1RE4C

Crystal structure of fragment d of bbetad398a fibrinogen
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
298
structure length
298
Chain Sequence
YEASILTHDSSIRYLQEIYNSNNQKIVNLKEKVAQLEAQCQEPCKDTVQIHDITGKDCQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQSAIPYALRVELEDWNGRTSTADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEGNCAEQDGSGWWMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIPFNRLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Blood clotting
molecule keywords Fibrinogen alpha/alpha-E chain
publication title BbetaGlu397 and BbetaAsp398 but not BbetaAsp432 are required for "B:b" interactions.
pubmed doi rcsb
source organism Homo sapiens
total genus 82
structure length 298
sequence length 298
chains with identical sequence F
ec nomenclature
pdb deposition date 2003-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1re4C01
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 1re4C02
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 1re4C03
2A45I 2J64A 3H32C 2XNXB 1FIDA 2OYIB 1RE4B 1LTJB 1FZEC 2HODA 2Q9IB 2J3UA 1W2EA 2A45H 2OYHB 1FZGB 1FZEA 2J60A 2J61A 1FZAA 1Z3SA 2FIBA 2HODB 2WNPF 1N86A 1RF0C 2HLOA 3BVHC 1FZEB 2J61B 2JHKF 2FFDA 1LT9C 1FZAB 1JC9A 2J3OA 4JZCA 1JY3N 1FZFC 1RE3C 1FZBC 1N86B 3H32A 2J3FA 2HPCC 2HLOB 2H43C 2GY7A 2FFDB 1M1JC 2HPCA 1LWUC 2J3GA 1JY3O 1JY2O 3E1IC 4M7FA 3H32B 2JHIF 1JY3P 1RF1C 3E1IA 2JHMF 1FZCC 1N73C 2HPCB 2J2PA 1RF0A 4R9JA 3BVHA 1JY2N 1T3UA 4NYTA 1LT9A 2J1GA 2J5ZA 2Z4EC 3FIBA 2XNXC 2JHHC 1RE4C 1FZFA 2OYIC 1FICA 1LTJC 2Z4EA 3E1IB 2Q9IC 1FZBA 1RE3A 2A45G 1RF0B 2J0HA 2JHLF 2OYHC 3BVHB 1Z3UA 2H43A 1LT9B 1M1JA 2J0YA 3GHGC 1LWUA 1JY2P 1FZFB 3HUSC 2Z4EB 2HODC 3GHGA 1FZBB 1RE3B 1RF1A 2D39A 3HUSA 2H43B 1FZCA 1FZAC 1N73A 1M1JB 1FIBA 1LWUB 3GHGB 4M7HA 1N86C 2XNXA 2HLOC 4R9TA 1RF1B 3HUSB 1RE4A 2OYIA 2J0GA 1FZGC 1LTJA 2Q9IA 4ZFGA 2FFDC 1FZCB 4JYOX 1N73B 1FZDA 2J3FD 1FZGA 2OYHA 4EPUA
