2OYHC

Crystal structure of fragment d of gammad298,301a fibrinogen with the peptide ligand gly-his-arg-pro-amide
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
299
structure length
299
Chain Sequence
YEASILTHDSSIRYLQEIYNSNNQKIVNLKEKVAQLEAQCQEPCKDTVQIHDITGKDCQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQSAIPYALRVELEDWNGRTSTADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDAPSAKFFTSHNGMQFSTWDNDNDKFEGNCAEQDGSGWWMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIPFNRLTI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Blood clotting
molecule keywords Fibrinogen alpha chain
publication title Probing the gamma2 Calcium-Binding Site: Studies with gammaD298,301A Fibrinogen Reveal Changes in the gamma294-301 Loop that Alter the Integrity of the "a" Polymerization Site.
pubmed doi rcsb
source organism Homo sapiens
total genus 89
structure length 299
sequence length 299
chains with identical sequence F
ec nomenclature
pdb deposition date 2007-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2oyhC01
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 2oyhC02
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 2oyhC03
2Q9IC 1M1JA 3GHGB 1RE3B 1LWUC 1LT9B 2HLOC 1LTJA 2FFDB 1FZFB 2J0HA 2Q9IA 1FZCB 1N73C 2HPCB 3E1IB 2HLOA 2JHLF 3BVHB 2XNXB 4M7FA 2J0GA 2A45G 1T3UA 1N73A 1RE4B 2J3GA 1RF1C 3H32B 1FZBC 2OYHB 2J3OA 1LWUB 2HODC 2HLOB 1JY3N 2A45I 4JYOX 1N86C 1RF1A 1JY2N 1FZGC 2Z4EC 1FZBA 1RF0C 2HODA 1JY2P 1M1JB 1FZEC 2J61A 1FIBA 2H43C 1JC9A 1N86A 2A45H 4R9TA 1LTJB 2J5ZA 1FZGA 2JHKF 2Z4EA 1FICA 3GHGC 2Q9IB 3HUSC 1RF0A 1FIDA 1FZEA 2H43A 2FIBA 1LT9C 1FZBB 2OYIC 1Z3UA 2FFDC 2J60A 1FZFC 1FZCC 2GY7A 2J3UA 3GHGA 4NYTA 2HPCC 3HUSA 1RE3A 1JY3P 2JHIF 2WNPF 2Z4EB 1N73B 1LT9A 2OYIA 3E1IC 2FFDA 2XNXC 1FZEB 1FZFA 1FZCA 3FIBA 2HPCA 4ZFGA 2J64A 1FZAC 3E1IA 3HUSB 3BVHA 3H32C 4JZCA 2XNXA 1RE3C 2OYHC 1RF1B 2J3FA 1FZDA 4M7HA 2OYIB 2D39A 1RE4A 1JY3O 2HODB 1FZAA 2J61B 2J1GA 1N86B 4EPUA 2J3FD 2J0YA 1JY2O 3H32A 2OYHA 1LWUA 1FZGB 1W2EA 2JHMF 1M1JC 2J2PA 1RF0B 3BVHC 4R9JA 2H43B 2JHHC 1LTJC 1Z3SA 1RE4C 1FZAB
chains in the Genus database with same CATH superfamily
3I5CA 2W6AA 2E76B 1JB0J 3L36A 3L74J 1IO4A 5APWA 3MD0A 3KZIH 1YJNP 1UIXA 5AW3B 3AE6C 1N7SB 1KMIZ 3C1LA 4Y99B 2JDIH 3E1IB 2H89C 1HTLC 1IFNA 4XFJA 1G2CB 3AEDC 1SQPJ 1YBKA 1N86C 3CCLP 3KXDA 1L2PA 1LNQA 4K3AA 1L0LJ 2KS1A 5K5GB 1U57A 3U59A 1GL2D 3RK3C 2QG4A 5KTBA 1UIIA 1OMIA 2WZ7A 2JHIF 2FY8A 3G9RA 4ZKUA 3CCVP 2NRGA 4JPZB 3KHUA 3V2NA 1T2KD 1JCDA 5AVRB 3D6ZA 2IBZI 2Z5IA 1FDIA 3AE9C 3BVHA 1RF1B 1H0TB 3A3YB 3CCUP 3H1ID 1L0NJ 4EPUA 2AXTH 4JYCA 2J2PA 2JJLA 1OVRA 4R9JA 1LTSC 3HTKA 3BASA 2K9YA 1BE3D 1LT9B 2HLOC 2YMYA 1QGKB 1KFNA 3AEAC 3BRTB 1KILE 1GD2E 3H25A 1LTBC 5B66H 2R3SA 2A45G 2YNYA 1KZUB 2QSIA 1LTAC 1IFMA 1WT6A 2N9BA 3H32B 3F89A 2WTYA 4IFMA 1VQ5P 3R2PA 3SWFA 1K73Q 5APTA 1GL2A 2WSEJ 3RK3D 2KNCB 3TGUJ 1DEEG 3MP7B 1LTJB 1FZGA 1ZOYC 1FZEA 3KDPB 5AW0B 2H43A 1Z3UA 1G1IA 4HKZH 2WT7A 3L72D 5KLVD 2K88A 3CWBG 3G4SP 4DZOA 2B9BA 4YXDC 2WVRA 3G71P 2QE7H 1LTIC 2FFDA 2V7QH 1VQ8P 2K37A 3M0DA 5B5EH 2ZT9D 1GK4A 3VMAA 1KD1Q 3EQ2A 3VP8A 3FX0A 5CBNA 4PD4H 3UIAA 1PGPA 2KUBA 4LC1A 3JCUE 1M57D 4I7ZC 1KB9I 1YQ3C 4UB8E 4PD4D 1NTKK 1NYHA 3WUUA 1N73C 3KYQA 5GTHE 1SQVG 1FDMA 1SP4A 1EQ7A 2R3CA 1NU1D 2AEMA 1VF5C 1X79B 1CI6B 1NTKD 1RF0C 1M1JB 3D71A 1S2EA 1S3JA 3G3ZA 1SQVE 1EZVD 3PH0A 1FIDA 4ZKPA 3N7NA 2OYIC 2NPSD 1FZCC 1P84H 5KAIE 2HPCC 2KSEA 1L4AB 1PPJD 1QL2A 1KILB 3WMM0 3SWKA 5CCGA 4H13D 1HH0A 4C46A 4HYTB 1JMBA 1FJPA 1X22A 2O1KA 1P84D 2D39A 4PJ0E 1HWTC 3S1KA 2ZYAA 1GW4A 1KN7A 3HD7C 1BGYJ 2FYUD 3KPEA 4MN4C 1Z3SA 5KKZB 3CCQP 4OGQC 3L37A 2WPSA 2QJKC 1LWUC 3OW2O 4KT0J 3PP5A 3KZIE 1J2JB 1L0LK 4U3FJ 4NPDA 5AVSB 1FOSF 1SLQA 1VF5D 1GDTA 1M8OB 4IFDK 3AEGC 2B88A 1FZBC 2OYHB 3NFQA 2K9JA 3TF5A 4JYOX 3F5HA 1GTWA 1KQLA 2KZIA 4I1LA 2Z4EC 1FS0E 1SQBJ 3VN0A 3H1IG 1NTZK 3OAKA 1JMMA 2E74C 2NPSA 1QVGO 3CC7P 2JHKF 2A06D 3HUSC 4K35A 1L0NK 1X9VA 1X8YA 2P7JA 1BE3G 1M90Q 3M9QA 5AVWB 2KK7A 3E7KA 3B5NC 3VYIA 3CD6P 1NAFA 1FZFA 5CHXA 2XDJA 3H1IE 2ZXXA 1RY3A 3BCCD 1VL2A 1NTZD 4A7PA 1Y8AA 3HD7D 1BE3E 2AXTE 4OGQD 3LW5H 2IDBA 3IN6A 2CK3H 1CZQA 2IZ1A 2E75B 3L75D 3M9HA 3CCSP 2LXBA 3L72G 5KLVG 1MFTA 2G8YA 1KC8Q 1J1EB 3BVHB 1KYOH 2B87A 2DW3A 3P8MC 5KJ7C 1OVUA 4R4LA 5B66E 1QX8A 2KSJA 1YQ4C 1VQ7P 3RK3E 3H1JD 5BU8B 2J3OA 2HODC 4IL6H 5AW9B 3HTKB 1KYOD 1PGQA 1GW3A 3L72E 5L8RJ 5KLVE 