2E43A 2GY7A 2JDIH 2JWAA 3LW5J 3IF4A 3IR9A 1YTZT 2KYVA 1IO4A 2YKOA 1SQPK 4Z1MH 2J0GA 3U59A 1S5LE 1VF5D 5CMZA 3C8VA 2M3BA 2LKMA 4W7YA 1LT9A 3KPEA 3M06A 1AVYA 2WSCJ 2IBZG 1FZFC 4RKUJ 5CCGA 3L74E 4HJGH 1IFNA 1LT1A 2WT7B 2J0YA 4XE5B 5GTHE 2NPSA 4EDFA 1FZBC 2JHMF 1SQBD 1KB9E 3EFFK 2PRRA 1EDIA 1XTGB 2ZVNB 2DW3A 1R5SA 2O01J 3R2PA 4U3FJ 3E1RA 2HPCC 3L70E 2XNXC 3L72G 1T3UA 2K1AA 4BXLA 4IL6E 3TSIA 2V7QJ 5KLVG 1L0LD 1JM0A 2WQYC 2WPQA 1IZNB 1ZR2A 1W5CE 1KYOE 1GD2E 3U1CA 3W67A 5KKZC 4IFFA 3VYIA 3VP9A 1OXZA 1FZAA 3H1HE 1YTZI 2QJPC 4B86A 1W2BO 1SQVJ 1NTME 2KSEA 1VQ6P 1BE3G 2W27A 1AFOA 1JY2P 3AEFC 3L37A 1H0TA 1FZGB 5H2FE 2XNXB 2GA1A 1FZCA 1NU1J 1USDA 2HLOC 2FFDA 2UWJE 3H1JJ 1Y8AA 1NTZD 2FYUD 1WMKA 1Y47A 1RQVA 2PP6A 2Q9IA 5APVA 1AQ5A 1M8OB 2K37A 3HRNA 1JC9A 2K9JB 3CWBG 2FYUG 1N73B 1J2JB 1Y9BA 1GW3A 1HUCA 1JEKA 3H32A 2Z4EA 3BCCG 4EPUA 1FIBA 5KAIE 1AA0A 1FDOA 1NKZB 2HPCB 3RK2B 2WSEJ 1JMBA 3M0AA 1YHQP 4IFMA 1U57A 2ZAEB 2Z5HA 2FYUK 4K35A 2FYUJ 3C9IA 1BDDA 1HWTC 5KJ7A 1RF0C 2KK7A 1A02F 5BU5A 4KT0J 1X79B 2KS1A 2AXTE 3PJSK 3TF5A 3ITKA 1RY3A 2KNCB 1CI6B 1D7MA 4U3FE 2Y9YA 1IK9A 1FJKA 1R5LA 3H1ID 2ZXXA 2N1TA 4EIJA 2Q9IB 3L74G 3V2NA 3D6YA 2QA4P 1JCCA 3H1LG 2V4HA 2OTLP 2HLOB 1PGOA 1KMIZ 3FXEA 4C7RA 5K5GB 1GL2C 1UIXA 3M9HA 1SQQD 3C1LA 2FFDC 1A02J 3L70G 3B5NB 3CCVP 2Q3IA 4Y28J 4I7ZB 4HYTB 1LTJC 5KLVK 2IFMA 1M1JB 2JHLF 2ZVOB 3JC22 4NPDA 1KFNA 1BGYG 1FZAC 3JCUH 3HD7A 1MUUA 2ZT9D 3FGAD 1FC2C 4N78E 2B87B 2FYNC 5KAFH 4NPFX 2KZIA 2BEZF 3CL3D 1Q81Q 3OJAB 4PD4I 2YXQB 1SQVE 5KAFE 2WSFH 3Q3DA 1X9VA 3HE5B 3GHGC 3Q5PA 1OW8A 3BASA 2N1TC 5H2FH 2A45I 5GTHH 1FZDA 3CX5H 3TNUA 1NTKD 1FZBA 5TISH 1FZAB 1SQPG 3MZWB 1NKNA 3CC4P 1U7JA 1NGMB 1PP9D 5GTIH 5KJ7C 1IFPA 1OZHA 3LIEA 1LNQA 2KS1B 3B5ND 2JHKF 1MKMA 1CZQA 1OVVA 3O6QB 1KC8Q 4UB8H 3RK3C 1ZN5A 1L0LE 4Y99C 2GM4A 1FE6A 1LTBC 3SWFA 1LWUA 1FU1A 3HTKA 5CCGC 3E1IA 2M5AA 1URQB 1SQQJ 3RL0g 1URQD 1BSNA 4AUWA 3AE7C 4ASVA 3CCLP 1RE4B 2E74B 3H1LE 1YJWP 4H0LD 5APXA 2CPSA 1IJDB 1KV4A 1RF1A 1DX7A 1AV1A 2JHHC 3KZIH 2XU6A 4IL6X 4U3FD 3L75G 1RE3B 1N7SA 4PV1D 1T2KC 4TT3H 1SVFA 2R3CA 2IFNA 3FWLA 4NPEA 3V4WA 4XFJA 3CWBJ 1PGQA 5AVUB 1L0NJ 5CCHD 1NH4A 3G71P 2NPSC 1MV8A 1GU5A 3JCUE 2Y0CA 1J1DB 5AW5B 3BCCJ 1ZRTE 1GK4A 4ZKPA 1G1JA 2YO2A 3R4YA 4EI2A 1NU1E 2O1JA 3CCJP 3I56P 1N7SC 3L72E 2FKWB 3GLMA 3M0DC 3A7OA 1NAFA 3VMAA 4ASWA 3L35A 1VF5B 1K04A 1BGYD 1MFZA 2D39A 4I2LC 3H1LD 3HUSB 1SQVG 4LC1A 1IFMA 1N86A 2KXPB 1NJIQ 2YXRB 2W83C 1FZGC 4C7NA 3E1IC 3BCCD 2YMKA 2WSSH 3KHUA 5DJUB 4PJ0H 3L72J 4JPZB 3RK3E 1MFTA 2E75C 1J1EB 4I1LA 2ZXEB 1VQPP 1M1JC 1CI6A 2A06G 5APQA 3GHGA 3F89A 3GF7A 2PAJA 3KDPB 2Y0EA 3FWNA 3PRJA 1GU4A 2YIUB 3A2AA 1PPJE 3L73J 3T97B 1OIPA 3TNUB 4KHXA 4YXDC 3VN0A 1PFIA 1FZEC 2R5DA 3KYQA 1BE3D 3CWBD 1K73Q 2A06D 2H88C 3VMZA 2QJKB 2YKPA 1SS1A 3SWKA 2WT7A 5AVRB 4JZCA 1GDTA 3PH0A 1TU3F 1R8EA 3PP5A 2OQQA 3CCSP 3O8ZA 4H44D 2BCCJ 4R9TA 1FZEB 2IBZI 1SQVD 1G1IA 1ZRTD 2E76D 3NTNA 3CXHH 2CK3H 3BRVB 3L75J 1SQBG 5AVQB 2QJKC 3EWKA 1GL2D 2O01H 1KILA 2FXMA 2IYPA 2K88A 1L4AC 1KQSO 5KLVD 3G4SP 1J1DC 1S5LH 1YIJP 1LP1A 2OTJP 3SWYA 4AQRD 3S9OA 3AEAC 3RBXA 2J5UA 1FICA 3USSA 2QE7H 2J58A 4H13C 3GG2A 2ZYDA 1BCCG 1IK7A 2ZT9C 1HVVA 1JNMA 4PV1B 3EQ2A 3L75D 2N9BA 4PD4H 2LR2A 2YMYA 1LGHB 1Q7YQ 1RF1B 2IBZD 5AW9B 3GW6A 2WZ7A 3H32C 2Z4EC 1JTHB 2J3OA 5CJ4A 4LLHA 3CCEP 2W8ZA 1IFIA 2HODB 1URQA 2W90A 1FAVA 4OH8B 1NHLA 4M7FA 3H1KE 1WRGA 1QL2A 4W80A 3L71J 4HH2A 1KYOH 2LXBA 3N4XA 4D6TJ 2N9YB 1RE4A 2ZYAA 3SSUA 1PP9E 2H8PD 1L0LK 2L91A 2R5BA 2E76C 3JSVC 1RE3C 1KZUB 4YTPC 1YYCA 1E79H 2WITA 3NFQA 1EDJA 3II6A 5B66E 4QMAA 1BDCA 1EXJA 3PTZA 4KJMA 2NPSB 3L4FA 2IX7C 3V2QA 2RMZA 2WPSA 3B4SA 4PV1C 1M1KQ 3A0BH 1PP9J 1L0NG 1URQC 2K9JA 3H1IJ 2SPZA 2M5AB 2QG4A 1NTMD 2QJYC 4H0LC 4UB6H 1GTWA 5E79H 1FDIA 3RK2C 3HUSA 1YBKA 2FBWC 3BVHA 3AEBC 2M8RA 2OYHC 1DEBA 4ZKUA 1QVFO 2ITAA 3WUUA 2JEEA 2B87A 4N6JA 2OGUA 2Q9IC 5CCHC 3L71D 1GZLA 1KQFB 1LTAC 2AXCA 4L75A 2FY8A 1JMMA 1BCCJ 2QJYB 1FS0E 3H1JE 4YPCA 1KQGB 1E5WA 2FXPA 2YIUC 2QJPB 2OYOA 1NTKG 