chains in the Genus database with same CATH superfamily
3II6A 4NPFX 1LNQA 3L4FA 1RE4B 4HKZH 3D6ZA 1NTZK 1JOCA 2Q9IB 3F5HA 2J60A 3V2RA 1PL5A 1NTKK 2FYUG 1Z3SA 3CMEP 5AVXB 5L8RJ 1CI6B 3WUTA 2KI7B 4H0LB 1NTZE 3TNUA 4I6MC 1FZBC 5AW0B 2HPCC 2FYZA 2FBWC 4WB4A 2E74C 5KKZB 4RO0A 1YQ3C 1KYOH 3PH0A 3BCCE 2J2PA 1KN7A 3KPEA 2OTLP 2JHHC 2NZ2A 4EYYQ 1Y9BA 3A0HE 1H89A 2ZFCA 1URQC 2OYHC 1M56D 4JYCA 3HE4B 3RGUA 2AXTH 1L4AD 2XU6A 5APWA 1S5LX 1RF1A 2JP3A 2Y0CA 2KS1A 1NTMK 1N7SC 1HGVA 3A7OA 1JMBA 3E1RA 3L70G 3USSA 4DCKA 3L73G 3HUSB 1FZGC 1BGYG 3RL0g 2J3FD 2BEZF 3TDKA 5APTA 2P10A 4L73A 3IN6A 1NTME 2E76D 1YYCA 1R5LA 1HUCA 2E75C 1L4AA 1OVUA 1PGPA 1FBMA 1A02F 4NPEA 1H0TB 2FIBA 1X79B 4W7ZA 1GK6A 3H1IE 1NTZG 1S72P 5CCGD 1RH5B 1SS1A 3CCJP 2R5BA 5APVA 2J3FA 2K9JB 4WWIA 1PP9D 1KILC 3SWYA 1Q86Q 2GY7A 1RQVA 3VOPA 4RKUJ 1WMKA 1Z56A 3B71A 3BCCG 3H32B 1EDKA 2JDIH 2IFNA 1NO4A 1X22A 1T2KC 2L91A 4WY4A 2YXRB 5CCGA 1GU4A 2ZYGA 1GD2E 2YIUB 1GDTA 3D71A 2G8YA 2WPVB 2N1TD 3M0AA 1SQQJ 2I8DA 2K9YA 4I7ZB 1M1JB 1SQXK 4I1LA 3G4SP 4R4LA 2KB7P 1USEA 2ZT9B 3C9IA 2WQYC 5AW1B 1P84E 4UB6H 4R9TA 2P1JA 2Q6QA 1GW3A 3L75J 4JPZB 2WITA 3ITKA 2BEQD 1SQXE 2Q5UA 1NTMG 2XNXB 4ZKPA 2QEXP 2N1TA 4DT0A 1SFCC 2ZVOB 5BU5A 1PFIA 1KQLA 4C7NA 3GF3A 3HD7B 3H1IG 1G1JA 3NMDA 3H1HE 3QWOC 4C46A 1QGKB 3RK2C 2QJKC 1NAFA 4GOEA 3BATA 1BDCA 5B66H 4YPCA 1EDIA 1NGMB 3VP9A 3B8EB 1YIJP 1IFMA 2QG4A 1BCCJ 3H1LJ 1BE3J 1FZCC 3AE7C 3WMM0 1K73Q 3K5BA 5CCHC 2R3CA 2J1GA 4GOFA 3GF7A 2NPSC 5APQA 2K3RA 5AVTB 1GK4A 4W7YA 2HR3A 1VQ7P 3M9HA 1LWUA 1FDIA 4Y99B 1KYOE 1E5WA 1M8OB 3TK1A 3P32A 3RL0D 1FZAC 2FXOA 3N4XA 1EZVE 3TGUJ 3KYQA 1KTMA 4O9BA 2H7HA 3U1CA 2OYIA 4DJGA 2WPRA 4JYOX 2FYNB 2W6JH 4HB1A 3MIWA 5GTHH 1ZP0C 1SQXG 1G1IA 3CCSP 3MUDA 3CX5H 4BRYB 1Q81Q 2J3UA 2A45H 1SQPJ 1MKMA 1ZRTE 1J1EC 5AW9B 4GIFA 3FXDA 2KK7A 3H1HG 1VQPP 1LTSC 4D6TE 4LGDE 1J2JB 5C39A 1FZFC 1GL2C 2GUSA 3Q3DA 2E74D 1SQVJ 1AJYA 3BRVB 1KQFB 1T8ZA 1R5SA 2KSEA 2JKVA 