2J61A 2RH0A 4H0LC 4NPEA 2XZRA 3TGUD 1AQ5A 1FAVA 1PV3A 2KLUA 1D7MA 1ZR2A 3O6QA 4LGDE 1VQ4P 5AW5B 3SFEC 1QEXA 5KLIB 3NXSA 3CMAP 2R32A 1KV4A 3CCEP 3Q2YA 3HD7A 2C0XA 2ITAA 1RE3C 5B5EE 1YI2P 5TJHA 2WSFJ 1GK6A 2IYOA 1GL2B 2K3RA 3G6EP 1NU1G 4PD4E 4QMAA 1LWUA 1FZGB 4W7ZA 2H43B 3V2RA 4H44C 2WT7B 2I8DA 1NTKG 1S4XA 1FZAB 2ZJSE 4ASWA 2QJPC 2FFDB 1EZVG 2Y0EA 2QJYB 5BVZA 2Q9IA 3FWNA 3CLQA 4L74A 1NU1E 1XTCC 2O01J 4GIFA 1Q81Q 1A02F 3V2QA 1MZ9A 1PPJG 1NTKE 1K05A 4WVZA 5M1BA 1JTHA 4PV1D 1S1CX 5DJTB 2KZJA 2A45I 5CCHD 1EZVE 3M9BA 1AQTA 1HBWA 2R5DA 1JY2P 2YKOA 3CCRP 3D6YA 4XA4A 1PPJE 2D2CC 2E76C 3LIDA 1YYCA 2FYUG 3H1HD 4D6TD 2GY7A 1N7SC 2XKMA 1IK9A 1P84E 1VQPP 4KJMA 3E1IC 3VP9A 1OFCX 2J64A 2AEFA 2WMMA 3RK3B 2XNXA 2FYUE 4N78D 2YKQA 4C7NA 3CC4P 3V6IA 4NPFX 4H44D 4N3YB 1E5WA 3TK1A 3NTNA 1BCCD 1BGYD 2M0BA 1J1DB 1HF9A 2MJZA 4IL6X 3MUDC 1KQFB 2A06G 3FXEA 1S5LH 2ZT9B 3PHLA 2JKVA 4UB6H 2P67A 2E5YA 3RGUA 2GUVA 1OW6A 3A0HH 2YXRB 4TT3H 5CCHA 1RF1C 3SWYA 3V5BA 2HLOB 3BCCG 2A06E 1NTZG 2E43A 3AE1C 1H88A 2WPVB 4W80A 2D2CD 3AE8C 2W6JH 1W2BO 2FYNB 2RN0A 3LIEA 1N7SD 3AECC 3H6PA 1LT9C 4RESB 4M3LA 1M7LA 3L73D 5E79H 3BCCE 3GHGA 1NTZE 1RE3A 5AVZB 1PP9D 3QH9A 3R4YA 3WU2H 3L75G 1KFMA 1IFDA 2M5AA 3W67A 3CWBJ 2K9JB 1AA0A 3H32C 3U1CA 1FZDA 1FZAA 1H89A 3H1JG 3H1KD 2WSCJ 2NPSB 4B86A 2JHMF 3PTZA 2O01N 1IFIA 4DT0A 2ZVOB 3L75E 1LTJC 3ZDMA 2CPSA 3VMZA 3TGUG 4H13B 1FZFB 2JWAA 3H1JE 1NH4A 4XE5B 1Q86Q 1NTMK 3MIWA 4M7FA 1KYOE 1URQC 2Q5UA 3HE5A 3RL0B 4YXWH 2SPZA 1LGHB 4DJGA 1YHQP 3L71D 3TGUE 1SQVJ 2WPQA 4IL6E 1NVOA 1U7MA 3Q1MA 1W5CE 1FIBA 2M3BA 1EXJA 1N86A 1R5LA 3VOPA 3I55P 2BCCD 2KLVA 1NTMD 1ZN5A 1VF5B 2XU6A 2BEQD 2B87B 4NYTA 3H1LD 1SVFA 1NHLA 2KXPB 3E1RA 3CCJP 3IAOA 1S5LX 2OYIB 4L75A 3GLMA 2J61B 1XTGB 1SQQK 4BXLA 1DH3A 1ZMEC 2FYZA 1M1JC 2QA4P 3CXHH 1FU1A 2O01H 3O6QB 2E5TA 4GKGA 1LT1A 3SFDC 5AVUB 1LTTC 1M56D 3S4RA 1WRGA 1YJWP 4L73A 3MTUE 5CJ4A 3CXHD 1L4AC 1URQD 1KILC 3H1HG 1CW5A 4D6TG 2HLOA 3HD7B 2JHLF 3USSA 1EDLA 1SQQD 4YTPC 4OGQB 4Z1MH 1SQPK 2OQQA 1AFOA 2QJKB 4WBAA 1OW8A 3MZWB 1LWUB 3EWKA 1PZQA 2Q7CA 3L74D 3SSUA 3TSIA 1IK7A 1DD3A 3H1HE 4AUWA 4D6TE 1JC9A 5AVTB 3RK2C 5AVYB 2Q9IB 1FC2C 5KAFH 1FZBB 1BCCG 1BGYG 3H1IJ 1FJKA 1SQPD 4EYYQ 1JY3P 3NMDA 1AVOA 2Z4EB 4WY4C 3CX5H 5AW1B 1JTHB 1SFCC 4PD4I 1L0LD 3EFFK 1BE3J 2LR2A 2ZVNB 3HUSB 3T97A 2OYHC 3AE3C 5CBOA 1BCCE 1BGYE 2I1KA 3CX5D 2Q6QA 1ZRTD 1IC2A 1YJ9P 2Z5HA 1N8RQ 3Q5SA 2WWWA 1PGJA 3ITKA 1FBMA 1NWQA 2JHHC 5AW7B 1RE4C 2H8PD 2PP6A 2KI7B 1PGOA 1L4AD 1N2DC 3JC22 1S5LE 3BRVB 1K04A 4UB6E 3L73G 2IYPA 1L0ND 1VQKP 1GMJA 2XNXB 2M3EA 1EZVI 4RKUJ 4C7NB 1T3UA 1N73A 1SQXJ 1PP9G 2P10A 2J3GA 3VMXA 3L72J 5KLVJ 1LTGC 4JYBA 3A0HE 1N7LA 5APVA 2QVAA 3V2PA 3RL0g 4JF7A 1S9KD 3A5TA 4L76A 4EOTA 2FXOA 1MKMA 1Y9BA 3RK2D 3L73E 2C0WA 1QL1A 1KQGB 2GUSA 3H1KG 1QVFO 5DJUB 1P84I 1PP9E 1RF0A 2FXMA 2FKWB 2WSEH 2FIBA 3QWOC 3GF3A 2E75C 1Z56A 1GZLA 4WY4D 2JO1A 2J3UA 2L91A 5E79E 4PV1B 4JBZA 1SFCD 2E74D 2OYIA 1J1EC 3H1KE 1FZCA 3WU2E 2HPCA 1G1JA 1PFIA 4HB1A 1VQLP 3CWBD 2YIUC 4I6MC 1S72P 2O3JA 4JZCA 1ZLLA 3B5ND 2J3FD 3L35A 3JSVC 3L71G 1RHZB 1NOHA 2OYOA 2IX7C 3ABVC 1NU1J 2QIWA 3L70J 3CMEP 3GHGB 1RE3B 2IBZD 1NKNA 2BCCG 5KLIC 1NTMG 2PFXA 1NTKJ 2V4HA 2M5AB 4W7YA 3L71E 1NO4A 2E42A 2HFED 3H1LG 4H44B 3RBZA 2GM4A 3IF4A 2XNDH 2ZYDA 3OJAB 2QJPB 4IOIH 1FDOA 1GL2C 2BCCE 1JY3N 2N1TC 1NTME 2JP3A 4WB4A 2YO2A 1FZGC 1NJIQ 1OZHA 5KJ7D 1FZBA 4EDFA 4AYCA 3HE4A 1FZEC 2H43C 3H1LE 2Z4EA 1Q7YQ 1EDKA 1LP1A 1T2KC 1EC5A 2FFDC 2BEZF 2WITA 4GOFA 1A02J 3HUSA 4H0LD 1H8AA 1BDDA 3HE5B 2FYUJ 2W8ZA 3TNUB 3B8EB 2YKPA 4RO0A 4ZFGA 1RQUA 2D2CB 3B5NA 3P7KA 2J59M 1SQQG 2J3FA 5AVXB 4ZMDA 1YTZI 1RE4A 3WUTA 3P8CD 2R5BA 1N86B 1W2EA 4Y99C 4BRYA 3L74G 1T6AA 2AXCA 2P2UA 1PL5A 3CXHE 4EIJA 1KTMA 1NGMB 1OWAA 1SQQE 2WPRA 3CC2P 1KYOI 3CI9A 1KB9H 1VQNP 2R44A 2C9LY 3W68A 1SQPG 1OXZA 4WWIA 3L74E 3I56P 2JR8A 3EFGA 2N1TD 3WUVA 1KB9D 4BWNA 2CPBA 1USEA 1L0LG 4OH8B 5KJ7A 1SQBK 2C9NY 2Y9YA 1KQSO 2HODA 1RQVA 4TLFA 4U3FD 1SQPE 2UWJE 1T8ZA 3RBXA 2IFMA 3BCCJ 3PRJA 1J1DC 1NTZJ 2KB7P 3A0BH 2IZ0A 5C39A 5KAFE 2J60A 3AEBC 1L0LE 2ZT9C 2JWDA 5CCGC 2E76D 4AQRD 1SQBD 3CX5E 1ZRTE 1IFJA 1L0NG 5APQA 4U7JA 4I2LC 1Q90D 3CL3D 2ZFCA 3LW5J 3L75J 4IFFA 1RH5B 2PRRA 5GTIH 2J0YA 1JOCA 1SQXK 2LKMA 2IFNA 1MUUA 5KLVK 3PJSK 3H1JJ 2M8RA 2FYNC 1L0NE 2HR3A 1OW7A 5TISH 1EDJA 1JCCA 1MV8A 3D70A 1HGVA 1S9KE 3CCMP 1OX3A 1DIPA 1X0TA 2N1TA 3T97B 2OTLP 2OTJP 2J0GA 2K1AA 3II6A 1SQXD 3CPWO 3O8ZA 3M91A 3VTPC 1BDCA 