2J3FA

L-ficolin complexed to n-acetyl-d-galactosamine
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
219
structure length
218
Chain Sequence
PQPCLTGPRTCKDLLDRGHFLSGWHTIYLPDCRPLTVLCDMDTDGGGWTVFQRRVDGSVDFYRDWATYKQGFGSRLGEFWLGNDNIHALTAQGTSELRTDLVDFEDNYQFAKYRSFKVADEAEKYNLVLGAFVEGSAGDSLTFHNNQSFSTKDQDNDLNTGNCAVMFQGAWWYNCHTSNLNGRYLRGTHGSFANGINWKSGKGYNYSYKVSEMKVRPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FICOLIN-2
publication title Structural Insights Into the Innate Immune Recognition Specificities of L- and H-Ficolins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Sugar binding protein
total genus 46
structure length 218
sequence length 219
chains with identical sequence B, C, E, F
ec nomenclature
pdb deposition date 2006-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 2j3fA01
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 2j3fA02
1RF0B 2J3FA 2XNXC 1RF1C 2J3GA 1FZAB 3FIBA 1N73B 2WNPF 1FICA 4M7HA 1FZEC 4EPUA 4ZFGA 1FZGB 2FIBA 2OYHC 1FZFB 1Z3UA 2JHIF 3E1IC 2J0HA 2OYIC 2J0YA 1LWUB 2HODC 1LT9B 2J0GA 2J64A 2J3FD 1N86C 3HUSC 2HPCB 1M1JC 4JYOX 2HLOC 1JC9A 1RE3C 3BVHB 2JHMF 1LTJC 2FFDC 1FZCC 2OYHB 3E1IB 2OYIB 2XNXB 1FZAC 1N73C 3H32C 2JHHC 1RF1B 2D39A 4R9TA 2JHKF 1FIDA 1RE4C 1FZBC 2J3UA 2Z4EC 4R9JA 2GY7A 2HLOB 1Z3SA 1FZGC 1FZEB 4JZCA 1LTJB 2J61A 2H43C 2FFDB 4M7FA 1FZCB 2Q9IC 2JHLF 1RF0C 1LWUC 1LT9C 2J3OA 2HODB 3H32B 2J60A 3GHGC 1FZDA 2HPCC 1N86B 1RE4B 1FZBB 3HUSB 2Z4EB 3BVHC 1M1JB 4NYTA 1RE3B 1FIBA 2J61B 2J5ZA 2H43B 1FZFC 2Q9IB 2J2PA 2J1GA
chains in the Genus database with same CATH superfamily
1RF0B 2J3FA 2XNXC 1RF1C 2J3GA 1FZAB 3FIBA 1N73B 2WNPF 3GHGB 1FICA 4M7HA 1FZEC 4EPUA 4ZFGA 1FZGB 2FIBA 2OYHC 1FZFB 1Z3UA 2JHIF 3E1IC 2J0HA 2OYIC 2J0YA 1LWUB 2HODC 1LT9B 2J0GA 2J64A 2J3FD 1N86C 3HUSC 2HPCB 1M1JC 4JYOX 2HLOC 1JC9A 1RE3C 3BVHB 2JHMF 1LTJC 2FFDC 1FZCC 2OYHB 3E1IB 2OYIB 2XNXB 1FZAC 1N73C 3H32C 2JHHC 1RF1B 2D39A 4R9TA 2JHKF 1FIDA 1RE4C 1FZBC 2J3UA 2Z4EC 4R9JA 2GY7A 2HLOB 1Z3SA 1FZGC 1FZEB 4JZCA 1LTJB 2J61A 2H43C 2FFDB 4M7FA 1FZCB 2Q9IC 2JHLF 1RF0C 1LWUC 1LT9C 2J3OA 2HODB 3H32B 2J60A 3GHGC 1FZDA 2HPCC 1N86B 1RE4B 1FZBB 3HUSB 2Z4EB 3BVHC 1M1JB 4NYTA 1RE3B 1FIBA 2J61B 2J5ZA 2H43B 1FZFC 2Q9IB 2J2PA 2J1GA
chains in the Genus database with same CATH topology
1RF0B 2J3FA 2XNXC 1RF1C 2J3GA 1FZAB 3FIBA 1N73B 2WNPF 1FICA 4M7HA 1FZEC 4EPUA 4ZFGA 1FZGB 2FIBA 2OYHC 1FZFB 1Z3UA 2JHIF 3E1IC 2J0HA 2OYIC 2J0YA 1LWUB 2HODC 1LT9B 2J0GA 2J64A 2J3FD 1N86C 3HUSC 2HPCB 1M1JC 4JYOX 2HLOC 1JC9A 1RE3C 3BVHB 2JHMF 1LTJC 2FFDC 1FZCC 2OYHB 3E1IB 2OYIB 2XNXB 1FZAC 1N73C 3H32C 2JHHC 1RF1B 2D39A 4R9TA 2JHKF 1FIDA 1RE4C 1FZBC 2J3UA 2Z4EC 4R9JA 2GY7A 2HLOB 1Z3SA 1FZGC 1FZEB 4JZCA 1LTJB 2J61A 2H43C 2FFDB 4M7FA 1FZCB 2Q9IC 2JHLF 1RF0C 1LWUC 1LT9C 2J3OA 2HODB 3H32B 2J60A 3GHGC 1FZDA 2HPCC 1N86B 1RE4B 1FZBB 3HUSB 2Z4EB 3BVHC 1M1JB 4NYTA 1RE3B 1FIBA 2J61B 2J5ZA 2H43B 1FZFC 2Q9IB 2J2PA 2J1GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RF0 B;  2J3F A;  2XNX