3B5NB 2JHIF 1LTGC 2Z5HA 3MGNA 2HPCB 2A06E 2Q7CA 2W6AA 1IO4A 2C0XA 1URQD 5CCGC 3H1JJ 1GU5A 2Z4EA 1M7LA 1FZBA 4L74A 3BVHB 3OAKA 3A3YB 1JB0J 1S5LH 1L2PA 4PD4H 3KDPB 3HRNA 2WMMA 3CX5D 1AVYA 2AEFA 2KIKA 4JF7A 1EZVG 4N3YB 5B5EE 3WU2E 3PTZA 1YTZT 3A0BH 1N73B 1IFPA 2D2CC 1URQA 2OYHA 4OWFA 3MTUE 4PV1D 3HE5B 2N1TC 4ZMDA 1LTJB 1SQQD 1FZGB 1FJKA 1FZEA 3CD6P 3AE9C 3S1KA 4BWNA 1YJNP 5H2FH 1N7SA 1OVVA 5AVWB 5APSA 3AEAC 2WSSH 4D6TG 1QEXA 1IK7A 1EDLA 1JY3N 1KILD 3L75D 1U7JA 2HG5D 3RK3B 3H1KJ 1XTCC 1RE3C 4GDOA 2K88A 2P58A 3S4RA 1J1DC 5KLVJ 5AW7B 4PD4D 1JTHB 2WT7B 1YHQP 2A06G 1T2KD 3VTPC 3L72E 1QX8A 1QVFO 2HFED 2PGDA 1LT1A 4BXLA 4KT0J 4AUWA 3L74J 3BRTB 1LGHB 1FICA 1PIXA 2J0HA 3JC22 1KILA 3VN0A 2BCCE 1U7MA 5K5GB 1BCCD 2PFXA 3CWBE 1FU1A 1PGQA 3H1LD 1BE3D 2VRSA 3O8ZA 1OVRA 1T6AA 2QJYB 1N86C 2M8RA 3CPWO 3AE8C 5TISH 1MZ9A 1JM0A 1NH4A 2YKQA 4EPUA 2J64A 3P8CE 1SFCD 3PRJA 2WSFJ 1W2EA 4TT3H 3LIDA 2L5GB 3AEBC 3TGUD 4LC1A 3G71P 4U3FE 1N7LA 2R3SA 4ASWA 4IFFA 4JYBA 1RF0C 3HTKA 3CC4P 2CK3H 3VP8A 1P84I 2J3OA 4JZCA 1L0NK 3AE5C 1SQBJ 2IBZG 2W83C 3JCUE 3L71J 2QJPB 5CJ4A 3TNUB 1SFCA 1SQPD 5CBNA 2J3GA 3CXHE 1VQMP 3RK2B 1NU1E 3MHVA 1SQQK 1Q7YQ 5AW8B 5CCHD 3CI9A 3L72G 2JHMF 4IOIH 1L0NE 4YXWH 3M9BA 2NPSD 1JY2N 1HJ0A 1Q90D 2Z4EC 1QL1A 1NTKE 5KLIC 1W5CE 1KMIZ 4N78E 1SQVD 2N9BA 4UB8H 2BCCG 3RK3E 2KLUA 1KQSO 4OGQD 1L0LJ 3GHGA 3L37A 3CWBG 1RQUA 1X0TA 1NYHA 1FZCA 2KNCA 1JUNA 1PPJD 2C0WA 1S3JA 3L35A 5CCHA 3VMAA 5KJ7C 2O1JA 2MJZA 1DEBA 3H1JD 1RF1B 3Q5PA 2NPSA 2Y9YA 1JO5A 5AVRB 2KS1B 2FYUJ 2W8ZA 3G6EP 1FZEC 4QMAA 3GMAA 1ZN5A 2QIWA 2E5YA 1FZAA 3R2PA 4U3FG 2GUVA 1S9KE 3BASA 3TYYA 1EZVI 1EXIA 2FXMA 1L4AB 1GL2D 3Q2YA 2K1AA 1AQ5A 2ZYDA 1NAYA 2KUBA 3AE4C 4PV1C 2R5DA 2I1KA 1AV1A 1HBWA 1JY2O 1YI2P 1NU1G 2RN0A 4H44D 3GG2A 3V4WA 1L0NG 1OIPA 1SP4A 4R9JA 1OMIA 4Z1MH 2E76B 2J5ZA 1NTKG 1KORA 1FE6A 4Y28J 2K37A 1FZFA 5E79E 1GL2A 3H1KD 2QA4P 1ZXGA 2WSFH 1KB9E 3T97B 5KLVD 4WY4B 2P7JA 3G3ZA 3L70J 