2W27A 2RMZA 2JEEA 2NPSC 1OVVA 1JY2N 4GDOA 2KYVA 1NKZB 2LXCB 4OVNF 3A2AA 1URQB 4I7ZB 1Y47A 1VDFA 5CCGD 3AE5C 3TNUA 4H13C 2OGUA 3TDKA 1VQ9P 2Y9ZA 4LLHA 1FZFC 5H2FH 3CWBE 1EXIA 1K8AQ 3U1AA 2IBZG 4HH2A 1N73B 2WQYC 4JQ0D 1VQOP 3AE4C 1NU1K 2OTKE 1N7SA 3RL0C 2YMKA 1HJBA 3E1IA 5APYA 1Q2NA 1KORA 3HRNA 3V4QA 1JY3O 2QM8A 1G2CA 2O1JA 2KP8A 3TYYA 2IBZE 1QLED 2WSFH 5AW8B 1HVVA 3KQGA 1RF0B 2Q1KA 2VRSA 3P32A 1PIXA 1BSNA 3GG2A 1NAYA 3C8VA 1VPCA 2POHA 1ZV8A 1DEBA 2HYNA 3L70D 1WMKA 1DD4A 2XV5A 1JNMA 1FZCB 1USDA 2HPCB 4C7RA 1IZNB 1T3JA 3MUDA 2PAJA 2ZAEB 4HJGH 4O9BA 1IJDB 2WSSH 3BATA 5CMZA 2G3AA 3H1HJ 4D6TJ 1VQMP 1U7JA 2FYUK 3C9IA 2J5UA 3MGNA 1RF1A 2ZXEB 1H0TA 1ZP0C 1IFPA 3GMAA 4R9TA 3M06A 4R4MA 1FICA 3AEFC 1ZR4A 2QRXA 2P58A 3IFMA 2ZYGA 1JEKA 1R5SA 2KOGA 3RL0D 1LT9A 1BCCJ 3FGAD 3MHVA 3P8CE 1DX7A 4ZNCA 5KKZC 3RK2B 4GT1A 2FBWC 4DOJA 4N6JA 2Y0CA 1ZXGA 3HE4B 2PGDA 5APSA 2I1JA 1HGZA 3H32A 1YIJP 4YPCA 4N78E 4WY4B 4CPGA 3B71A 5EFWB 1LP1B 2Q3IA 3L4FA 4Y28J 1AV1A 1SFCB 3Q5RA 2E74B 1TU3F 3B4SA 2Q9IC 4U3FG 2KNCA 3S9OA 1HUCA 1LTJA 1M1KQ 3K5BA 1KB9E 3B5NB 3V4WA 2NZ2A 2Q3EA 5AW4B 3FWLA 1LJ2A 1RE4B 2HG5D 1SQBG 1Q82Q 3L73J 4U3FE 4KHXA 2QEXP 1URQA 1KILD 4BRYB 5AVVB 1GU5A 2IPPA 1PP9J 1OIPA 2YXQB 2A45H 1K9MQ 1FOSE 2H88C 1SQBE 3A0BE 3H1KJ 2P1JA 2W6BA 1EDIA 2KS1B 2RKLA 5AW6B 2WNPF 3N4XA 4RJTA 2XNXC 4GOEA 3FIBA 2MKVA 1SS1A 3Q3DA 4GODA 5BU5A 2N9YB 3CXHI 2HODB 2L5GB 1JM0A 1SQXG 2V7QJ 2J1GA 3OA7A 4EI2A 1JY2O 5GTIE 3JCUH 2B89A 3BVHC 1JO5A 2AEJA 4H0LB 3GF7A 1CI6A 2KIKA 2WSCH 2YIUB 3L71J 4UB8H 1M1JA 4DCKA 2OARA 4OWFA 2W83C 2J0HA 4PV1C 5TISE 1SQXE 5GTHH 2H7HA 1JUNA 2QM7A 5CCHC 1YITP 3AE7C 3PLNA 2BCCJ 1NTMJ 1CSBA 1L4AA 1KILA 2BASA 1SQVK 5CJ0A 2J58A 3H1LJ 1YTZT 5APUA 3AE2C 1VQ6P 1FE6A 1R8EA 3GW6A 1HJ0A 2J5ZA 5AW2B 3GHGC 1E79H 2GA1A 3CX5I 1AVYA 5KAIH 2N1TB 3L70G 5H2FE 1SQVD 3VMYA 3M0AA 3Q5PA 1FZEB 2W90A 1GU4A 1ZW0A 2E75D 1FZAC 5APXA 4WY4A 4ASVA 2YO3A 1BSHA 4M7HA 2FXPA 2Y0DA 4PJ0H 1AJYA 5AVQB 3AEEC 3FXDA 1SFCA 2QJYC 3L70E 2OYHA 3M0DC 1SQQJ 3A7OA 1MFZA 3IR9A
chains in the Genus database with same CATH topology
3I5CA 2W6AA 5AVUB 3L36A 1LTTC 1IO4A 5APWA 3MD0A 1WRGA 1JCCA 1MV8A 5AW3B 3MTUE 1HGVA 5CJ4A 1N7SB 3M9HA 1L4AC 1URQD 1S9KE 1KILC 1CW5A 4Y99B 3E1IB 2HLOA 1J1EB 3HD7B 2JHLF 2N1TA 3BVHB 1HTLC 3P8MC 5KJ7C 2J0GA 1IFNA 3II6A 1G2CB 1SQPK 2KSJA 1AFOA 5BU8B 4WBAA 3O8ZA 3M91A 1LWUB 2J3OA 2HODC 3VTPC 2W27A 1N86C 2Q7CA 5AW9B 2JEEA 3HTKB 2NPSC 1JY2N 3TSIA 2KYVA 1GW3A 1NKZB 2J61A 4AUWA 1JC9A 5AVTB 2XZRA 3A2AA 1URQB 1AQ5A 1FAVA 3RK2C 5AVYB 3U59A 1GL2D 1VDFA 3RK3C 2Q9IB 5CCGD 5KTBA 3TNUA 1FZBB 1ZR2A 4LGDE 4LLHA 1FZFC 5AW5B 1FJKA 2WZ7A 3NXSA 3U1AA 1JY3P 3NMDA 2JHIF 2Z4EB 4HH2A 1N73B 2R32A 4WY4C 4ZKUA 1NU1K 5AW1B 1JTHB 3V2NA 1N7SA 3RL0C 1T2KD 1HJBA 1SFCC 1JCDA 5AVRB 2Z5IA 3E1IA 3HD7A 3HUSB 3BVHA 2C0XA 5APYA 1RE3C 3T97A 1RF1B 2OYHC 1GK6A 3HRNA 3A3YB 3V4QA 1JY3O 2QM8A 1G2CA 1GL2B 2O1JA 2I1KA 4EPUA 1IC2A 2KP8A 3TYYA 2Z5HA 1LWUA 1FZGB 2WWWA 4JYCA 2WSFH 5AW8B 2J2PA 1HVVA 4W7ZA 1FBMA 3KQGA 1RF0B 2VRSA 2JJLA 3P32A 1NWQA 4R9JA 1LTSC 3V2RA 2JHHC 2H43B 3HTKA 3BASA 2WT7B 5AW7B 1RE4C 1VPCA 1FZAB 2POHA 1ZV8A 2H8PD 2PP6A 1DEBA 2HYNA 1L4AD 1LT9B 2HLOC 2FFDB 2XV5A 2YMYA 1N2DC 5BVZA 1JNMA 2Q9IA 1FZCB 3CLQA 3BRVB 1KFNA 1XTCC 4GIFA 2HPCB 4C7RA 3BRTB 1T3JA 3MUDA 1A02F 2PAJA 1GD2E 2XNXB 1LTBC 4O9BA 4C7NB 1IJDB 2A45G 2YNYA 1KZUB 1T3UA 1MZ9A 3V2QA 1N73A 1LTAC 3BATA 5CMZA 2J3GA 1IFMA 3VMXA 1WT6A 1LTGC 4JYBA 1JTHA 2N9BA 1N7LA 3H32B 5APVA 3V2PA 4JF7A 1S9KD 3A5TA 2WTYA 4EOTA 2A45I 2FYUK 5CCHD 4IFMA 3C9IA 3M9BA 3R2PA 3MGNA 3SWFA 1RF1A 1HBWA 2ZXEB 3RK2D 5APTA 2R5DA 2C0WA 1JY2P 1GL2A 1QL1A 3RK3D 2GUSA 2YKOA 4R9TA 1LTJB 1FZGA 4XA4A 3M06A 1FICA 3LIDA 1RF0A 1YYCA 2FKWB 2FXMA 1ZR4A 1FZEA 2WSEH 3KDPB 5AW0B 2H43A 1Z3UA 2FIBA 1G1IA 1Z56A 1GZLA 2WT7A 4WY4D 3IFMA 2GY7A 2J3UA 1N7SC 2XKMA 4DZOA 1IK9A 2KOGA 3RL0D 1SFCD 1LT9A 1LTIC 2OYIA 3E1IC 1J1EC 2FFDA 3P8CE 1FZCA 3VP9A 1DX7A 2HPCA 2J64A 1G1JA 1PFIA 3RK2B 3M0DA 4GT1A 3RK3B 4I6MC 1GK4A 4JZCA 2XNXA 4DOJA 4N6JA 4N78D 2YKQA 4C7NA 3EQ2A 1ZLLA 3VP8A 3HE4B 3B5ND 5APSA 3L35A 2J3FD 2I1JA 1HGZA 3H32A 3UIAA 4N78E 4N3YB 4WY4B 4LC1A 1NOHA 1E5WA 2Q3IA 3TK1A 3L4FA 3NTNA 2IX7C 1SFCB 1J1DB 2Q9IC 2MJZA 3GHGB 1RE3B 1NTKK 1HUCA 1NKNA 1LTJA 1N73C 3KYQA 2P67A 4W7YA 1NO4A 2E42A 3B5NB 3V4WA 2HFED 1FDMA 5AW4B 2GUVA 1SP4A 1RE4B 2GM4A 2HG5D 1EQ7A 2R3CA 5CCHA 1RF1C 4KHXA 3OJAB 3SWYA 3V5BA 1X79B 1GL2C 2HLOB 1JY3N 1URQA 1KILD 2N1TC 5AVVB 