4L73A 1SQXJ 3CCMP 3RL0C 1SFCC 1NTZJ 2WSFJ 3CXHD 4OGQD 1M56D 2KP8A 4OWFA 3TK1A 1L0ND 3B5NA 1N7SD 4EOTA 3OAKA 3CLQA 3RGUA 3A0HH 1LTJB 1UIIA 5M1BA 2H89C 1YITP 3M0DA 2J59M 3H1KG 2BCCG 2IDBA 1VQLP 3G9RA 5CJ0A 2K9YA 5AW2B 2KIKA 2KUBA 1KFMA 5APTA 3MUDC 3NMDA 2H43B 2J1GA 3S1KA 2CPBA 3KXDA 3RL0D 5B66H 1FZEA 4GODA 1DH3A 4WVZA 2P7JA 3VOPA 4I6MC 4WY4B 1N8RQ 2E75D 3M9QA 4GOEA 2HPCA 1KB9H 4WB4A 2J3GA 1P84D 1M1JA 4AYCA 3P32A 4JQ0D 2OARA 1KILE 3KQGA 2J2PA 3AE3C 4TLFA 3H1IG 1S72P 5B5EE 2H7HA 1FZGA 2XKMA 2J0HA 1EZVG 3L70D 5KAIH 1FOSF 2YO3A 2ZT9B 3SFDC 4DT0A 1L0LJ 3V2PA 4ZNCA 1S5LX 3LIDA 3HD7B 3H1HJ 3Q5RA 3F5HA 5TJHA 5CCHA 1JUNA 5KTBA 5APSA 2RKLA 3TYYA 5BU8B 2Q1KA 1SQBE 1RF1C 3G6EP 4IOIH 2ZJSE 3L72D 3D70A 2AXTH 5APYA 4RO0A 3B8EB 5AW3B 3WU2H 1VQKP 1HJ0A 5AW1B 3WUVA 3CX5E 1BGYE 3LW5H 1U7MA 2P2UA 3BRTB 1BCCD 4C46A 1RQUA 2J64A 1NTKE 2P67A 4H13B 1H0TB 1N73C 1OMIA 1S3JA 1PIXA 5CCGD 4GKGA 2FIBA 1NTZG 2JP3A 2WPRA 4GIFA 3FX0A 1NTKJ 2QSIA 5AW6B 4R4MA 2HFED 3GHGB 2Q7CA 2E76B 3TDKA 2XNDH 2A06E 2P10A 1FDMA 4DOJA 1Z56A 3M9BA 3AE9C 1Q86Q 1YQ4C 4M3LA 3H6PA 2MJZA 1PPJG 1JY2O 2HODC 1OX3A 1FZBB 2HYNA 1YI2P 2H43C 4DCKA 1YJ9P 4H0LB 2Q3EA 2JJLA 5BVZA 1VPCA 3N7NA 1NWQA 3A0BE 2E74D 4XA4A 1GL2A 2NZ2A 3QH9A 4PD4E 2B88A 2KB7P 1T8ZA 1SQBK 2YKQA 1RHZB 3QWOC 1VQ8P 3MP7B 5E79E 4GOFA 4CPGA 4PJ0E 1Z3UA 3AE5C 1KYOI 1FZCB 2R3SA 3H1IE 1N7LA 2I1JA 1VF5C 1LTGC 2N1TB 1JY2N 1ZMEC 3A0HE 3L36A 2GUSA 1JY3O 2IZ0A 4UB6E 1IC2A 4UB8E 5APWA 2XDJA 5AW7B 2QM8A 1K9MQ 2BASA 3HTKB 2WSCH 2P58A 3RBZA 2JHIF 2XV5A 1RF0B 1SQXD 3B71A 1EZVD 5KJ7D 2M0BA 4RJTA 3GMAA 1G2CB 3W68A 1GMJA 1N2DC 2J3UA 2OYHB 1BCCE 5AVZB 1W2EA 2WSEH 1P84H 3L71G 1VQOP 3IN6A 3RK2D 1S9KE 1JCDA 2OYIA 2RH0A 3H1HG 2J61B 4D6TD 3UIAA 5AW8B 2E5YA 3AE1C 3MTUE 2G3AA 1BE3E 5AVWB 1NTZE 2IPPA 1SQPD 1BGYJ 2QRXA 4BRYA 2I8DA 1KTMA 1EDKA 2C0XA 1JY3P 2D2CD 4BWNA 3RL0B 5DJTB 5AVTB 3I5CA 1X0TA 1SQVK 3TGUG 1LTIC 3M91A 5AVSB 2KLVA 1Q82Q 1PP9G 1ZP0C 4A7PA 5AW0B 1YQ3C 4OVNF 1OW7A 2A45H 2C0WA 4Y99B 1LTSC 3BCCE 3NXSA 5KLIC 1DIPA 3CX5D 2KNCA 2WMMA 1NTMJ 3CCQP 3PHLA 3L74J 3CI9A 2FXOA 4I7ZC 1RH5B 1SLQA 3AECC 2HLOA 1Q2NA 1VL2A 2QM7A 3KZIE 2O01N 4K3AA 2H43A 1L0NE 3AEDC 4D6TG 2J3FD 1SQQK 1QLED 3RK3B 5GTIE 3TGUD 1N86C 4H44C 1AJYA 1HF9A 2WNPF 4HB1A 1DD4A 3P7KA 3BVHB 4O9BA 2KSJA 3Q2YA 1NAYA 3CC2P 1Q90D 2FYZA 2OYIB 4HKZH 3A5TA 1NU1K 1JB0J 2J61A 3SFEC 5CBOA 1PGJA 4IFDK 1LTTC 3AE4C 2HR3A 1L4AD 1GK6A 2D2CC 2QVAA 2QEXP 1P84E 3B5NC 1LJ2A 1EZVI 2PGDA 1BE3J 5KLIB 3L71E 3H1JG 1CW5A 4JF7A 4JYOX 3V5BA 2POHA 1FJPA 1LT9C 1KILD 2JR8A 3Q5SA 5AW4B 4ZFGA 1S4XA 3GF3A 2FYNB 3H1HD 1SQPJ 3AE2C 1H89A 1L2PA 4N3YB 2J5ZA 1VQ9P 3HE5A 1P84I 1G2CA 2JWDA 3L73D 1VQNP 5AVYB 1JOCA 2BCCE 1KB9D 4H44B 1NYHA 1LP1B 1MZ9A 3CD6P 3TGUE 3V4QA 1VQ5P 3BVHC 1ZV8A 3A3YB 3HUSC 2WTYA 5AVXB 4WBAA 2WVRA 4JBZA 1X8YA 3OW2O 4GDOA 4WY4A 3AE8C 2NRGA 1H88A 2NPSD 3MD0A 3L74D 3VMYA 4YXWH 1AQTA 3P8CD 3CX5I 5L8RJ 1EQ7A 2B89A 3AE6C 1IFDA 1L0LG 3CWBE 5B5EH 2FYUE 3E1IB 2VRSA 3L73E 4WY4D 3S4RA 4BRYB 2B9BA 1PPJD 2J3FA 1LT9B 5TISE 1QX8A 4DZOA 4H13D 1KB9I 1PL5A 2P1JA 2W6BA 2BEQD 1NOHA 4MN4C 1AVOA 3U1AA 1VQ4P 1N86B 2IBZE 3O6QA 2A45G 2N1TD 1LWUC 1VQMP 3FIBA 1RE4C 2E74C 1SFCD 2AEJA 2G8YA 3CPWO 2ZFCA 3L75E 3HD7C 3MGNA 4WWIA 1HBWA 1NO4A 1KD1Q 2YNYA 1FOSE 3WUTA 3HE4B 1PZQA 1WT6A 3FXDA 3E7KA 5KLVE 1T2KD 1JO5A 1OVUA 3RK3D 1IFJA 4M7HA 3PLNA 1HGZA 1LWUB 1HJBA 2Y9ZA 3H1KJ 4C7NB 1BSHA 2L5GB 4OGQB 1RF0A 1FIDA 1NTMK 1N7SB 4RESB 1EDLA 3IAOA 3VTPC
chains in the Genus database with same CATH topology