3L73J 2HODC 1CW5A 1BGYJ 4K3AA 4EDFA 5TJHA 1SQPK 1WT6A 2Q3EA 2D2CD 3L74D 3KXDA 3L36A 4H13D 2HLOC 3SWKA 2WZ7A 2FFDC 2Z5IA 3PHLA 1HVVA 1SQVK 1NTZJ 2ZT9D 3OA7A 2J61A 2OGUA 5KAIE 1M90Q 5AVSB 2N1TB 1LT9C 2ZXXA 1K8AQ 5AVUB 3BCCJ 4L75A 3TSIA 1S1CX 2B9BA 1VQ5P 2H43C 1VF5C 3RBXA 2YO2A 1HJBA 4IL6E 1JY3P 5AVZB 5CMZA 2QRXA 1J1DB 3U1AA 3S9OA 3FIBA 2GM4A 1VQ6P 1RE4C 2Q9IC 4MN4C 1RE3A 1SQBD 2IZ1A 3L71D 1DX7A 3GLMA 2IBZI 3GHGC 1IK9A 5KAFH 4PJ0H 4XFJA 4H0LC 1N2DC 1LWUB 1NTMJ 3W67A 1Y47A 4NPDA 2C9NY 2KLVA 4ZFGA 2JO1A 2IFMA 1NOHA 5APYA 3H1IJ 1ZMEC 2OTKE 1BDDA 2OYIB 4OGQC 1L0LD 1YJWP 2PRRA 1VQOP 2PP6A 5GTIH 1FOSE 3CL3D 2LR2A 2JR8A 1VQ8P 2AXCA 2BASA 1N86A 1VDFA 2IBZD 3AE3C 1PP9E 5APXA 1M1KQ 1DH3A 1HWTC 3O6QA 2AXTE 4LLHA 1N8RQ 3RL0B 2FYUD 1IZNB 1LTIC 2O3JA 1ZR4A 4OVNF 1ZW0A 3C1LA 4ASVA 2J59M 1RY3A 4M7FA 2PAJA 1OFCX 3E1IA 3M0DC 1RF0A 3SFEC 1D7MA 1DD4A 5EFWB 4C7RA 1NJIQ 4HJGH 3B5ND 2J0YA 2AEJA 1JY2P 1E79H 2RH0A 2Z4EB 3M91A 1FZBB 1Q2NA 4W80A 1LTAC 1QL2A 3CXHI 4H44C 2WSEJ 5KJ7D 1SQXJ 5BVZA 2E74B 1CSBA 2LXCB 2M3BA 3AEEC 4M7HA 2B88A 3H1HJ 3H32C 1OW6A 2JWAA 1HF9A 1SQBK 3A0HH 3L70D 3L73D 3B5NA 1URQB 2OYHB 1BGYD 1X9VA 2H8PD 1PZQA 4HH2A 3QH9A 3RBZA 2ZYAA 3EQ2A 5DJUB 1JEKA 1PV3A 5KJ7A 1PP9G 1UIXA 1FZEB 2YIUC 4H13C 1N7SB 3FXEA 4I7ZC 1VQLP 4HYTB 1M1JC 1NTZD 2B87A 2ZT9C 4B86A 1T3JA 4EOTA 1JMMA 1NVOA 1W2BO 4UB6E 2Q3IA 1LP1A 1NKNA 2E75B 1MV8A 4R4MA 3CCQP 2YXQB 2FKWB 2XNXC 3AECC 3BCCD 2W90A 2XV5A 3ABVC 4ZNCA 2JEEA 2ZAEB 2I1JA 3OW2O 3MP7B 3HD7C 1YITP 5BU8B 3EWKA 3I5CA 3AEDC 2DW3A 3AE6C 1KILB 3CCMP 1ZV8A 1YQ4C 1FJPA 2M0BA 4I2LC 1YTZI 1QLED 4XE5B 4U7JA 5B66E 2IX7C 4D6TJ 1KB9I 2JWDA 2HODA 1K05A 3ZDMA 2KP8A 1KD1Q 2XDJA 1NTMD 1XTGB 2KYVA 2HLOA 2FFDA 2QM8A 1IFDA 1EXJA 1SVFA 2FXPA 5AW3B 1G2CA 4Y99C 1VF5D 1P84H 3H1ID 3HTKB 1NWQA 3MZWB 3CCVP 3E7KA 1VQKP 1H88A 1JY3O 5GTIE 3E1IC 1ZOYC 2FYNC 1SFCB 1USDA 2YKOA 4NYTA 1LT9A 1FDOA 2WSCJ 3P7KA 5GTHE 2M5AA 3CX5E 2H43A 5CBOA 1KC8Q 4H0LD 2QJKB 