1GU5A 2IPPA 4WB4A 2E43A 2YO2A 1H88A 1FZGC 1CI6B 5KJ7D 4W80A 1FZBA 1RF0C 4AYCA 3HE4A 1M1JB 1FZEC 2H43C 2A45H 3G3ZA 2Z4EA 1FOSE 3LIEA 1N7SD 1FIDA 4ZKPA 3H6PA 3N7NA 1LT9C 4RESB 1T2KC 2OYIC 2NPSD 2FFDC 4M3LA 1M7LA 2P1JA 2WITA 2W6BA 1FZCC 3GHGA 2HPCC 1A02J 3HUSA 1RE3A 1H8AA 5AW6B 2WNPF 3HE5B 5AVZB 3N4XA 1L4AB 1QL2A 1KILB 2XNXC 3TNUB 1KFMA 3WMM0 3B8EB 3FIBA 2YKPA 1IFDA 5CCGA 4ZFGA 1HH0A 4C46A 4HYTB 3B5NA 1FJPA 5BU5A 3H32C 3P7KA 3U1CA 2J59M 2O1KA 2J3FA 1FZDA 2D39A 5AVXB 1HWTC 1YTZI 1RE4A 2HODB 2L5GB 1FZAA 3P8CD 1H89A 2J1GA 2R5BA 1N86B 3OA7A 1JY2O 2NPSB 1GW4A 1W2EA 4B86A 2JHMF 4Y99C 1IFIA 3HD7C 3BVHC 2P2UA 1JO5A 3KPEA 1LTJC 1Z3SA 1CI6A 2WSCH 3L37A 1M1JA 2WPSA 4EIJA 2CPSA 1OWAA 3VMZA 2OARA 1LWUC 2WPRA 3CI9A 1FZFB 2J0HA 3PP5A 1J2JB 2H7HA 1JUNA 1NH4A 1L0LK 4XE5B 1NTMK 2QM7A 5AVSB 5CCHC 2C9LY 1FOSF 1OXZA 3MIWA 1SLQA 4M7FA 1CSBA 1URQC 3EFGA 2Q5UA 3HE5A 3RL0B 1L4AA 1GDTA 4IFDK 2N1TD 1KILA 1LGHB 2BASA 1SQVK 1FZBC 2OYHB 2CPBA 3NFQA 5CJ0A 4OH8B 2J58A 5KJ7A 2WPQA 4JYOX 1SQBK 1YTZT 5APUA 1GTWA 2C9NY 1KQLA 4I1LA 2Z4EC 2HODA 3VN0A 3OAKA 1NTZK 1FIBA 2M3BA 1N86A 3VOPA 1T8ZA 2IFMA 1J1DC 1JMMA 2NPSA 2J5ZA 2JHKF 5AW2B 2KLVA 2KB7P 3GHGC 3HUSC 1ZN5A 1L0NK 2XU6A 2J60A 2N1TB 1X9VA 5CCGC 4NYTA 1X8YA 2P7JA 3M9QA 1SVFA 5AVWB 3VMYA 3B5NC 3VYIA 3M0AA 1NAFA 1FZEB 1NHLA 5CHXA 4AQRD 1FZFA 1GU4A 2XDJA 1IFJA 1FZAC 1RY3A 5APQA 5APXA 4WY4A 4I2LC 2YO3A 4M7HA 3CL3D 5AVQB 2OYIB 2ZFCA 4IFFA 1SFCA 3HD7D 2J61B 1XTGB 1SQQK 2J0YA 1DH3A 2OYHA 2FYZA 1M1JC 3M0DC 1JOCA 3LW5H 1SQXK 3A7OA 2LKMA 1MFZA 1MUUA 2IFNA 5KLVK 1FU1A 2O01H 3IR9A 2M8RA 1CZQA 4GKGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q9I C;  1M1J A;  3GHG B;  1RE3 B;  1LWU C;  1LT9 B;  2HLO C;  1LTJ A;  2FFD B;  1FZF B;  2J0H A;  2Q9I A;  1FZC B;  1N73 C;  2HPC B;  3E1I B;  2HLO A;  2JHL F;  3BVH B;  2XNX B;  4M7F A;  2J0G A;  2A45 G;  1T3U A;  1N73 A;  1RE4 B;  2J3G A;  1RF1 C;  3H32 B;  1FZB C;  2OYH B;  2J3O A;  1LWU B;  2HOD C;  2HLO B;  1JY3 N;  2A45 I;  4JYO X;  1N86 C;  1RF1 A;  1JY2 N;  1FZG C;  2Z4E C;  1FZB A;  1RF0 C;  2HOD A;  1JY2 P;  1M1J B;  1FZE C;  2J61 A;  1FIB A;  2H43 C;  1JC9 A;  1N86 A;  2A45 H;  4R9T A;  1LTJ B;  2J5Z A;  1FZG A;  2JHK F;  2Z4E A;  1FIC A;  3GHG C;  2Q9I B;  3HUS C;  1RF0 A;  1FID A;  1FZE A;  2H43 A;  2FIB A;  1LT9 C;  1FZB B;  2OYI C;  1Z3U A;  2FFD C;  2J60 A;  1FZF C;  1FZC C;  2GY7 A;  2J3U A;  3GHG A;  4NYT A;  2HPC C;  3HUS A;  1RE3 A;  1JY3 P;  2JHI F;  2WNP F;  2Z4E B;  1N73 B;  1LT9 A;  2OYI A;  3E1I C;  2FFD A;  2XNX C;  1FZE B;  1FZF A;  1FZC A;  3FIB A;  2HPC A;  4ZFG A;  2J64 A;  1FZA C;  3E1I A;  3HUS B;  3BVH A;  3H32 C;  4JZC A;  2XNX A;  1RE3 C;  2OYH C;  1RF1 B;  2J3F A;  1FZD A;  4M7H A;  2OYI B;  2D39 A;  1RE4 A;  1JY3 O;  2HOD B;  1FZA A;  2J61 B;  2J1G A;  1N86 B;  4EPU A;  2J3F D;  2J0Y A;  1JY2 O;  3H32 A;  2OYH A;  1LWU A;  1FZG B;  1W2E A;  2JHM F;  1M1J C;  2J2P A;  1RF0 B;  3BVH C;  4R9J A;  2H43 B;  2JHH C;  1LTJ C;  1Z3S A;  1RE4 C;  1FZA B; 
#chains in the Genus database with same CATH topology
 3I5C A;  2W6A A;  2E76 B;  1JB0 J;  3L36 A;  3L74 J;  1IO4 A;  5APW A;  3MD0 A;  3KZI H;  1YJN P;  1UIX A;  5AW3 B;  3AE6 C;  1N7S B;  1KMI Z;  3C1L A;  4Y99 B;  2JDI H;  3E1I B;  2H89 C;  1HTL C;  1IFN A;  4XFJ A;  1G2C B;  3AED C;  1SQP J;  1YBK A;  1N86 C;  3CCL P;  3KXD A;  1L2P A;  1LNQ A;  4K3A A;  1L0L J;  2KS1 A;  5K5G B;  1U57 A;  3U59 A;  1GL2 D;  3RK3 C;  2QG4 A;  5KTB A;  1UII A;  1OMI A;  2WZ7 A;  2JHI F;  2FY8 A;  3G9R A;  4ZKU A;  3CCV P;  2NRG A;  4JPZ B;  3KHU A;  3V2N A;  1T2K D;  1JCD A;  5AVR B;  3D6Z A;  2IBZ I;  2Z5I A;  1FDI A;  3AE9 C;  3BVH A;  1RF1 B;  1H0T B;  3A3Y B;  3CCU P;  3H1I D;  1L0N J;  4EPU A;  2AXT H;  4JYC A;  2J2P A;  2JJL A;  1OVR A;  4R9J A;  1LTS C;  3HTK A;  3BAS A;  2K9Y A;  1BE3 D;  1LT9 B;  2HLO C;  2YMY A;  1QGK B;  1KFN A;  3AEA C;  3BRT B;  1KIL E;  1GD2 E;  3H25 A;  1LTB C;  5B66 H;  2R3S A;  2A45 G;  2YNY A;  1KZU B;  2QSI A;  1LTA C;  1IFM A;  1WT6 A;  2N9B A;  3H32 B;  3F89 A;  2WTY A;  4IFM A;  1VQ5 P;  3R2P A;  3SWF A;  1K73 Q;  5APT A;  1GL2 A;  2WSE J;  3RK3 D;  2KNC B;  3TGU J;  1DEE G;  3MP7 B;  1LTJ B;  1FZG A;  1ZOY C;  1FZE A;  3KDP B;  5AW0 B;  2H43 A;  1Z3U A;  1G1I A;  4HKZ H;  2WT7 A;  3L72 D;  5KLV D;  2K88 A;  3CWB G;  3G4S P;  4DZO A;  2B9B A;  4YXD C;  2WVR A;  3G71 P;  2QE7 H;  1LTI C;  2FFD A;  2V7Q H;  