3C9IA 1SQBK 3HD7D 2YKQA 2OYHA 1HWTC 5KJ7A 1RF0C 1HVVA 1JNMA 3EQ2A 1A02F 5AVVB 4N78D 5BU5A 2N9BA 2YMYA 1Z3UA 1LGHB 1FZCB 1X79B 1RF1B 5AW9B 1JTHA 1N7LA 2Z5IA 1RY3A 1HH0A 2WZ7A 1CI6B 3H32C 1JTHB 2I1JA 1LTGC 2N1TB 2Z4EC 2J3OA 1JY2N 5CJ4A 4LLHA 1IK9A 1FJKA 2N1TA 4EIJA 1IFIA 3L36A 2Q9IB 3V2NA 3OA7A 2GUSA 1JCCA 1JY3O 2HODA 1H8AA 1NTZK 1QL1A 2HLOB 1IC2A 2HODB 1URQA 1FAVA 4OH8B 5APWA 2XDJA 5AW7B 4C7RA 1NHLA 1GL2C 2QM8A 5CHXA 4M7FA 2BASA 3HTKB 2WSCH 3M9HA 1WRGA 1QL2A 1KQLA 4W80A 2JHIF 1FZFB 2XV5A 4HH2A 1RF0B 2FFDC 1A02J 2KOGA 3N4XA 3WMM0 1RE4A 3B5NB 3G3ZA 5KJ7D 2Q3IA 1L4AA 2XZRA 1HGVA 1G2CB 4HYTB 2H8PD 3VMXA 1LTJC 2OYIC 1N2DC 5KLVK 1L0LK 2OYHB 2IFMA 2J3UA 2R5BA 5AVZB 1M7LA 1W2EA 2WSEH 1M1JB 1L0NK 3VP8A 1RE3C 1RE3A 2O1KA 1KZUB 2JHLF 1YYCA 3RK2D 2WITA 3NFQA 1S9KE 1JCDA 1KFNA 1LTJA 2OYIA 1FZAC 3II6A 2J61B 3EFGA 3HD7A 1MUUA 1Z3SA 4N78E 3UIAA 5AW8B 3MTUE 2NPSB 3L4FA 2IX7C 5AVWB 2GUVA 3V2QA 2IPPA 3CL3D 1OWAA 2C9LY 2WPSA 4GT1A 3OJAB 2J60A 1SP4A 2C0XA 3T97A 1URQC 1ZLLA 1JY3P 1N73A 2WSFH 1X9VA 3HE5B 3RL0B 3GHGC 1J1EC 3H32B 2Z4EB 3BASA 2N1TC 5AVTB 3I5CA 2A45I 1JY3N 1SQVK 3MIWA 1LTIC 1FZDA 3M91A 3TNUA 1GTWA 1FZBA 5AVSB 2KLVA 1FZAB 3RK2C 1KILB 3HUSA 5AW0B 1NKNA 2W6AA 2A45H 3BVHA 2C0WA 1CSBA 2M8RA 5KJ7C 4Y99B 1LTSC 2OYHC 2C9NY 3LIEA 3NXSA 1DEBA 4ZKUA 4R9JA 3B5ND 5APUA 2JHKF 2JEEA 4JYBA 4N6JA 1CZQA 2Q9IC 5CCHC 3CI9A 3P8CE 1GZLA 1SLQA 3RK3C 1LTAC 1ZN5A 1JMMA 2HLOA 4Y99C 1SFCB 2WWWA 4JYCA 2GM4A 2QM7A 1LTBC 3SWFA 1LWUA 2H43A 1FU1A 3HTKA 1KILC 5CCGC 1E5WA 1FZFA 1FBMA 3E1IA 1URQB 2J3FD 1SQQK 3RK3B 1GL2B 1N86C 3RL0C 1URQD 4W7ZA 1SFCC 4AUWA 2WNPF 3P7KA 2KP8A 3BVHB 4O9BA 2KSJA 3TK1A 3B5NA 1RE4B 1N7SD 4EOTA 3OAKA 3CLQA 5APXA 3V2RA 1T3JA 2FYZA 2CPSA 1FZCC 1LTJB 1VDFA 2OYIB 1IJDB 3IFMA 3A5TA 1RF1A 2E42A 1DX7A 1NTKK 3M0DA 2J59M 2XNXA 2JHHC 1NU1K 2J61A 2XU6A 2Q5UA 1RE3B 2R32A 1N7SA 1S9KD 1L4AB 5CJ0A 1T2KC 5AW2B 1SVFA 2R3CA 4IFDK 1LTTC 2IFNA 2HG5D 1SQXK 1KFMA 1L4AD 1GK6A 3V4WA 4WY4C 5APTA 3B5NC 3P8MC 1HTLC 2I1KA 5AVUB 5CCHD 3NMDA 1NH4A 2H43B 2NPSC 1MV8A 1GU5A 2J1GA 4LGDE 1ZR4A 2CPBA 3RL0D 1FZEA 1SFCA 1J1DB 3MUDA 5AW5B 3BATA 1DH3A 1CW5A 4JF7A 1GK4A 1GW4A 2P7JA 4NYTA 3VOPA 4ZKPA 2FFDB 1G1JA 1XTCC 4I6MC 4JYOX 2YO2A 4WY4B 3V5BA 2POHA 2O1JA 1FJPA 1LT9C 1N7SC 1KILD 3HE4A 2E43A 3M9QA 2FKWB 5AW4B 2HPCA 2GY7A 3M0DC 4ZFGA 4WB4A 3A7OA 1NAFA 3IR9A 2J3GA 3L35A 1YTZT 1H89A 1M1JA 2KYVA 4N3YB 1IO4A 2YKOA 4AYCA 2J5ZA 1SQPK 2J0GA 3U59A 1MFZA 3P32A 3HE5A 2D39A 1G2CA 4I2LC 5CMZA 3HUSB 2OARA 2M3BA 3KQGA 4LC1A 2LKMA 5AVYB 2J2PA 4W7YA 1JOCA 1IFMA 1N86A 2H7HA 1LT9A 3KPEA 1MZ9A 3M06A 1FZGA 2XKMA 2J0HA 3V4QA 4C7NA 1FZGC 3E1IC 1FZFC 3BVHC 5CCGA 1ZV8A 1FOSF 1IFNA 2YO3A 3A3YB 3HUSC 2WTYA 2WT7B 3V2PA 2J0YA 4XE5B 2NPSA 5AVXB 4WBAA 1FZBC 2JHMF 1X8YA 1J1EB 3LIDA 4I1LA 3HD7B 1XTGB 2ZXEB 4WY4A 1M1JC 1CI6A 5APQA 3GHGA 1H88A 2NPSD 2PAJA 5CCHA 3MD0A 3KDPB 3R2PA 1JUNA 3VMYA 5KTBA 5APSA 3TYYA 2HPCC 3P8CD 1GU4A 5BU8B 3A2AA 1EQ7A 2XNXC 1T3UA 1IFDA 1RF1C 3TSIA 3TNUB 2WPQA 4KHXA 5APYA 3VN0A 1ZR2A 3B8EB 2VRSA 1PFIA 3E1IB 5AW3B 1FZEC 2R5DA 3KYQA 4WY4D 5AW1B 1GD2E 3U1CA 2J3FA 4IFFA 3LW5H 1LT9B 3VYIA 2P2UA 3BRTB 3VP9A 4DZOA 1OXZA 1FZAA 3VMZA 1YTZI 4C46A 2YKPA 2J64A 2P1JA 2W6BA 4B86A 1NOHA 2P67A 3U1AA 1N73C 1N86B 2W27A 1AFOA 1JY2P 5CCGD 2WT7A 4GKGA 5AVRB 3L37A 2FIBA 2A45G 4JZCA 1FZGB 1GDTA 2WPRA 2N1TD 1LWUC 4GIFA 2XNXB 1FZCA 1RE4C 3FIBA 5AW6B 3PP5A 1SFCD 3O8ZA 2HLOC 2FFDA 2HFED 3GHGB 2Q7CA 2ZFCA 4R9TA 1FZEB 2PP6A 3HD7C 3MGNA 1G1IA 2Q9IA 3NTNA 5APVA 1FDMA 4DOJA 1AQ5A 1HBWA 1Z56A 3M9BA 3BRVB 1NO4A 2YNYA 5AVQB 1FOSE 4M3LA 3H6PA 2MJZA 1GL2D 1JY2O 3HRNA 2O01H 3HE4B 1JC9A 2HODC 1WT6A 1FZBB 1N73B 1J2JB 2HYNA 1T2KD 1JO5A 1GW3A 1KILA 2H43C 2FXMA 1HUCA 3H32A 3RK3D 2Z4EA 4EPUA 1IFJA 1FIBA 4M7HA 1L4AC 1HGZA 1LWUB 1J1DC 1HJBA 2JJLA 1NKZB 2HPCB 5BVZA 3RK2B 1VPCA 4C7NB 3N7NA 3M0AA 3SWYA 1NWQA 4AQRD 2L5GB 1RF0A 4IFMA 1FICA 1FIDA 1NTMK 4XA4A 1N7SB 2Z5HA 1GL2A 4RESB 2J58A 2FYUK 2KB7P 1T8ZA 3VTPC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RE3 B;  2XNX C;  1T3U A;  1JY3 P;  1RF1 C;  1N73 A;  2OYH A;  1RF0 C;  3GHG C;  3H32 B;  2Z4E B;  3E1I B;  2A45 I;  1JY3 N;  1Z3U A;  1FZE C;  1FZD A;  1FZC B;  1FZB A;  1RF1 B;  1FZA B;  2H43 B;  2J1G A;  2J3F A;  1LT9 B;  3H32 C;  3HUS A;  2Z4E C;  1FZE A;  1FZA A;  2J3O A;  1JY2 N;  2J64 A;  4NYT A;  2A45 H;  3BVH A;  2Q9I B;  2FFD B;  4JYO X;  2OYH C;  2HOD A;  1JY3 O;  1N73 C;  1N86 B;  2HLO B;  1JY2 P;  1LT9 C;  2FIB A;  2HOD B;  2A45 G;  4JZC A;  4R9J A;  1FZG B;  2HPC A;  