2E43A 3Q1MA 5AW6B 5DJTB 3GHGB 3M06A 1GW4A 1RE4A 2IZ0A 2J0GA 2Q9IA 1FZCB 1OXZA 1AQTA 1SQQE 2KNCB 3FX0A 2UWJE 2OYOA 1Q82Q 3CCUP 3B5NC 4XA4A 1P84D 2NPSB 2XNDH 3CCRP 4TLFA 1CI6A 1AVOA 3IF4A 3B4SA 1KILE 1SQXD 2IPPA 3PJSK 3L75E 1FAVA 4OGQB 3BVHC 1FZAB 1YBKA 2OQQA 3VYIA 2GA1A 3NTNA 1S5LE 2OTJP 4PD4E 2QSIA 1WRGA 3L72J 2MKVA 3H1HD 1S2EA 1IC2A 3EFFK 1KYOI 4JQ0D 2YMKA 2BCCJ 2CPSA 1N73C 3D6YA 3A0BE 1J1EB 3G9RA 3HE4A 3M9QA 3CWBJ 2LKMA 1LTJC 1ZLLA 2KZJA 1FDMA 2A45G 5CJ0A 1BCCE 1U57A 3H1LE 2B89A 1BE3E 1A02J 5H2FE 4DZOA 2V7QJ 1FZFB 1GL2B 3P8MC 1Y8AA 3HUSA 2E5TA 3M0DA 4WBAA 1FIBA 3AE1C 2KXPB 3RK3C 3CCEP 2FY8A 1KYOD 3PP5A 1SQQG 4WY4D 2IYOA 4H44B 1EZVD 4U3FJ 3C8VA 1NHLA 5AW2B 1VL2A 3TGUE 1H0TA 3VMYA 1FIDA 3FWLA 1VPCA 1S4XA 2V4HA 3KZIH 1M57D 2OARA 3L75G 3EFGA 2WSCH 3Q5SA 3AEGC 2K9JA 4GODA 2J61B 1MFZA 1ZRTD 2JHKF 2QE7H 5B5EH 3WU2H 1JC9A 1NU1J 1SQPE 3T97A 2R32A 3MD0A 3A2AA 3CCLP 1L0NJ 3H32A 4D6TD 3D70A 2IYPA 2D2CB 4K35A 1NTKJ 4H13B 2O01N 4KJMA 2QJYC 1DIPA 2LXBA 2YKPA 3GW6A 1JNMA 3LW5J 5TISE 1SQVE 2YNYA 4C7NB 4YTPC 5KTBA 1AA0A 1BCCG 5AW5B 3H1LG 1IFIA 2A06D 1KV4A 1BE3G 1GTWA 3LIEA 3HD7D 2WPQA 4YXDC 1PGOA 1M1JA 3WUVA 1PPJE 3PLNA 3NFQA 1RE3B 3H1JE 4N6JA 1FS0E 3V5BA 2XNXA 2QJPC 2ITAA 3IFMA 5AVQB 4JBZA 4IL6X 1OW7A 3TGUG 1LJ2A 4M3LA 3FGAD 1MUUA 2Q1KA 3HD7A 1SLQA 3WUUA 3I55P 1CZQA 2KOGA 2SPZA 4UB8E 5KKZC 1EC5A 1SQPG 4AQRD 1N86B 2V7QH 3F89A 5KLVK 2QVAA 2C9LY 3O6QB 2J58A 3AEFC 1RF1C 3H1KE 1SQVG 1IFJA 1T3UA 2WPSA 1OX3A 5KLVE 3SFDC 2NRGA 3E1IB 4IFDK 1RF0B 3L72D 2JHLF 3H25A 1Z3UA 1PPJG 2H89C 3FWNA 3JCUH 5M1BA 3HUSC 2H88C 3H1JG 3L74E 2D39A 2JJLA 1DEEG 1L4AC 1KZUB 2J5UA 1EDJA 2BCCD 1LTTC 3CXHH 2R44A 4EIJA 2W6BA 3I56P 3CWBD 4BRYA 3V6IA 3V2QA 3CX5I 2A45I 3IR9A 5KLIB 1KQGB 3TF5A 3U59A 2ZJSE 3LW5H 1AFOA 3VMXA 2WTYA 2ZXEB 1MFTA 2E76C 3P8CD 3KHUA 1OWAA 2O01J 2WNPF 1KFNA 1VQ9P 2Y0DA 1K04A 1IFNA 2Y0EA 1HTLC 4WY4C 4U3FD 2XZRA 1EQ7A 4OH8B 3Q5RA 2HPCA 3KZIE 1X8YA 4IFMA 1BSNA 3H1KG 