2J3FA

L-ficolin complexed to n-acetyl-d-galactosamine
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
219
structure length
218
Chain Sequence
PQPCLTGPRTCKDLLDRGHFLSGWHTIYLPDCRPLTVLCDMDTDGGGWTVFQRRVDGSVDFYRDWATYKQGFGSRLGEFWLGNDNIHALTAQGTSELRTDLVDFEDNYQFAKYRSFKVADEAEKYNLVLGAFVEGSAGDSLTFHNNQSFSTKDQDNDLNTGNCAVMFQGAWWYNCHTSNLNGRYLRGTHGSFANGINWKSGKGYNYSYKVSEMKVRPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords FICOLIN-2
publication title Structural Insights Into the Innate Immune Recognition Specificities of L- and H-Ficolins.
pubmed doi rcsb
source organism Homo sapiens
total genus 46
structure length 218
sequence length 219
chains with identical sequence B, C, E, F
ec nomenclature
pdb deposition date 2006-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 2j3fA01
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 2j3fA02
1FIBA 2HPCB 1LT9B 2OYIB 1LTJB 1RF0B 1Z3SA 2XNXB 2OYHC 1N86C 2J0HA 2WNPF 2J3UA 1N73B 2J3GA 2J61B 2FFDB 1FZDA 2J3OA 1FZAC 3HUSC 1JC9A 2Q9IC 2J60A 1RE3B 1FZFB 4M7FA 1M1JC 2HODC 1FZBB 1RE4C 1FZCB 1LTJC 2J3FD 3E1IC 2J61A 2J5ZA 1RF1C 1FZGC 2J2PA 2OYHB 1FIDA 1N86B 3BVHC 1FZEC 4NYTA 3H32B 2J64A 3GHGC 2D39A 1LWUB 2J0GA 2HLOB 2H43B 2HPCC 2J3FA 1FZAB 3HUSB 1LT9C 2OYIC 2Z4EB 1RF0C 2Q9IB 2XNXC 2GY7A 1Z3UA 4JZCA 4ZFGA 1N73C 2JHKF 1M1JB 2HODB 2JHMF 2FFDC 1RE4B 2J0YA 4JYOX 3FIBA 4M7HA 2JHLF 3E1IB 4EPUA 2FIBA 1RF1B 1FICA 3H32C 1FZGB 2J1GA 1LWUC 1RE3C 1FZFC 2HLOC 2H43C 3BVHB 1FZEB 2JHHC 1FZBC 2JHIF 4R9JA 1FZCC 4R9TA 2Z4EC
chains in the Genus database with same CATH superfamily
1FIBA 2HPCB 1LT9B 2OYIB 1LTJB 1RF0B 1Z3SA 2XNXB 2OYHC 1N86C 2J0HA 2WNPF 2J3UA 1N73B 2J3GA 2J61B 2FFDB 1FZDA 2J3OA 1FZAC 3HUSC 1JC9A 2Q9IC 2J60A 1RE3B 1FZFB 4M7FA 1M1JC 2HODC 1FZBB 1RE4C 1FZCB 1LTJC 2J3FD 3E1IC 2J61A 2J5ZA 1RF1C 1FZGC 2J2PA 2OYHB 1FIDA 1N86B 3BVHC 1FZEC 4NYTA 3H32B 2J64A 3GHGC 2D39A 1LWUB 2J0GA 2HLOB 2H43B 2HPCC 2J3FA 1FZAB 3HUSB 1LT9C 2OYIC 2Z4EB 1RF0C 2Q9IB 2XNXC 2GY7A 1Z3UA 4JZCA 4ZFGA 1N73C 2JHKF 1M1JB 2HODB 2JHMF 2FFDC 1RE4B 2J0YA 4JYOX 3FIBA 4M7HA 2JHLF 3E1IB 4EPUA 2FIBA 1RF1B 1FICA 3H32C 1FZGB 2J1GA 1LWUC 1RE3C 1FZFC 2HLOC 2H43C 3BVHB 1FZEB 2JHHC 1FZBC 2JHIF 3GHGB 4R9JA 1FZCC 4R9TA 2Z4EC
chains in the Genus database with same CATH topology
1FIBA 2HPCB 1LT9B 2OYIB 1LTJB 1RF0B 1Z3SA 2XNXB 2OYHC 1N86C 2J0HA 2WNPF 2J3UA 1N73B 2J3GA 2J61B 2FFDB 1FZDA 2J3OA 1FZAC 3HUSC 1JC9A 2Q9IC 2J60A 1RE3B 1FZFB 4M7FA 1M1JC 2HODC 1FZBB 1RE4C 1FZCB 1LTJC 2J3FD 3E1IC 2J61A 2J5ZA 1RF1C 1FZGC 2J2PA 2OYHB 1FIDA 1N86B 3BVHC 1FZEC 4NYTA 3H32B 2J64A 3GHGC 2D39A 1LWUB 2J0GA 2HLOB 2H43B 2HPCC 2J3FA 1FZAB 3HUSB 1LT9C 2OYIC 2Z4EB 1RF0C 2Q9IB 2XNXC 2GY7A 1Z3UA 4JZCA 4ZFGA 1N73C 2JHKF 1M1JB 2HODB 2JHMF 2FFDC 1RE4B 2J0YA 4JYOX 3FIBA 4M7HA 2JHLF 3E1IB 4EPUA 2FIBA 1RF1B 1FICA 3H32C 1FZGB 2J1GA 1LWUC 1RE3C 1FZFC 2HLOC 2H43C 3BVHB 1FZEB 2JHHC 1FZBC 2JHIF 4R9JA 1FZCC 4R9TA 2Z4EC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FIB A;  2HPC B;  1LT9 B;  2OYI B;  