1LWU C;  2GY7 A;  2JHK F;  4ZFG A;  2Q9I C;  4M7F A;  2XNX B;  2J3G A;  1FZC A;  1RE4 C;  3FIB A;  1M1J A;  2HLO C;  2FFD A;  2JHI F;  1FZF B;  2J5Z A;  3GHG B;  1RF0 B;  2J0G A;  2D39 A;  2FFD C;  2HLO A;  3HUS B;  1RE4 A;  4R9T A;  1FZE B;  2Q9I A;  2J2P A;  1LWU A;  2H43 A;  1LTJ C;  2OYI C;  1N86 A;  2J3U A;  2OYH B;  1LT9 A;  1W2E A;  3E1I A;  1FZF A;  1FZG A;  1M1J B;  1JY2 O;  2HOD C;  1RE3 C;  1RE3 A;  1JC9 A;  2J3F D;  2J0H A;  2JHL F;  1FZG C;  1FZB B;  3E1I C;  1FZF C;  3BVH C;  1N73 B;  1N86 C;  1LTJ A;  2OYI A;  1FZA C;  2H43 C;  3HUS C;  3H32 A;  2Z4E A;  4EPU A;  1FIB A;  2J0Y A;  4M7H A;  2J61 B;  2WNP F;  1LWU B;  1Z3S A;  1FZB C;  2JHM F;  2HPC B;  3BVH B;  1RE4 B;  1M1J C;  1RF0 A;  3GHG A;  1FZC C;  1FIC A;  1FID A;  1LTJ B;  2OYI B;  1RF1 A;  2J60 A;  2XNX A;  2HPC C;  2JHH C;  2J61 A; 
#chains in the Genus database with same CATH topology
 2K3R A;  3HD7 D;  1SQB J;  2OYH A;  1SQX E;  4L74 A;  3K5B A;  5AVV B;  2RN0 A;  2MKV A;  4N78 D;  4OGQ C;  3H1K D;  3CCU P;  2R44 A;  1JTH A;  2Z5I A;  1ZW0 A;  1HH0 A;  1DD3 A;  1K05 A;  3H1J D;  3CMA P;  3OA7 A;  2HOD A;  1H8A A;  1NTZ K;  1QL1 A;  3ZDM A;  2Y0D A;  2W6J H;  2KLU A;  5EFW B;  5CHX A;  2E75 B;  1SQQ E;  1QVG O;  1KQL A;  1FZF B;  1OFC X;  2BCC D;  2KOG A;  1KN7 A;  3WMM 0;  3G3Z A;  2V7Q H;  3MHV A;  1L4A A;  2XZR A;  2LXC B;  1HGV A;  5KLV J;  3VMX A;  2OYI C;  1M7L A;  1EC5 A;  3L73 G;  1L0N K;  3VP8 A;  1RE3 A;  2O1K A;  1ZXG A;  1KYO D;  4U7J A;  1QGK B;  1LTJ A;  2WPV B;  3EFG A;  1Z3S A;  3H1L J;  1S1C X;  4U3F G;  2Q6Q A;  2AEF A;  3H25 A;  2GUV A;  1PGP A;  1ZOY C;  1OWA A;  3Q1M A;  2C9L Y;  4GT1 A;  2J60 A;  2D2C B;  1SP4 A;  5KKZ B;  3T97 A;  1QEX A;  1ZLL A;  5CBN A;  1VQ7 P;  4D6T E;  1N73 A;  1J1E C;  3H32 B;  2Z4E B;  1JY3 N;  3MIW A;  1PV3 A;  1YJN P;  1EZV E;  1NU1 D;  4L76 A;  1KIL B;  3WU2 E;  1OVR A;  1S2E A;  3CXH I;  2M3E A;  2W6A A;  1K8A Q;  1CSB A;  2C9N Y;  1X22 A;  2AEM A;  2PFX A;  2IZ1 A;  4R9J A;  5APU A;  4JYB A;  3CC7 P;  1EXI A;  1M57 D;  3P8C E;  2KZJ A;  2JKV A;  5C39 A;  4R4L A;  1NVO A;  1SFC B;  2WWW A;  4JYC A;  1M90 Q;  2IYO A;  1SQX G;  2E5T A;  1KIL C;  2O3J A;  3AEE C;  3I55 P;  1FZF A;  1FBM A;  3CXH E;  3L70 J;  3D6Z A;  1KOR A;  1NU1 G;  2JO1 A;  1GL2 B;  1NTM G;  4W7Z A;  3ABV C;  3V6I A;  1DEE G;  1SQP E;  1T6A A;  4PD4 D;  3V2R A;  1T3J A;  3CCR P;  1FZC C;  1VDF A;  3IFM A;  2E42 A;  1NTK K;  2XNX A;  1SQQ G;  2OTK E;  2Q5U A;  2R32 A;  3TGU J;  1S9K D;  1L4A B;  1OW6 A;  2HG5 D;  1SQX K;  3D71 A;  1USE A;  4WY4 C;  4EYY Q;  4ZMD A;  3P8M C;  1HTL C;  2I1K A;  4DJG A;  2QIW A;  4LGD E;  1ZR4 A;  4IL6 H;  3AEG C;  1SFC A;  3MUD A;  3BAT A;  2ZYG A;  1GW4 A;  4NYT A;  2FFD B;  3CME P;  1XTC C;  2KI7 B;  3HE4 A;  2E43 A;  2GY7 A;  2JDI H;  2JWA A;  3LW5 J;  3IF4 A;  3IR9 A;  1YTZ T;  2KYV A;  1IO4 A;  2YKO A;  1SQP K;  4Z1M H;  2J0G A;  3U59 A;  1S5L E;  1VF5 D;  5CMZ A;  3C8V A;  2M3B A;  2LKM A;  4W7Y A;  1LT9 A;  3KPE A;  3M06 A;  1AVY A;  2WSC J;  2IBZ G;  1FZF C;  4RKU J;  5CCG A;  3L74 E;  4HJG H;  1IFN A;  1LT1 A;  2WT7 B;  2J0Y A;  4XE5 B;  5GTH E;  2NPS A;  4EDF A;  1FZB C;  2JHM F;  1SQB D;  1KB9 E;  3EFF K;  2PRR A;  1EDI A;  1XTG B;  2ZVN B;  2DW3 A;  1R5S A;  2O01 J;  3R2P A;  4U3F J;  3E1R A;  2HPC C;  3L70 E;  2XNX C;  3L72 G;  1T3U A;  2K1A A;  4BXL A;  4IL6 E;  3TSI A;  2V7Q J;  5KLV G;  1L0L D;  1JM0 A;  2WQY C;  2WPQ A;  1IZN B;  1ZR2 A;  1W5C E;  1KYO E;  1GD2 E;  3U1C A;  3W67 A;  5KKZ C;  4IFF A;  3VYI A;  3VP9 A;  1OXZ A;  1FZA A;  3H1H E;  1YTZ I;  2QJP C;  4B86 A;  1W2B O;  1SQV J;  1NTM E;  2KSE A;  1VQ6 P;  1BE3 G;  2W27 A;  1AFO A;  1JY2 P;  3AEF C;  3L37 A;  1H0T A;  1FZG B;  5H2F E;  2XNX B;  2GA1 A;  1FZC A;  1NU1 J;  1USD A;  2HLO C;  2FFD A;  2UWJ E;  3H1J J;  1Y8A A;  1NTZ D;  2FYU D;  1WMK A;  1Y47 A;  1RQV A;  2PP6 A;  2Q9I A;  5APV A;  1AQ5 A;  1M8O B;  2K37 A;  3HRN A;  1JC9 A;  2K9J B;  