C;  1RF1 C;  2J3G A;  1FZA B;  3FIB A;  1N73 B;  2WNP F;  1FIC A;  4M7H A;  1FZE C;  4EPU A;  4ZFG A;  1FZG B;  2FIB A;  2OYH C;  1FZF B;  1Z3U A;  2JHI F;  3E1I C;  2J0H A;  2OYI C;  2J0Y A;  1LWU B;  2HOD C;  1LT9 B;  2J0G A;  2J64 A;  2J3F D;  1N86 C;  3HUS C;  2HPC B;  1M1J C;  4JYO X;  2HLO C;  1JC9 A;  1RE3 C;  3BVH B;  2JHM F;  1LTJ C;  2FFD C;  1FZC C;  2OYH B;  3E1I B;  2OYI B;  2XNX B;  1FZA C;  1N73 C;  3H32 C;  2JHH C;  1RF1 B;  2D39 A;  4R9T A;  2JHK F;  1FID A;  1RE4 C;  1FZB C;  2J3U A;  2Z4E C;  4R9J A;  2GY7 A;  2HLO B;  1Z3S A;  1FZG C;  1FZE B;  4JZC A;  1LTJ B;  2J61 A;  2H43 C;  2FFD B;  4M7F A;  1FZC B;  2Q9I C;  2JHL F;  1RF0 C;  1LWU C;  1LT9 C;  2J3O A;  2HOD B;  3H32 B;  2J60 A;  3GHG C;  1FZD A;  2HPC C;  1N86 B;  1RE4 B;  1FZB B;  3HUS B;  2Z4E B;  3BVH C;  1M1J B;  4NYT A;  1RE3 B;  1FIB A;  2J61 B;  2J5Z A;  2H43 B;  1FZF C;  2Q9I B;  2J2P A;  2J1G A; 
#chains in the Genus database with same CATH topology
 1RF0 B;  2J3F A;  2XNX C;  1RF1 C;  2J3G A;  1FZA B;  3FIB A;  1N73 B;  2WNP F;  3GHG B;  1FIC A;  4M7H A;  1FZE C;  4EPU A;  4ZFG A;  1FZG B;  2FIB A;  2OYH C;  1FZF B;  1Z3U A;  2JHI F;  3E1I C;  2J0H A;  2OYI C;  2J0Y A;  1LWU B;  2HOD C;  1LT9 B;  2J0G A;  2J64 A;  2J3F D;  1N86 C;  3HUS C;  2HPC B;  1M1J C;  4JYO X;  2HLO C;  1JC9 A;  1RE3 C;  3BVH B;  2JHM F;  1LTJ C;  2FFD C;  1FZC C;  2OYH B;  3E1I B;  2OYI B;  2XNX B;  1FZA C;  1N73 C;  3H32 C;  2JHH C;  1RF1 B;  2D39 A;  4R9T A;  2JHK F;  1FID A;  1RE4 C;  1FZB C;  2J3U A;  2Z4E C;  4R9J A;  2GY7 A;  2HLO B;  1Z3S A;  1FZG C;  1FZE B;  4JZC A;  1LTJ B;  2J61 A;  2H43 C;  2FFD B;  4M7F A;  1FZC B;  2Q9I C;  2JHL F;  1RF0 C;  1LWU C;  1LT9 C;  2J3O A;  2HOD B;  3H32 B;  2J60 A;  3GHG C;  1FZD A;  2HPC C;  1N86 B;  1RE4 B;  1FZB B;  3HUS B;  2Z4E B;  3BVH C;  1M1J B;  4NYT A;  1RE3 B;  1FIB A;  2J61 B;  2J5Z A;  2H43 B;  1FZF C;  2Q9I B;  2J2P A;  2J1G A; 
#chains in the Genus database with same CATH homology
 1RF0 B;  2J3F A;  2XNX C;  1RF1 C;  2J3G A;  1FZA B;  3FIB A;  1N73 B;  2WNP F;  1FIC A;  4M7H A;  1FZE C;  4EPU A;  4ZFG A;  1FZG B;  2FIB A;  2OYH C;  1FZF B;  1Z3U A;  2JHI F;  3E1I C;  2J0H A;  2OYI C;  2J0Y A;  1LWU B;  2HOD C;  1LT9 B;  2J0G A;  2J64 A;  2J3F D;  1N86 C;  3HUS C;  2HPC B;  1M1J C;  4JYO X;  2HLO C;  1JC9 A;  1RE3 C;  3BVH B;  2JHM F;  1LTJ C;  2FFD C;  1FZC C;  2OYH B;  3E1I B;  2OYI B;  2XNX B;  1FZA C;  1N73 C;  3H32 C;  2JHH C;  1RF1 B;  2D39 A;  4R9T A;  2JHK F;  1FID A;  1RE4 C;  1FZB C;  2J3U A;  2Z4E C;  4R9J A;  2GY7 A;  2HLO B;  1Z3S A;  1FZG C;  1FZE B;  4JZC A;  1LTJ B;  2J61 A;  2H43 C;  2FFD B;  4M7F A;  1FZC B;  2Q9I C;  2JHL F;  1RF0 C;  1LWU C;  1LT9 C;  2J3O A;  2HOD B;  3H32 B;  2J60 A;  3GHG C;  1FZD A;  2HPC C;  1N86 B;  1RE4 B;  1FZB B;  3HUS B;  2Z4E B;  3BVH C;  1M1J B;  4NYT A;  1RE3 B;  1FIB A;  2J61 B;  2J5Z A;  2H43 B;  1FZF C;  2Q9I B;  2J2P A;  2J1G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...