1VQ8 P;  2K37 A;  3M0D A;  5B5E H;  2ZT9 D;  1GK4 A;  3VMA A;  1KD1 Q;  3EQ2 A;  3VP8 A;  3FX0 A;  5CBN A;  4PD4 H;  3UIA A;  1PGP A;  2KUB A;  4LC1 A;  3JCU E;  1M57 D;  4I7Z C;  1KB9 I;  1YQ3 C;  4UB8 E;  4PD4 D;  1NTK K;  1NYH A;  3WUU A;  1N73 C;  3KYQ A;  5GTH E;  1SQV G;  1FDM A;  1SP4 A;  1EQ7 A;  2R3C A;  1NU1 D;  2AEM A;  1VF5 C;  1X79 B;  1CI6 B;  1NTK D;  1RF0 C;  1M1J B;  3D71 A;  1S2E A;  1S3J A;  3G3Z A;  1SQV E;  1EZV D;  3PH0 A;  1FID A;  4ZKP A;  3N7N A;  2OYI C;  2NPS D;  1FZC C;  1P84 H;  5KAI E;  2HPC C;  2KSE A;  1L4A B;  1PPJ D;  1QL2 A;  1KIL B;  3WMM 0;  3SWK A;  5CCG A;  4H13 D;  1HH0 A;  4C46 A;  4HYT B;  1JMB A;  1FJP A;  1X22 A;  2O1K A;  1P84 D;  2D39 A;  4PJ0 E;  1HWT C;  3S1K A;  2ZYA A;  1GW4 A;  1KN7 A;  3HD7 C;  1BGY J;  2FYU D;  3KPE A;  4MN4 C;  1Z3S A;  5KKZ B;  3CCQ P;  4OGQ C;  3L37 A;  2WPS A;  2QJK C;  1LWU C;  3OW2 O;  4KT0 J;  3PP5 A;  3KZI E;  1J2J B;  1L0L K;  4U3F J;  4NPD A;  5AVS B;  1FOS F;  1SLQ A;  1VF5 D;  1GDT A;  1M8O B;  4IFD K;  3AEG C;  2B88 A;  1FZB C;  2OYH B;  3NFQ A;  2K9J A;  3TF5 A;  4JYO X;  3F5H A;  1GTW A;  1KQL A;  2KZI A;  4I1L A;  2Z4E C;  1FS0 E;  1SQB J;  3VN0 A;  3H1I G;  1NTZ K;  3OAK A;  1JMM A;  2E74 C;  2NPS A;  1QVG O;  3CC7 P;  2JHK F;  2A06 D;  3HUS C;  4K35 A;  1L0N K;  1X9V A;  1X8Y A;  2P7J A;  1BE3 G;  1M90 Q;  3M9Q A;  5AVW B;  2KK7 A;  3E7K A;  3B5N C;  3VYI A;  3CD6 P;  1NAF A;  1FZF A;  5CHX A;  2XDJ A;  3H1I E;  2ZXX A;  1RY3 A;  3BCC D;  1VL2 A;  1NTZ D;  4A7P A;  1Y8A A;  3HD7 D;  1BE3 E;  2AXT E;  4OGQ D;  3LW5 H;  2IDB A;  3IN6 A;  2CK3 H;  1CZQ A;  2IZ1 A;  2E75 B;  3L75 D;  3M9H A;  3CCS P;  2LXB A;  3L72 G;  5KLV G;  1MFT A;  2G8Y A;  1KC8 Q;  1J1E B;  3BVH B;  1KYO H;  2B87 A;  2DW3 A;  3P8M C;  5KJ7 C;  1OVU A;  4R4L A;  5B66 E;  1QX8 A;  2KSJ A;  1YQ4 C;  1VQ7 P;  3RK3 E;  3H1J D;  5BU8 B;  2J3O A;  2HOD C;  4IL6 H;  5AW9 B;  3HTK B;  1KYO D;  1PGQ A;  1GW3 A;  3L72 E;  5L8R J;  5KLV E;  2J61 A;  2RH0 A;  4H0L C;  4NPE A;  2XZR A;  3TGU D;  1AQ5 A;  1FAV A;  1PV3 A;  2KLU A;  1D7M A;  1ZR2 A;  3O6Q A;  4LGD E;  1VQ4 P;  5AW5 B;  3SFE C;  1QEX A;  5KLI B;  3NXS A;  3CMA P;  2R32 A;  1KV4 A;  3CCE P;  3Q2Y A;  3HD7 A;  2C0X A;  2ITA A;  1RE3 C;  5B5E E;  1YI2 P;  5TJH A;  2WSF J;  1GK6 A;  2IYO A;  1GL2 B;  2K3R A;  3G6E P;  1NU1 G;  4PD4 E;  4QMA A;  1LWU A;  1FZG B;  4W7Z A;  2H43 B;  3V2R A;  4H44 C;  2WT7 B;  2I8D A;  1NTK G;  1S4X A;  1FZA B;  2ZJS E;  4ASW A;  2QJP C;  2FFD B;  1EZV G;  2Y0E A;  2QJY B;  5BVZ A;  2Q9I A;  3FWN A;  3CLQ A;  4L74 A;  1NU1 E;  1XTC C;  2O01 J;  4GIF A;  1Q81 Q;  1A02 F;  3V2Q A;  1MZ9 A;  1PPJ G;  1NTK E;  1K05 A;  4WVZ A;  5M1B A;  1JTH A;  4PV1 D;  1S1C X;  5DJT B;  2KZJ A;  2A45 I;  5CCH D;  1EZV E;  3M9B A;  1AQT A;  1HBW A;  2R5D A;  1JY2 P;  2YKO A;  3CCR P;  3D6Y A;  4XA4 A;  1PPJ E;  2D2C C;  2E76 C;  3LID A;  1YYC A;  2FYU G;  3H1H D;  4D6T D;  2GY7 A;  1N7S C;  2XKM A;  1IK9 A;  1P84 E;  1VQP P;  4KJM A;  3E1I C;  3VP9 A;  1OFC X;  2J64 A;  2AEF A;  2WMM A;  3RK3 B;  2XNX A;  2FYU E;  4N78 D;  2YKQ A;  4C7N A;  3CC4 P;  3V6I A;  4NPF X;  4H44 D;  4N3Y B;  1E5W A;  3TK1 A;  3NTN A;  1BCC D;  1BGY D;  2M0B A;  1J1D B;  1HF9 A;  2MJZ A;  4IL6 X;  3MUD C;  1KQF B;  2A06 G;  3FXE A;  1S5L H;  2ZT9 B;  3PHL A;  2JKV A;  4UB6 H;  2P67 A;  2E5Y A;  3RGU A;  2GUV A;  1OW6 A;  3A0H H;  2YXR B;  4TT3 H;  5CCH A;  1RF1 C;  3SWY A;  3V5B A;  2HLO B;  3BCC G;  2A06 E;  1NTZ G;  2E43 A;  3AE1 C;  1H88 A;  2WPV B;  4W80 A;  2D2C D;  3AE8 C;  2W6J H;  1W2B O;  2FYN B;  2RN0 A;  3LIE A;  1N7S D;  3AEC C;  3H6P A;  1LT9 C;  4RES B;  4M3L A;  1M7L A;  3L73 D;  5E79 H;  3BCC E;  3GHG A;  1NTZ E;  1RE3 A;  5AVZ B;  1PP9 D;  3QH9 A;  3R4Y A;  3WU2 H;  3L75 G;  1KFM A;  1IFD A;  2M5A A;  3W67 A;  3CWB J;  2K9J B;  1AA0 A;  3H32 C;  3U1C A;  1FZD A;  1FZA A;  1H89 A;  3H1J G;  3H1K D;  2WSC J;  2NPS B;  4B86 A;  2JHM F;  3PTZ A;  2O01 N;  1IFI A;  4DT0 A;  2ZVO B;  3L75 E;  1LTJ C;  3ZDM A;  2CPS A;  3VMZ A;  3TGU G;  4H13 B;  1FZF B;  2JWA A;  3H1J E;  1NH4 A;  4XE5 B;  1Q86 Q;  1NTM K;  3MIW A;  4M7F A;  1KYO E;  1URQ C;  2Q5U A;  3HE5 A;  3RL0 B;  4YXW H;  2SPZ A;  1LGH B;  4DJG A;  1YHQ P;  3L71 D;  3TGU E;  1SQV J;  2WPQ A;  4IL6 E;  1NVO A;  1U7M A;  3Q1M A;  1W5C E;  1FIB A;  2M3B A;  1EXJ A;  1N86 A;  1R5L A;  3VOP A;  3I55 P;  2BCC