3CWB G;  2FYU G;  1N73 B;  1J2J B;  1Y9B A;  1GW3 A;  1HUC A;  1JEK A;  3H32 A;  2Z4E A;  3BCC G;  4EPU A;  1FIB A;  5KAI E;  1AA0 A;  1FDO A;  1NKZ B;  2HPC B;  3RK2 B;  2WSE J;  1JMB A;  3M0A A;  1YHQ P;  4IFM A;  1U57 A;  2ZAE B;  2Z5H A;  2FYU K;  4K35 A;  2FYU J;  3C9I A;  1BDD A;  1HWT C;  5KJ7 A;  1RF0 C;  2KK7 A;  1A02 F;  5BU5 A;  4KT0 J;  1X79 B;  2KS1 A;  2AXT E;  3PJS K;  3TF5 A;  3ITK A;  1RY3 A;  2KNC B;  1CI6 B;  1D7M A;  4U3F E;  2Y9Y A;  1IK9 A;  1FJK A;  1R5L A;  3H1I D;  2ZXX A;  2N1T A;  4EIJ A;  2Q9I B;  3L74 G;  3V2N A;  3D6Y A;  2QA4 P;  1JCC A;  3H1L G;  2V4H A;  2OTL P;  2HLO B;  1PGO A;  1KMI Z;  3FXE A;  4C7R A;  5K5G B;  1GL2 C;  1UIX A;  3M9H A;  1SQQ D;  3C1L A;  2FFD C;  1A02 J;  3L70 G;  3B5N B;  3CCV P;  2Q3I A;  4Y28 J;  4I7Z B;  4HYT B;  1LTJ C;  5KLV K;  2IFM A;  1M1J B;  2JHL F;  2ZVO B;  3JC2 2;  4NPD A;  1KFN A;  1BGY G;  1FZA C;  3JCU H;  3HD7 A;  1MUU A;  2ZT9 D;  3FGA D;  1FC2 C;  4N78 E;  2B87 B;  2FYN C;  5KAF H;  4NPF X;  2KZI A;  2BEZ F;  3CL3 D;  1Q81 Q;  3OJA B;  4PD4 I;  2YXQ B;  1SQV E;  5KAF E;  2WSF H;  3Q3D A;  1X9V A;  3HE5 B;  3GHG C;  3Q5P A;  1OW8 A;  3BAS A;  2N1T C;  5H2F H;  2A45 I;  5GTH H;  1FZD A;  3CX5 H;  3TNU A;  1NTK D;  1FZB A;  5TIS H;  1FZA B;  1SQP G;  3MZW B;  1NKN A;  3CC4 P;  1U7J A;  1NGM B;  1PP9 D;  5GTI H;  5KJ7 C;  1IFP A;  1OZH A;  3LIE A;  1LNQ A;  2KS1 B;  3B5N D;  2JHK F;  1MKM A;  1CZQ A;  1OVV A;  3O6Q B;  1KC8 Q;  4UB8 H;  3RK3 C;  1ZN5 A;  1L0L E;  4Y99 C;  2GM4 A;  1FE6 A;  1LTB C;  3SWF A;  1LWU A;  1FU1 A;  3HTK A;  5CCG C;  3E1I A;  2M5A A;  1URQ B;  1SQQ J;  3RL0 g;  1URQ D;  1BSN A;  4AUW A;  3AE7 C;  4ASV A;  3CCL P;  1RE4 B;  2E74 B;  3H1L E;  1YJW P;  4H0L D;  5APX A;  2CPS A;  1IJD B;  1KV4 A;  1RF1 A;  1DX7 A;  1AV1 A;  2JHH C;  3KZI H;  2XU6 A;  4IL6 X;  4U3F D;  3L75 G;  1RE3 B;  1N7S A;  4PV1 D;  1T2K C;  4TT3 H;  1SVF A;  2R3C A;  2IFN A;  3FWL A;  4NPE A;  3V4W A;  4XFJ A;  3CWB J;  1PGQ A;  5AVU B;  1L0N J;  5CCH D;  1NH4 A;  3G71 P;  2NPS C;  1MV8 A;  1GU5 A;  3JCU E;  2Y0C A;  1J1D B;  5AW5 B;  3BCC J;  1ZRT E;  1GK4 A;  4ZKP A;  1G1J A;  2YO2 A;  3R4Y A;  4EI2 A;  1NU1 E;  2O1J A;  3CCJ P;  3I56 P;  1N7S C;  3L72 E;  2FKW B;  3GLM A;  3M0D C;  3A7O A;  1NAF A;  3VMA A;  4ASW A;  3L35 A;  1VF5 B;  1K04 A;  1BGY D;  1MFZ A;  2D39 A;  4I2L C;  3H1L D;  3HUS B;  1SQV G;  4LC1 A;  1IFM A;  1N86 A;  2KXP B;  1NJI Q;  2YXR B;  2W83 C;  1FZG C;  4C7N A;  3E1I C;  3BCC D;  2YMK A;  2WSS H;  3KHU A;  5DJU B;  4PJ0 H;  3L72 J;  4JPZ B;  3RK3 E;  1MFT A;  2E75 C;  1J1E B;  4I1L A;  2ZXE B;  1VQP P;  1M1J C;  1CI6 A;  2A06 G;  5APQ A;  3GHG A;  3F89 A;  3GF7 A;  2PAJ A;  3KDP B;  2Y0E A;  3FWN A;  3PRJ A;  1GU4 A;  2YIU B;  3A2A A;  1PPJ E;  3L73 J;  3T97 B;  1OIP A;  3TNU B;  4KHX A;  4YXD C;  3VN0 A;  1PFI A;  1FZE C;  2R5D A;  3KYQ A;  1BE3 D;  3CWB D;  1K73 Q;  2A06 D;  2H88 C;  3VMZ A;  2QJK B;  2YKP A;  1SS1 A;  3SWK A;  2WT7 A;  5AVR B;  4JZC A;  1GDT A;  3PH0 A;  1TU3 F;  1R8E A;  3PP5 A;  2OQQ A;  3CCS P;  3O8Z A;  4H44 D;  2BCC J;  4R9T A;  1FZE B;  2IBZ I;  1SQV D;  1G1I A;  1ZRT D;  2E76 D;  3NTN A;  3CXH H;  2CK3 H;  3BRV B;  3L75 J;  1SQB G;  5AVQ B;  2QJK C;  3EWK A;  1GL2 D;  2O01 H;  1KIL A;  2FXM A;  2IYP A;  2K88 A;  1L4A C;  1KQS O;  5KLV D;  3G4S P;  1J1D C;  1S5L H;  1YIJ P;  1LP1 A;  2OTJ P;  3SWY A;  4AQR D;  3S9O A;  3AEA C;  3RBX A;  2J5U A;  1FIC A;  3USS A;  2QE7 H;  2J58 A;  4H13 C;  3GG2 A;  2ZYD A;  1BCC G;  1IK7 A;  2ZT9 C;  1HVV A;  1JNM A;  4PV1 B;  3EQ2 A;  3L75 D;  2N9B A;  4PD4 H;  2LR2 A;  2YMY A;  1LGH B;  1Q7Y Q;  1RF1 B;  2IBZ D;  5AW9 B;  3GW6 A;  2WZ7 A;  3H32 C;  2Z4E C;  1JTH B;  2J3O A;  5CJ4 A;  4LLH A;  3CCE P;  2W8Z A;  1IFI A;  2HOD B;  1URQ A;  2W90 A;  1FAV A;  4OH8 B;  1NHL A;  4M7F A;  3H1K E;  1WRG A;  1QL2 A;  4W80 A;  3L71 J;  4HH2 A;  1KYO H;  2LXB A;  3N4X A;  4D6T J;  2N9Y B;  1RE4 A;  2ZYA A;  3SSU