1LTJ B;  1RF0 B;  1Z3S A;  2XNX B;  2OYH C;  1N86 C;  2J0H A;  2WNP F;  2J3U A;  1N73 B;  2J3G A;  2J61 B;  2FFD B;  1FZD A;  2J3O A;  1FZA C;  3HUS C;  1JC9 A;  2Q9I C;  2J60 A;  1RE3 B;  1FZF B;  4M7F A;  1M1J C;  2HOD C;  1FZB B;  1RE4 C;  1FZC B;  1LTJ C;  2J3F D;  3E1I C;  2J61 A;  2J5Z A;  1RF1 C;  1FZG C;  2J2P A;  2OYH B;  1FID A;  1N86 B;  3BVH C;  1FZE C;  4NYT A;  3H32 B;  2J64 A;  3GHG C;  2D39 A;  1LWU B;  2J0G A;  2HLO B;  2H43 B;  2HPC C;  2J3F A;  1FZA B;  3HUS B;  1LT9 C;  2OYI C;  2Z4E B;  1RF0 C;  2Q9I B;  2XNX C;  2GY7 A;  1Z3U A;  4JZC A;  4ZFG A;  1N73 C;  2JHK F;  1M1J B;  2HOD B;  2JHM F;  2FFD C;  1RE4 B;  2J0Y A;  4JYO X;  3FIB A;  4M7H A;  2JHL F;  3E1I B;  4EPU A;  2FIB A;  1RF1 B;  1FIC A;  3H32 C;  1FZG B;  2J1G A;  1LWU C;  1RE3 C;  1FZF C;  2HLO C;  2H43 C;  3BVH B;  1FZE B;  2JHH C;  1FZB C;  2JHI F;  4R9J A;  1FZC C;  4R9T A;  2Z4E C; 
#chains in the Genus database with same CATH topology
 1FIB A;  2HPC B;  1LT9 B;  2OYI B;  1LTJ B;  1RF0 B;  1Z3S A;  2XNX B;  2OYH C;  1N86 C;  2J0H A;  2WNP F;  2J3U A;  1N73 B;  2J3G A;  2J61 B;  2FFD B;  1FZD A;  2J3O A;  1FZA C;  3HUS C;  1JC9 A;  2Q9I C;  2J60 A;  1RE3 B;  1FZF B;  4M7F A;  1M1J C;  2HOD C;  1FZB B;  1RE4 C;  1FZC B;  1LTJ C;  2J3F D;  3E1I C;  2J61 A;  2J5Z A;  1RF1 C;  1FZG C;  2J2P A;  2OYH B;  1FID A;  1N86 B;  3BVH C;  1FZE C;  4NYT A;  3H32 B;  2J64 A;  3GHG C;  2D39 A;  1LWU B;  2J0G A;  2HLO B;  2H43 B;  2HPC C;  2J3F A;  1FZA B;  3HUS B;  1LT9 C;  2OYI C;  2Z4E B;  1RF0 C;  2Q9I B;  2XNX C;  2GY7 A;  1Z3U A;  4JZC A;  4ZFG A;  1N73 C;  2JHK F;  1M1J B;  2HOD B;  2JHM F;  2FFD C;  1RE4 B;  2J0Y A;  4JYO X;  3FIB A;  4M7H A;  2JHL F;  3E1I B;  4EPU A;  2FIB A;  1RF1 B;  1FIC A;  3H32 C;  1FZG B;  2J1G A;  1LWU C;  1RE3 C;  1FZF C;  2HLO C;  2H43 C;  3BVH B;  1FZE B;  2JHH C;  1FZB C;  2JHI F;  3GHG B;  4R9J A;  1FZC C;  4R9T A;  2Z4E C; 
#chains in the Genus database with same CATH homology
 1FIB A;  2HPC B;  1LT9 B;  2OYI B;  1LTJ B;  1RF0 B;  1Z3S A;  2XNX B;  2OYH C;  1N86 C;  2J0H A;  2WNP F;  2J3U A;  1N73 B;  2J3G A;  2J61 B;  2FFD B;  1FZD A;  2J3O A;  1FZA C;  3HUS C;  1JC9 A;  2Q9I C;  2J60 A;  1RE3 B;  1FZF B;  4M7F A;  1M1J C;  2HOD C;  1FZB B;  1RE4 C;  1FZC B;  1LTJ C;  2J3F D;  3E1I C;  2J61 A;  2J5Z A;  1RF1 C;  1FZG C;  2J2P A;  2OYH B;  1FID A;  1N86 B;  3BVH C;  1FZE C;  4NYT A;  3H32 B;  2J64 A;  3GHG C;  2D39 A;  1LWU B;  2J0G A;  2HLO B;  2H43 B;  2HPC C;  2J3F A;  1FZA B;  3HUS B;  1LT9 C;  2OYI C;  2Z4E B;  1RF0 C;  2Q9I B;  2XNX C;  2GY7 A;  1Z3U A;  4JZC A;  4ZFG A;  1N73 C;  2JHK F;  1M1J B;  2HOD B;  2JHM F;  2FFD C;  1RE4 B;  2J0Y A;  4JYO X;  3FIB A;  4M7H A;  2JHL F;  3E1I B;  4EPU A;  2FIB A;  1RF1 B;  1FIC A;  3H32 C;  1FZG B;  2J1G A;  1LWU C;  1RE3 C;  1FZF C;  2HLO C;  2H43 C;  3BVH B;  1FZE B;  2JHH C;  1FZB C;  2JHI F;  4R9J A;  1FZC C;  4R9T A;  2Z4E C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...