D;  2KLV A;  1NTM D;  1ZN5 A;  1VF5 B;  2XU6 A;  2BEQ D;  2B87 B;  4NYT A;  3H1L D;  1SVF A;  1NHL A;  2KXP B;  3E1R A;  3CCJ P;  3IAO A;  1S5L X;  2OYI B;  4L75 A;  3GLM A;  2J61 B;  1XTG B;  1SQQ K;  4BXL A;  1DH3 A;  1ZME C;  2FYZ A;  1M1J C;  2QA4 P;  3CXH H;  1FU1 A;  2O01 H;  3O6Q B;  2E5T A;  4GKG A;  1LT1 A;  3SFD C;  5AVU B;  1LTT C;  1M56 D;  3S4R A;  1WRG A;  1YJW P;  4L73 A;  3MTU E;  5CJ4 A;  3CXH D;  1L4A C;  1URQ D;  1KIL C;  3H1H G;  1CW5 A;  4D6T G;  2HLO A;  3HD7 B;  2JHL F;  3USS A;  1EDL A;  1SQQ D;  4YTP C;  4OGQ B;  4Z1M H;  1SQP K;  2OQQ A;  1AFO A;  2QJK B;  4WBA A;  1OW8 A;  3MZW B;  1LWU B;  3EWK A;  1PZQ A;  2Q7C A;  3L74 D;  3SSU A;  3TSI A;  1IK7 A;  1DD3 A;  3H1H E;  4AUW A;  4D6T E;  1JC9 A;  5AVT B;  3RK2 C;  5AVY B;  2Q9I B;  1FC2 C;  5KAF H;  1FZB B;  1BCC G;  1BGY G;  3H1I J;  1FJK A;  1SQP D;  4EYY Q;  1JY3 P;  3NMD A;  1AVO A;  2Z4E B;  4WY4 C;  3CX5 H;  5AW1 B;  1JTH B;  1SFC C;  4PD4 I;  1L0L D;  3EFF K;  1BE3 J;  2LR2 A;  2ZVN B;  3HUS B;  3T97 A;  2OYH C;  3AE3 C;  5CBO A;  1BCC E;  1BGY E;  2I1K A;  3CX5 D;  2Q6Q A;  1ZRT D;  1IC2 A;  1YJ9 P;  2Z5H A;  1N8R Q;  3Q5S A;  2WWW A;  1PGJ A;  3ITK A;  1FBM A;  1NWQ A;  2JHH C;  5AW7 B;  1RE4 C;  2H8P D;  2PP6 A;  2KI7 B;  1PGO A;  1L4A D;  1N2D C;  3JC2 2;  1S5L E;  3BRV B;  1K04 A;  4UB6 E;  3L73 G;  2IYP A;  1L0N D;  1VQK P;  1GMJ A;  2XNX B;  2M3E A;  1EZV I;  4RKU J;  4C7N B;  1T3U A;  1N73 A;  1SQX J;  1PP9 G;  2P10 A;  2J3G A;  3VMX A;  3L72 J;  5KLV J;  1LTG C;  4JYB A;  3A0H E;  1N7L A;  5APV A;  2QVA A;  3V2P A;  3RL0 g;  4JF7 A;  1S9K D;  3A5T A;  4L76 A;  4EOT A;  2FXO A;  1MKM A;  1Y9B A;  3RK2 D;  3L73 E;  2C0W A;  1QL1 A;  1KQG B;  2GUS A;  3H1K G;  1QVF O;  5DJU B;  1P84 I;  1PP9 E;  1RF0 A;  2FXM A;  2FKW B;  2WSE H;  2FIB A;  3QWO C;  3GF3 A;  2E75 C;  1Z56 A;  1GZL A;  4WY4 D;  2JO1 A;  2J3U A;  2L91 A;  5E79 E;  4PV1 B;  4JBZ A;  1SFC D;  2E74 D;  2OYI A;  1J1E C;  3H1K E;  1FZC A;  3WU2 E;  2HPC A;  1G1J A;  1PFI A;  4HB1 A;  1VQL P;  3CWB D;  2YIU C;  4I6M C;  1S72 P;  2O3J A;  4JZC A;  1ZLL A;  3B5N D;  2J3F D;  3L35 A;  3JSV C;  3L71 G;  1RHZ B;  1NOH A;  2OYO A;  2IX7 C;  3ABV C;  1NU1 J;  2QIW A;  3L70 J;  3CME P;  3GHG B;  1RE3 B;  2IBZ D;  1NKN A;  2BCC G;  5KLI C;  1NTM G;  2PFX A;  1NTK J;  2V4H A;  2M5A B;  4W7Y A;  3L71 E;  1NO4 A;  2E42 A;  2HFE D;  3H1L G;  4H44 B;  3RBZ A;  2GM4 A;  3IF4 A;  2XND H;  2ZYD A;  3OJA B;  2QJP B;  4IOI H;  1FDO A;  1GL2 C;  2BCC E;  1JY3 N;  2N1T C;  1NTM E;  2JP3 A;  4WB4 A;  2YO2 A;  1FZG C;  1NJI Q;  1OZH A;  5KJ7 D;  1FZB A;  4EDF A;  4AYC A;  3HE4 A;  1FZE C;  2H43 C;  3H1L E;  2Z4E A;  1Q7Y Q;  1EDK A;  1LP1 A;  1T2K C;  1EC5 A;  2FFD C;  2BEZ F;  2WIT A;  4GOF A;  1A02 J;  3HUS A;  4H0L D;  1H8A A;  1BDD A;  3HE5 B;  2FYU J;  2W8Z A;  3TNU B;  3B8E B;  2YKP A;  4RO0 A;  4ZFG A;  1RQU A;  2D2C B;  3B5N A;  3P7K A;  2J59 M;  1SQQ G;  2J3F A;  5AVX B;  4ZMD A;  1YTZ I;  1RE4 A;  3WUT A;  3P8C D;  2R5B A;  1N86 B;  1W2E A;  4Y99 C;  4BRY A;  3L74 G;  1T6A A;  2AXC A;  2P2U A;  1PL5 A;  3CXH E;  4EIJ A;  1KTM A;  1NGM B;  1OWA A;  1SQQ E;  2WPR A;  3CC2 P;  1KYO I;  3CI9 A;  1KB9 H;  1VQN P;  2R44 A;  2C9L Y;  3W68 A;  1SQP G;  1OXZ A;  4WWI A;  3L74 E;  3I56 P;  2JR8 A;  3EFG A;  2N1T D;  3WUV A;  1KB9 D;  4BWN A;  2CPB A;  1USE A;  1L0L G;  4OH8 B;  5KJ7 A;  1SQB K;  2C9N Y;  2Y9Y A;  1KQS O;  2HOD A;  1RQV A;  4TLF A;  4U3F D;  1SQP E;  2UWJ E;  1T8Z A;  3RBX A;  2IFM A;  3BCC J;  3PRJ A;  1J1D C;  1NTZ J;  2KB7 P;  3A0B H;  2IZ0 A;  5C39 A;  5KAF E;  2J60 A;  3AEB C;  1L0L E;  2ZT9 C;  2JWD A;  5CCG C;  2E76 D;  4AQR D;  1SQB D;  3CX5 E;  1ZRT E;  1IFJ A;  1L0N G;  5APQ A;  4U7J A;  4I2L C;  1Q90 D;  3CL3 D;  2ZFC A;  3LW5 J;  3L75 J;  4IFF A;  1RH5 B;  2PRR A;  5GTI H;  2J0Y A;  1JOC A;  1SQX K;  2LKM A;  2IFN A;  1MUU A;  5KLV K;  3PJS K;  3H1J J;  2M8R A;  2FYN C;  1L0N E;  2HR3 A;  1OW7 A;  5TIS H;  1EDJ A;  1JCC A;  1MV8 A;  3D70 A;  1HGV A;  1S9K E;  3CCM P;  1OX3 A;  1DIP A;  1X0T A;  2N1T A;  3T97 B;  2OTL P;  2OTJ P;  2J0G A;  2K1A A;  3II6 A;  1SQX D;  3CPW O;  3O8Z A;  3M91 A;  3VTP C;  1BDC A;  2W27 A;  2RMZ A;  2JEE A;  2NPS C;  1OVV A;  1JY2 N;  4GDO A;  2KYV A;  1NKZ B;  2LXC B;  4OVN F;  3A2A A;  1URQ B;  4I7Z B;  1Y47 A;  1VDF A;  5CCG D;  3AE5 C;  3TNU A;  4H13 C;  2OGU A;  3TDK