A;  1PP9 E;  2H8P D;  1L0L K;  2L91 A;  2R5B A;  2E76 C;  3JSV C;  1RE3 C;  1KZU B;  4YTP C;  1YYC A;  1E79 H;  2WIT A;  3NFQ A;  1EDJ A;  3II6 A;  5B66 E;  4QMA A;  1BDC A;  1EXJ A;  3PTZ A;  4KJM A;  2NPS B;  3L4F A;  2IX7 C;  3V2Q A;  2RMZ A;  2WPS A;  3B4S A;  4PV1 C;  1M1K Q;  3A0B H;  1PP9 J;  1L0N G;  1URQ C;  2K9J A;  3H1I J;  2SPZ A;  2M5A B;  2QG4 A;  1NTM D;  2QJY C;  4H0L C;  4UB6 H;  1GTW A;  5E79 H;  1FDI A;  3RK2 C;  3HUS A;  1YBK A;  2FBW C;  3BVH A;  3AEB C;  2M8R A;  2OYH C;  1DEB A;  4ZKU A;  1QVF O;  2ITA A;  3WUU A;  2JEE A;  2B87 A;  4N6J A;  2OGU A;  2Q9I C;  5CCH C;  3L71 D;  1GZL A;  1KQF B;  1LTA C;  2AXC A;  4L75 A;  2FY8 A;  1JMM A;  1BCC J;  2QJY B;  1FS0 E;  3H1J E;  4YPC A;  1KQG B;  1E5W A;  2FXP A;  2YIU C;  2QJP B;  2OYO A;  1NTK G;  4L73 A;  1SQX J;  3CCM P;  3RL0 C;  1SFC C;  1NTZ J;  2WSF J;  3CXH D;  4OGQ D;  1M56 D;  2KP8 A;  4OWF A;  3TK1 A;  1L0N D;  3B5N A;  1N7S D;  4EOT A;  3OAK A;  3CLQ A;  3RGU A;  3A0H H;  1LTJ B;  1UII A;  5M1B A;  2H89 C;  1YIT P;  3M0D A;  2J59 M;  3H1K G;  2BCC G;  2IDB A;  1VQL P;  3G9R A;  5CJ0 A;  2K9Y A;  5AW2 B;  2KIK A;  2KUB A;  1KFM A;  5APT A;  3MUD C;  3NMD A;  2H43 B;  2J1G A;  3S1K A;  2CPB A;  3KXD A;  3RL0 D;  5B66 H;  1FZE A;  4GOD A;  1DH3 A;  4WVZ A;  2P7J A;  3VOP A;  4I6M C;  4WY4 B;  1N8R Q;  2E75 D;  3M9Q A;  4GOE A;  2HPC A;  1KB9 H;  4WB4 A;  2J3G A;  1P84 D;  1M1J A;  4AYC A;  3P32 A;  4JQ0 D;  2OAR A;  1KIL E;  3KQG A;  2J2P A;  3AE3 C;  4TLF A;  3H1I G;  1S72 P;  5B5E E;  2H7H A;  1FZG A;  2XKM A;  2J0H A;  1EZV G;  3L70 D;  5KAI H;  1FOS F;  2YO3 A;  2ZT9 B;  3SFD C;  4DT0 A;  1L0L J;  3V2P A;  4ZNC A;  1S5L X;  3LID A;  3HD7 B;  3H1H J;  3Q5R A;  3F5H A;  5TJH A;  5CCH A;  1JUN A;  5KTB A;  5APS A;  2RKL A;  3TYY A;  5BU8 B;  2Q1K A;  1SQB E;  1RF1 C;  3G6E P;  4IOI H;  2ZJS E;  3L72 D;  3D70 A;  2AXT H;  5APY A;  4RO0 A;  3B8E B;  5AW3 B;  3WU2 H;  1VQK P;  1HJ0 A;  5AW1 B;  3WUV A;  3CX5 E;  1BGY E;  3LW5 H;  1U7M A;  2P2U A;  3BRT B;  1BCC D;  4C46 A;  1RQU A;  2J64 A;  1NTK E;  2P67 A;  4H13 B;  1H0T B;  1N73 C;  1OMI A;  1S3J A;  1PIX A;  5CCG D;  4GKG A;  2FIB A;  1NTZ G;  2JP3 A;  2WPR A;  4GIF A;  3FX0 A;  1NTK J;  2QSI A;  5AW6 B;  4R4M A;  2HFE D;  3GHG B;  2Q7C A;  2E76 B;  3TDK A;  2XND H;  2A06 E;  2P10 A;  1FDM A;  4DOJ A;  1Z56 A;  3M9B A;  3AE9 C;  1Q86 Q;  1YQ4 C;  4M3L A;  3H6P A;  2MJZ A;  1PPJ G;  1JY2 O;  2HOD C;  1OX3 A;  1FZB B;  2HYN A;  1YI2 P;  2H43 C;  4DCK A;  1YJ9 P;  4H0L B;  2Q3E A;  2JJL A;  5BVZ A;  1VPC A;  3N7N A;  1NWQ A;  3A0B E;  2E74 D;  4XA4 A;  1GL2 A;  2NZ2 A;  3QH9 A;  4PD4 E;  2B88 A;  2KB7 P;  1T8Z A;  1SQB K;  2YKQ A;  1RHZ B;  3QWO C;  1VQ8 P;  3MP7 B;  5E79 E;  4GOF A;  4CPG A;  4PJ0 E;  1Z3U A;  3AE5 C;  1KYO I;  1FZC B;  2R3S A;  3H1I E;  1N7L A;  2I1J A;  1VF5 C;  1LTG C;  2N1T B;  1JY2 N;  1ZME C;  3A0H E;  3L36 A;  2GUS A;  1JY3 O;  2IZ0 A;  4UB6 E;  1IC2 A;  4UB8 E;  5APW A;  2XDJ A;  5AW7 B;  2QM8 A;  1K9M Q;  2BAS A;  3HTK B;  2WSC H;  2P58 A;  3RBZ A;  2JHI F;  2XV5 A;  1RF0 B;  1SQX D;  3B71 A;  1EZV D;  5KJ7 D;  2M0B A;  4RJT A;  3GMA A;  1G2C B;  3W68 A;  1GMJ A;  1N2D C;  2J3U A;  2OYH B;  1BCC E;  5AVZ B;  1W2E A;  2WSE H;  1P84 H;  3L71 G;  1VQO P;  3IN6 A;  3RK2 D;  1S9K E;  1JCD A;  2OYI A;  2RH0 A;  3H1H G;  2J61 B;  4D6T D;  3UIA A;  5AW8 B;  2E5Y A;  3AE1 C;  3MTU E;  2G3A A;  1BE3 E;  5AVW B;  1NTZ E;  2IPP A;  1SQP D;  1BGY J;  2QRX A;  4BRY A;  2I8D A;  1KTM A;  1EDK A;  2C0X A;  1JY3 P;  2D2C D;  4BWN A;  3RL0 B;  5DJT B;  5AVT B;  3I5C A;  1X0T A;  1SQV K;  3TGU G;  1LTI C;  3M91 A;  5AVS B;  2KLV A;  1Q82 Q;  1PP9 G;  1ZP0 C;  4A7P A;  5AW0 B;  1YQ3 C;  4OVN F;  1OW7 A;  2A45 H;  2C0W A;  4Y99 B;  1LTS C;  3BCC E;  3NXS A;  5KLI C;  1DIP A;  3CX5 D;  2KNC A;  2WMM A;  1NTM J;  3CCQ P;  3PHL A;  3L74 J;  3CI9 A;  2FXO A;  4I7Z C;  1RH5 B;  1SLQ A;  3AEC C;  2HLO A;  1Q2N A;  1VL2 A;  2QM7 A;  3KZI E;  2O01 N;  4K3A A;  2H43 A;  1L0N E;  3AED C;  4D6T G;  2J3F D;  1SQQ K;  1QLE D;  3RK3 B;  5GTI E;  3TGU D;  1N86 C;  4H44 C;  1AJY A;  1HF9 A;  2WNP F;  4HB1 A;  1DD4 A;  3P7K A;  3BVH B;  4O9B A;  2KSJ A;  3Q2Y A;  1NAY A;  3CC2 P;  1Q90 D;  2FYZ A;  2OYI B;  4HKZ H;  3A5T A;  1NU1 K;  1JB0 J;  2J61 A;  3SFE C;  5CBO A;  1PGJ A;  4IFD K;  1LTT C;  3AE4 C;  2HR3 A;  1L4A D;  1GK6 A;  2D2C C;  2QVA A;  2QEX P;  1P84 E;  3B5N C;  1LJ2 A;  1EZV I;  2PGD A;  1BE3 J;  5KLI B;  3L71 E;  3H1J G;  1CW5 A;  4JF7 A;  4JYO X;  3V5B A;  2POH A;  1FJP A;  1LT9 C;  1KIL D;  2JR8 A;  3Q5S A;  5AW4 B;  4ZFG A;  1S4X A;  3GF3 A;  2FYN B;  3H1H D;  1SQP J;  3AE2 C;  1H89 A;  1L2P A;  4N3Y B;  2J5Z A;  1VQ9 P;  3HE5 A;  1P84 I;  1G2C A;  2JWD A;  3L73 D;  1VQN P;  5AVY B;  1JOC A;  2BCC E;  1KB9 D;  4H44 B;  1NYH A;  1LP1 B;  1MZ9 A;  3CD6 P;  3TGU E;  3V4Q A;  1VQ5 P;  3BVH C;  1ZV8 A;  3A3Y B;  3HUS C;  2WTY A;  5AVX B;  4WBA A;  2WVR A;  4JBZ A;  1X8Y A;  3OW2 O;  4GDO A;  4WY4 A;  3AE8 C;  2NRG A;  1H88 A;  2NPS D;  3MD0 A;  3L74 D;  3VMY A;  4YXW H;  1AQT A;  3P8C D;  3CX5 I;  5L8R J;  1EQ7 A;  2B89 A;  3AE6 C;  1IFD A;  1L0L G;  3CWB E;  5B5E H;  2FYU E;  3E1I B;  2VRS A;  3L73 E;  4WY4 D;  3S4R A;  4BRY B;  2B9B A;  1PPJ D;  2J3F A;  1LT9 B;  5TIS E;  1QX8 A;  4DZO A;  4H13 D;  1KB9 I;  1PL5 A;  2P1J A;  2W6B A;  2BEQ D;  1NOH A;  4MN4 C;  1AVO A;  3U1A A;  1VQ4 P;  1N86 B;  2IBZ E;  3O6Q A;  2A45 G;  2N1T D;  1LWU C;  1VQM P;  3FIB A;  1RE4 C;  2E74 C;  1SFC D;  2AEJ A;  2G8Y A;  3CPW O;  2ZFC A;  3L75 E;  3HD7 C;  3MGN A;  4WWI A;  1HBW A;  1NO4 A;  1KD1 Q;  2YNY A;  1FOS E;  3WUT A;  3HE4 B;  1PZQ A;  1WT6 A;  3FXD A;  3E7K A;  5KLV E;  1T2K D;  1JO5 A;  1OVU A;  3RK3 D;  1IFJ A;  4M7H A;  3PLN A;  1HGZ A;  1LWU B;  1HJB A;  2Y9Z A;  3H1K J;  4C7N B;  1BSH A;  2L5G B;  4OGQ B;  1RF0 A;  1FID A;  1NTM K;  1N7S B;  4RES B;  1EDL A;  3IAO A;  3VTP C; 
#chains in the Genus database with same CATH homology
 3C9I A;  1SQB K;  3HD7 D;  2YKQ A;  2OYH A;  1HWT C;  5KJ7 A;  1RF0 C;  1HVV A;  1JNM A;  3EQ2 A;  1A02 F;  5AVV B;  4N78 D;  5BU5 A;  2N9B A;  2YMY A;  1Z3U A;  1LGH B;  1FZC B;  1X79 B;  1RF1 B;  5AW9 B;  1JTH A;  1N7L A;  2Z5I A;  1RY3 A;  1HH0 A;  2WZ7 A;  1CI6 B;  3H32 C;  1JTH B;  2I1J A;  1LTG C;  2N1T B;  2Z4E C;  2J3O A;  1JY2 N;  5CJ4 A;  4LLH A;  1IK9 A;  1FJK A;  2N1T A;  4EIJ A;  1IFI A;  3L36 A;  2Q9I B;  3V2N A;  3OA7 A;  2GUS A;  1JCC A;  1JY3 O;  2HOD A;  1H8A A;  1NTZ K;  1QL1 A;  2HLO B;  1IC2 A;  2HOD B;  1URQ A;  1FAV A;  4OH8 B;  5APW A;  2XDJ A;  5AW7 B;  4C7R A;  1NHL A;  1GL2 C;  2QM8 A;  5CHX A;  4M7F A;  2BAS A;  3HTK B;  2WSC H;  3M9H A;  1WRG A;  1QL2 A;  1KQL A;  4W80 A;  2JHI F;  1FZF B;  2XV5 A;  4HH2 A;  1RF0 B;  2FFD C;  1A02 J;  2KOG A;  3N4X A;  3WMM 0;  1RE4 A;  3B5N B;  3G3Z A;  5KJ7 D;  2Q3I A;  1L4A A;  2XZR A;  1HGV A;  1G2C B;  4HYT B;  2H8P D;  3VMX A;  1LTJ C;  2OYI C;  1N2D C;  5KLV K;  1L0L K;  2OYH B;  2IFM A;  2J3U A;  2R5B A;  5AVZ B;  1M7L A;  1W2E A;  2WSE H;  1M1J B;  1L0N K;  3VP8 A;  1RE3 C;  1RE3 A;  2O1K A;  1KZU B;  2JHL F;  1YYC A;  3RK2 D;  2WIT A;  3NFQ A;  1S9K E;  1JCD A;  1KFN A;  1LTJ A;  2OYI A;  1FZA C;  3II6 A;  2J61 B;  3EFG A;  3HD7 A;  1MUU A;  1Z3S A;  4N78 E;  3UIA A;  5AW8 B;  3MTU E;  2NPS B;  3L4F A;  2IX7 C;  5AVW B;  2GUV A;  3V2Q A;  2IPP A;  3CL3 D;  1OWA A;  2C9L Y;  2WPS A;  4GT1 A;  3OJA B;  2J60 A;  1SP4 A;  2C0X A;  3T97 A;  1URQ C;  1ZLL A;  1JY3 P;  1N73 A;  2WSF H;  1X9V A;  3HE5 B;  3RL0 B;  3GHG C;  1J1E C;  3H32 B;  2Z4E B;  3BAS A;  2N1T C;  5AVT B;  3I5C A;  2A45 I;  1JY3 N;  1SQV K;  3MIW A;  1LTI C;  1FZD A;  3M91 A;  3TNU A;  1GTW A;  1FZB A;  5AVS B;  2KLV A;  1FZA B;  3RK2 C;  1KIL B;  3HUS A;  5AW0 B;  1NKN A;  2W6A A;  2A45 H;  3BVH A;  2C0W A;  1CSB A;  2M8R A;  5KJ7 C;  4Y99 B;  1LTS C;  2OYH C;  2C9N Y;  3LIE A;  3NXS A;  1DEB A;  4ZKU A;  4R9J