A;  1VQ9 P;  2Y9Z A;  4LLH A;  1FZF C;  5H2F H;  3CWB E;  1EXI A;  1K8A Q;  3U1A A;  2IBZ G;  4HH2 A;  1N73 B;  2WQY C;  4JQ0 D;  1VQO P;  3AE4 C;  1NU1 K;  2OTK E;  1N7S A;  3RL0 C;  2YMK A;  1HJB A;  3E1I A;  5APY A;  1Q2N A;  1KOR A;  3HRN A;  3V4Q A;  1JY3 O;  2QM8 A;  1G2C A;  2O1J A;  2KP8 A;  3TYY A;  2IBZ E;  1QLE D;  2WSF H;  5AW8 B;  1HVV A;  3KQG A;  1RF0 B;  2Q1K A;  2VRS A;  3P32 A;  1PIX A;  1BSN A;  3GG2 A;  1NAY A;  3C8V A;  1VPC A;  2POH A;  1ZV8 A;  1DEB A;  2HYN A;  3L70 D;  1WMK A;  1DD4 A;  2XV5 A;  1JNM A;  1FZC B;  1USD A;  2HPC B;  4C7R A;  1IZN B;  1T3J A;  3MUD A;  2PAJ A;  2ZAE B;  4HJG H;  4O9B A;  1IJD B;  2WSS H;  3BAT A;  5CMZ A;  2G3A A;  3H1H J;  4D6T J;  1VQM P;  1U7J A;  2FYU K;  3C9I A;  2J5U A;  3MGN A;  1RF1 A;  2ZXE B;  1H0T A;  1ZP0 C;  1IFP A;  3GMA A;  4R9T A;  3M06 A;  4R4M A;  1FIC A;  3AEF C;  1ZR4 A;  2QRX A;  2P58 A;  3IFM A;  2ZYG A;  1JEK A;  1R5S A;  2KOG A;  3RL0 D;  1LT9 A;  1BCC J;  3FGA D;  3MHV A;  3P8C E;  1DX7 A;  4ZNC A;  5KKZ C;  3RK2 B;  4GT1 A;  2FBW C;  4DOJ A;  4N6J A;  2Y0C A;  1ZXG A;  3HE4 B;  2PGD A;  5APS A;  2I1J A;  1HGZ A;  3H32 A;  1YIJ P;  4YPC A;  4N78 E;  4WY4 B;  4CPG A;  3B71 A;  5EFW B;  1LP1 B;  2Q3I A;  3L4F A;  4Y28 J;  1AV1 A;  1SFC B;  3Q5R A;  2E74 B;  1TU3 F;  3B4S A;  2Q9I C;  4U3F G;  2KNC A;  3S9O A;  1HUC A;  1LTJ A;  1M1K Q;  3K5B A;  1KB9 E;  3B5N B;  3V4W A;  2NZ2 A;  2Q3E A;  5AW4 B;  3FWL A;  1LJ2 A;  1RE4 B;  2HG5 D;  1SQB G;  1Q82 Q;  3L73 J;  4U3F E;  4KHX A;  2QEX P;  1URQ A;  1KIL D;  4BRY B;  5AVV B;  1GU5 A;  2IPP A;  1PP9 J;  1OIP A;  2YXQ B;  2A45 H;  1K9M Q;  1FOS E;  2H88 C;  1SQB E;  3A0B E;  3H1K J;  2P1J A;  2W6B A;  1EDI A;  2KS1 B;  2RKL A;  5AW6 B;  2WNP F;  3N4X A;  4RJT A;  2XNX C;  4GOE A;  3FIB A;  2MKV A;  1SS1 A;  3Q3D A;  4GOD A;  5BU5 A;  2N9Y B;  3CXH I;  2HOD B;  2L5G B;  1JM0 A;  1SQX G;  2V7Q J;  2J1G A;  3OA7 A;  4EI2 A;  1JY2 O;  5GTI E;  3JCU H;  2B89 A;  3BVH C;  1JO5 A;  2AEJ A;  4H0L B;  3GF7 A;  1CI6 A;  2KIK A;  2WSC H;  2YIU B;  3L71 J;  4UB8 H;  1M1J A;  4DCK A;  2OAR A;  4OWF A;  2W83 C;  2J0H A;  4PV1 C;  5TIS E;  1SQX E;  5GTH H;  2H7H A;  1JUN A;  2QM7 A;  5CCH C;  1YIT P;  3AE7 C;  3PLN A;  2BCC J;  1NTM J;  1CSB A;  1L4A A;  1KIL A;  2BAS A;  1SQV K;  5CJ0 A;  2J58 A;  3H1L J;  1YTZ T;  5APU A;  3AE2 C;  1VQ6 P;  1FE6 A;  1R8E A;  3GW6 A;  1HJ0 A;  2J5Z A;  5AW2 B;  3GHG C;  1E79 H;  2GA1 A;  3CX5 I;  1AVY A;  5KAI H;  2N1T B;  3L70 G;  5H2F E;  1SQV D;  3VMY A;  3M0A A;  3Q5P A;  1FZE B;  2W90 A;  1GU4 A;  1ZW0 A;  2E75 D;  1FZA C;  5APX A;  4WY4 A;  4ASV A;  2YO3 A;  1BSH A;  4M7H A;  2FXP A;  2Y0D A;  4PJ0 H;  1AJY A;  5AVQ B;  3AEE C;  3FXD A;  1SFC A;  2QJY C;  3L70 E;  2OYH A;  3M0D C;  1SQQ J;  3A7O A;  1MFZ A;  3IR9 A; 
#chains in the Genus database with same CATH homology
 3I5C A;  2W6A A;  5AVU B;  3L36 A;  1LTT C;  1IO4 A;  5APW A;  3MD0 A;  1WRG A;  1JCC A;  1MV8 A;  5AW3 B;  3MTU E;  1HGV A;  5CJ4 A;  1N7S B;  3M9H A;  1L4A C;  1URQ D;  1S9K E;  1KIL C;  1CW5 A;  4Y99 B;  3E1I B;  2HLO A;  1J1E B;  3HD7 B;  2JHL F;  2N1T A;  3BVH B;  1HTL C;  3P8M C;  5KJ7 C;  2J0G A;  1IFN A;  3II6 A;  1G2C B;  1SQP K;  2KSJ A;  1AFO A;  5BU8 B;  4WBA A;  3O8Z A;  3M91 A;  1LWU B;  2J3O A;  2HOD C;  3VTP C;  2W27 A;  1N86 C;  2Q7C A;  5AW9 B;  2JEE A;  3HTK B;  2NPS C;  1JY2 N;  3TSI A;  2KYV A;  1GW3 A;  1NKZ B;  2J61 A;  4AUW A;  1JC9 A;  5AVT B;  2XZR A;  3A2A A;  1URQ B;  1AQ5 A;  1FAV A;  3RK2 C;  5AVY B;  3U59 A;  1GL2 D;  1VDF A;  3RK3 C;  2Q9I B;  5CCG D;  5KTB A;  3TNU A;  1FZB B;  1ZR2 A;  4LGD E;  4LLH A;  1FZF C;  5AW5 B;  1FJK A;  2WZ7 A;  3NXS A;  3U1A A;  1JY3 P;  3NMD A;  2JHI F;  2Z4E B;  4HH2 A;  1N73 B;  2R32 A;  4WY4 C;  4ZKU A;  1NU1 K;  5AW1 B;  1JTH B;  3V2N A;  1N7S A;  3RL0 C;  1T2K D;  1HJB A;  1SFC C;  1JCD A;  5AVR B;  2Z5I A;  3E1I A;  3HD7 A;  3HUS B;  3BVH A;  2C0X A;  5APY A;  1RE3 C;  3T97 A;  1RF1 B;  2OYH C;  1GK6 A;  3HRN A;  3A3Y B;  3V4Q A;  1JY3 O;  2QM8 A;  1G2C A;  1GL2 B;  2O1J A;  2I1K A;  4EPU A;  1IC2 A;  2KP8 A;  3TYY A;  2Z5H A;  1LWU A;  1FZG B;  2WWW A;  4JYC A;  2WSF H;  5AW8 B;  2J2P A;  1HVV A;  4W7Z A;  1FBM A;  3KQG A;  1RF0 B;  2VRS A;  2JJL A;  3P32 A;  1NWQ A;  4R9J A;  1LTS C;  3V2R A;  2JHH C;  2H43 B;  3HTK A;  3BAS A;  2WT7 B;  5AW7 B;  1RE4 C;  1VPC A;  1FZA