A;  3B5N D;  5APU A;  2JHK F;  2JEE A;  4JYB A;  4N6J A;  1CZQ A;  2Q9I C;  5CCH C;  3CI9 A;  3P8C E;  1GZL A;  1SLQ A;  3RK3 C;  1LTA C;  1ZN5 A;  1JMM A;  2HLO A;  4Y99 C;  1SFC B;  2WWW A;  4JYC A;  2GM4 A;  2QM7 A;  1LTB C;  3SWF A;  1LWU A;  2H43 A;  1FU1 A;  3HTK A;  1KIL C;  5CCG C;  1E5W A;  1FZF A;  1FBM A;  3E1I A;  1URQ B;  2J3F D;  1SQQ K;  3RK3 B;  1GL2 B;  1N86 C;  3RL0 C;  1URQ D;  4W7Z A;  1SFC C;  4AUW A;  2WNP F;  3P7K A;  2KP8 A;  3BVH B;  4O9B A;  2KSJ A;  3TK1 A;  3B5N A;  1RE4 B;  1N7S D;  4EOT A;  3OAK A;  3CLQ A;  5APX A;  3V2R A;  1T3J A;  2FYZ A;  2CPS A;  1FZC C;  1LTJ B;  1VDF A;  2OYI B;  1IJD B;  3IFM A;  3A5T A;  1RF1 A;  2E42 A;  1DX7 A;  1NTK K;  3M0D A;  2J59 M;  2XNX A;  2JHH C;  1NU1 K;  2J61 A;  2XU6 A;  2Q5U A;  1RE3 B;  2R32 A;  1N7S A;  1S9K D;  1L4A B;  5CJ0 A;  1T2K C;  5AW2 B;  1SVF A;  2R3C A;  4IFD K;  1LTT C;  2IFN A;  2HG5 D;  1SQX K;  1KFM A;  1L4A D;  1GK6 A;  3V4W A;  4WY4 C;  5APT A;  3B5N C;  3P8M C;  1HTL C;  2I1K A;  5AVU B;  5CCH D;  3NMD A;  1NH4 A;  2H43 B;  2NPS C;  1MV8 A;  1GU5 A;  2J1G A;  4LGD E;  1ZR4 A;  2CPB A;  3RL0 D;  1FZE A;  1SFC A;  1J1D B;  3MUD A;  5AW5 B;  3BAT A;  1DH3 A;  1CW5 A;  4JF7 A;  1GK4 A;  1GW4 A;  2P7J A;  4NYT A;  3VOP A;  4ZKP A;  2FFD B;  1G1J A;  1XTC C;  4I6M C;  4JYO X;  2YO2 A;  4WY4 B;  3V5B A;  2POH A;  2O1J A;  1FJP A;  1LT9 C;  1N7S C;  1KIL D;  3HE4 A;  2E43 A;  3M9Q A;  2FKW B;  5AW4 B;  2HPC A;  2GY7 A;  3M0D C;  4ZFG A;  4WB4 A;  3A7O A;  1NAF A;  3IR9 A;  2J3G A;  3L35 A;  1YTZ T;  1H89 A;  1M1J A;  2KYV A;  4N3Y B;  1IO4 A;  2YKO A;  4AYC A;  2J5Z A;  1SQP K;  2J0G A;  3U59 A;  1MFZ A;  3P32 A;  3HE5 A;  2D39 A;  1G2C A;  4I2L C;  5CMZ A;  3HUS B;  2OAR A;  2M3B A;  3KQG A;  4LC1 A;  2LKM A;  5AVY B;  2J2P A;  4W7Y A;  1JOC A;  1IFM A;  1N86 A;  2H7H A;  1LT9 A;  3KPE A;  1MZ9 A;  3M06 A;  1FZG A;  2XKM A;  2J0H A;  3V4Q A;  4C7N A;  1FZG C;  3E1I C;  1FZF C;  3BVH C;  5CCG A;  1ZV8 A;  1FOS F;  1IFN A;  2YO3 A;  3A3Y B;  3HUS C;  2WTY A;  2WT7 B;  3V2P A;  2J0Y A;  4XE5 B;  2NPS A;  5AVX B;  4WBA A;  1FZB C;  2JHM F;  1X8Y A;  1J1E B;  3LID A;  4I1L A;  3HD7 B;  1XTG B;  2ZXE B;  4WY4 A;  1M1J C;  1CI6 A;  5APQ A;  3GHG A;  1H88 A;  2NPS D;  2PAJ A;  5CCH A;  3MD0 A;  3KDP B;  3R2P A;  1JUN A;  3VMY A;  5KTB A;  5APS A;  3TYY A;  2HPC C;  3P8C D;  1GU4 A;  5BU8 B;  3A2A A;  1EQ7 A;  2XNX C;  1T3U A;  1IFD A;  1RF1 C;  3TSI A;  3TNU B;  2WPQ A;  4KHX A;  5APY A;  3VN0 A;  1ZR2 A;  3B8E B;  2VRS A;  1PFI A;  3E1I B;  5AW3 B;  1FZE C;  2R5D A;  3KYQ A;  4WY4 D;  5AW1 B;  1GD2 E;  3U1C A;  2J3F A;  4IFF A;  3LW5 H;  1LT9 B;  3VYI A;  2P2U A;  3BRT B;  3VP9 A;  4DZO A;  1OXZ A;  1FZA A;  3VMZ A;  1YTZ I;  4C46 A;  2YKP A;  2J64 A;  2P1J A;  2W6B A;  4B86 A;  1NOH A;  2P67 A;  3U1A A;  1N73 C;  1N86 B;  2W27 A;  1AFO A;  1JY2 P;  5CCG D;  2WT7 A;  4GKG A;  5AVR B;  3L37 A;  2FIB A;  2A45 G;  4JZC A;  1FZG B;  1GDT A;  2WPR A;  2N1T D;  1LWU C;  4GIF A;  2XNX B;  1FZC A;  1RE4 C;  3FIB A;  5AW6 B;  3PP5 A;  1SFC D;  3O8Z A;  2HLO C;  2FFD A;  2HFE D;  3GHG B;  2Q7C A;  2ZFC A;  4R9T A;  1FZE B;  2PP6 A;  3HD7 C;  3MGN A;  1G1I A;  2Q9I A;  3NTN A;  5APV A;  1FDM A;  4DOJ A;  1AQ5 A;  1HBW A;  1Z56 A;  3M9B A;  3BRV B;  1NO4 A;  2YNY A;  5AVQ B;  1FOS E;  4M3L A;  3H6P A;  2MJZ A;  1GL2 D;  1JY2 O;  3HRN A;  2O01 H;  3HE4 B;  1JC9 A;  2HOD C;  1WT6 A;  1FZB B;  1N73 B;  1J2J B;  2HYN A;  1T2K D;  1JO5 A;  1GW3 A;  1KIL A;  2H43 C;  2FXM A;  1HUC A;  3H32 A;  3RK3 D;  2Z4E A;  4EPU A;  1IFJ A;  1FIB A;  4M7H A;  1L4A C;  1HGZ A;  1LWU B;  1J1D C;  1HJB A;  2JJL A;  1NKZ B;  2HPC B;  5BVZ A;  3RK2 B;  1VPC A;  4C7N B;  3N7N A;  3M0A A;  3SWY A;  1NWQ A;  4AQR D;  2L5G B;  1RF0 A;  4IFM A;  1FIC A;  1FID A;  1NTM K;  4XA4 A;  1N7S B;  2Z5H A;  1GL2 A;  4RES B;  2J58 A;  2FYU K;  2KB7 P;  1T8Z A;  3VTP C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...