B;  2POH A;  1ZV8 A;  2H8P D;  2PP6 A;  1DEB A;  2HYN A;  1L4A D;  1LT9 B;  2HLO C;  2FFD B;  2XV5 A;  2YMY A;  1N2D C;  5BVZ A;  1JNM A;  2Q9I A;  1FZC B;  3CLQ A;  3BRV B;  1KFN A;  1XTC C;  4GIF A;  2HPC B;  4C7R A;  3BRT B;  1T3J A;  3MUD A;  1A02 F;  2PAJ A;  1GD2 E;  2XNX B;  1LTB C;  4O9B A;  4C7N B;  1IJD B;  2A45 G;  2YNY A;  1KZU B;  1T3U A;  1MZ9 A;  3V2Q A;  1N73 A;  1LTA C;  3BAT A;  5CMZ A;  2J3G A;  1IFM A;  3VMX A;  1WT6 A;  1LTG C;  4JYB A;  1JTH A;  2N9B A;  1N7L A;  3H32 B;  5APV A;  3V2P A;  4JF7 A;  1S9K D;  3A5T A;  2WTY A;  4EOT A;  2A45 I;  2FYU K;  5CCH D;  4IFM A;  3C9I A;  3M9B A;  3R2P A;  3MGN A;  3SWF A;  1RF1 A;  1HBW A;  2ZXE B;  3RK2 D;  5APT A;  2R5D A;  2C0W A;  1JY2 P;  1GL2 A;  1QL1 A;  3RK3 D;  2GUS A;  2YKO A;  4R9T A;  1LTJ B;  1FZG A;  4XA4 A;  3M06 A;  1FIC A;  3LID A;  1RF0 A;  1YYC A;  2FKW B;  2FXM A;  1ZR4 A;  1FZE A;  2WSE H;  3KDP B;  5AW0 B;  2H43 A;  1Z3U A;  2FIB A;  1G1I A;  1Z56 A;  1GZL A;  2WT7 A;  4WY4 D;  3IFM A;  2GY7 A;  2J3U A;  1N7S C;  2XKM A;  4DZO A;  1IK9 A;  2KOG A;  3RL0 D;  1SFC D;  1LT9 A;  1LTI C;  2OYI A;  3E1I C;  1J1E C;  2FFD A;  3P8C E;  1FZC A;  3VP9 A;  1DX7 A;  2HPC A;  2J64 A;  1G1J A;  1PFI A;  3RK2 B;  3M0D A;  4GT1 A;  3RK3 B;  4I6M C;  1GK4 A;  4JZC A;  2XNX A;  4DOJ A;  4N6J A;  4N78 D;  2YKQ A;  4C7N A;  3EQ2 A;  1ZLL A;  3VP8 A;  3HE4 B;  3B5N D;  5APS A;  3L35 A;  2J3F D;  2I1J A;  1HGZ A;  3H32 A;  3UIA A;  4N78 E;  4N3Y B;  4WY4 B;  4LC1 A;  1NOH A;  1E5W A;  2Q3I A;  3TK1 A;  3L4F A;  3NTN A;  2IX7 C;  1SFC B;  1J1D B;  2Q9I C;  2MJZ A;  3GHG B;  1RE3 B;  1NTK K;  1HUC A;  1NKN A;  1LTJ A;  1N73 C;  3KYQ A;  2P67 A;  4W7Y A;  1NO4 A;  2E42 A;  3B5N B;  3V4W A;  2HFE D;  1FDM A;  5AW4 B;  2GUV A;  1SP4 A;  1RE4 B;  2GM4 A;  2HG5 D;  1EQ7 A;  2R3C A;  5CCH A;  1RF1 C;  4KHX A;  3OJA B;  3SWY A;  3V5B A;  1X79 B;  1GL2 C;  2HLO B;  1JY3 N;  1URQ A;  1KIL D;  2N1T C;  5AVV B;  1GU5 A;  2IPP A;  4WB4 A;  2E43 A;  2YO2 A;  1H88 A;  1FZG C;  1CI6 B;  5KJ7 D;  4W80 A;  1FZB A;  1RF0 C;  4AYC A;  3HE4 A;  1M1J B;  1FZE C;  2H43 C;  2A45 H;  3G3Z A;  2Z4E A;  1FOS E;  3LIE A;  1N7S D;  1FID A;  4ZKP A;  3H6P A;  3N7N A;  1LT9 C;  4RES B;  1T2K C;  2OYI C;  2NPS D;  2FFD C;  4M3L A;  1M7L A;  2P1J A;  2WIT A;  2W6B A;  1FZC C;  3GHG A;  2HPC C;  1A02 J;  3HUS A;  1RE3 A;  1H8A A;  5AW6 B;  2WNP F;  3HE5 B;  5AVZ B;  3N4X A;  1L4A B;  1QL2 A;  1KIL B;  2XNX C;  3TNU B;  1KFM A;  3WMM 0;  3B8E B;  3FIB A;  2YKP A;  1IFD A;  5CCG A;  4ZFG A;  1HH0 A;  4C46 A;  4HYT B;  3B5N A;  1FJP A;  5BU5 A;  3H32 C;  3P7K A;  3U1C A;  2J59 M;  2O1K A;  2J3F A;  1FZD A;  2D39 A;  5AVX B;  1HWT C;  1YTZ I;  1RE4 A;  2HOD B;  2L5G B;  1FZA A;  3P8C D;  1H89 A;  2J1G A;  2R5B A;  1N86 B;  3OA7 A;  1JY2 O;  2NPS B;  1GW4 A;  1W2E A;  4B86 A;  2JHM F;  4Y99 C;  1IFI A;  3HD7 C;  3BVH C;  2P2U A;  1JO5 A;  3KPE A;  1LTJ C;  1Z3S A;  1CI6 A;  2WSC H;  3L37 A;  1M1J A;  2WPS A;  4EIJ A;  2CPS A;  1OWA A;  3VMZ A;  2OAR A;  1LWU C;  2WPR A;  3CI9 A;  1FZF B;  2J0H A;  3PP5 A;  1J2J B;  2H7H A;  1JUN A;  1NH4 A;  1L0L K;  4XE5 B;  1NTM K;  2QM7 A;  5AVS B;  5CCH C;  2C9L Y;  1FOS F;  1OXZ A;  3MIW A;  1SLQ A;  4M7F A;  1CSB A;  1URQ C;  3EFG A;  2Q5U A;  3HE5 A;  3RL0 B;  1L4A A;  1GDT A;  4IFD K;  2N1T D;  1KIL A;  1LGH B;  2BAS A;  1SQV K;  1FZB C;  2OYH B;  2CPB A;  3NFQ A;  5CJ0 A;  4OH8 B;  2J58 A;  5KJ7 A;  2WPQ A;  4JYO X;  1SQB K;  1YTZ T;  5APU A;  1GTW A;  2C9N Y;  1KQL A;  4I1L A;  2Z4E C;  2HOD A;  3VN0 A;  3OAK A;  1NTZ K;  1FIB A;  2M3B A;  1N86 A;  3VOP A;  1T8Z A;  2IFM A;  1J1D C;  1JMM A;  2NPS A;  2J5Z A;  2JHK F;  5AW2 B;  2KLV A;  2KB7 P;  3GHG C;  3HUS C;  1ZN5 A;  1L0N K;  2XU6 A;  2J60 A;  2N1T B;  1X9V A;  5CCG C;  4NYT A;  1X8Y A;  2P7J A;  3M9Q A;  1SVF A;  5AVW B;  3VMY A;  3B5N C;  3VYI A;  3M0A A;  1NAF A;  1FZE B;  1NHL A;  5CHX A;  4AQR D;  1FZF A;  1GU4 A;  2XDJ A;  1IFJ A;  1FZA C;  1RY3 A;  5APQ A;  5APX A;  4WY4 A;  4I2L C;  2YO3 A;  4M7H A;  3CL3 D;  5AVQ B;  2OYI B;  2ZFC A;  4IFF A;  1SFC A;  3HD7 D;  2J61 B;  1XTG B;  1SQQ K;  2J0Y A;  1DH3 A;  2OYH A;  2FYZ A;  1M1J C;  3M0D C;  1JOC A;  3LW5 H;  1SQX K;  3A7O A;  2LKM A;  1MFZ A;  1MUU A;  2IFN A;  5KLV K;  1FU1 A;  2O01 H;  3IR9 A;  2M8R A;  1CZQ A;  4GKG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...