3V2NA 1SQBE 3L71E 1N7SD 2B87B 3BVHA 5KLVG 1RHZB 3CXHD 2WWWA 1NU1D 2RKLA 4KHXA 3NXSA 3N7NA 1L0ND 1LP1B 4PD4I 1UIIA 2ZVNB 4EI2A 1L0LK 1NTKD 3L74G 2E75D 4N78D 1GZLA 4PV1B 3RK3D 5CHXA 2O1KA 1N73A 3CMAP 1R8EA 2HYNA 2AEMA 2XKMA 1HGZA 3CC2P 1LTBC 3HE5A 1L0LE 1LTJA 2KZIA 1H8AA 1FZGA 3KQGA 2POHA 2FYUK 1DD3A 4L76A 1PP9J 5E79H 1IJDB 1YJ9P 5AVVB 4DOJA 1BSHA 2CPBA 2IBZE 4RESB 1KFMA 2W27A 1FOSF 1KB9H 3R4YA 4GT1A 4WVZA 3V2PA 1GMJA 1VQ4P 1JCDA 2HODB 2FYUE 4ZKUA 2IDBA 3JSVC 2QM7A 1OW8A 2YMYA 1ZR2A 5AVYB 1S9KD 3CLQA 1JTHA 2N9YB 2WT7A 2HLOB 2M3EA 3SWFA 3VMZA 2FFDB 4A7PA 4CPGA 5KAFE 4PJ0E 1VQNP 1LWUC 4AYCA 2E42A 1G2CB 1HH0A 4RJTA 1K9MQ 1NKZB 3OJAB 1SQBG 3L71G 3V4QA 2WVRA 1TU3F 3IAOA 2G3AA 5KAIH 2KSJA 2OYIC 4GKGA 1QVGO 2WSEH 1LT9B 2RMZA 2M5AB 5AW4B 3MUDC 1FC2C 1OZHA 3CC7P 2P2UA 2O01H 2H43B 3SSUA 3H6PA 1KB9D 1PGJA 1JCCA 1VF5B 2Y9ZA 3UIAA 3RL0C 4IL6H 1L0LG 3L70E 3L73E 1FZDA 3RK2D 3AE2C 1BGYE 3A5TA 2YO3A 3W68A 2P67A 1NU1K 5APUA
chains in the Genus database with same CATH topology
3II6A 1FIDA 3HE5B 3VMYA 3L4FA 2OYIB 1RE4B 2N1TC 1LTJB 1NTZK 1JOCA 2Q9IB 1FZGB 1FJKA 1FZEA 2J60A 1VPCA 2PP6A 3V2RA 1FOSE 1NTKK 3CL3D 2OARA 3EFGA 2WSCH 1N7SA 5AVWB 1Z3SA 5APSA 5AVXB 2BASA 1N86A 1CI6B 1VDFA 5APYA 5APXA 2J61B 1MFZA 2JHKF 1DH3A 1HWTC 1JC9A 3TNUA 4I6MC 1JY3N 1KILD 4LLHA 2HG5D 2R32A 3RK3B 3MD0A 3RL0B 3A2AA 3T97A 1XTCC 1RE3C 5AW0B 1FZBC 3H32A 1LTIC 2HPCC 2FYZA 1ZR4A 1J1DC 4WB4A 5AW7B 1JTHB 2J59M 1RY3A 2WT7B 4M7FA 2YKPA 1JNMA 2PAJA 3E1IA 1T2KD 3VTPC 2J2PA 3M0DC 1RF0A 2HFED 2YNYA 4C7NB 3KPEA 4AUWA 3BRTB 2JHHC 1LGHB 5KTBA 1FICA 5AW5B 1H89A 2ZFCA 2J0HA 1URQC 1IFIA 2OYHC 1KILA 1GTWA 3LIEA 4C7RA 3HD7D 2WPQA 3VN0A 4JYCA 3B5ND 1M1JA 2J0YA 3HE4B 1L4AD 2XU6A 1JY2P 5APWA 3NFQA 2Z4EB 3M91A 1FZBB 1RE3B 4W80A 1LTAC 1QL2A 1RF1A 4N6JA 1FU1A 5KJ7D 2VRSA 3O8ZA 5BVZA 1NTMK 1N7SC 1CSBA 1HGVA 2M3BA 3A7OA 4M7HA 3V5BA 1N86C 2M8RA 2XNXA 3HUSB 3IFMA 1FZGC 1MZ9A 5AVQB 2J3FD 1NH4A 2YKQA 5APTA 4EPUA 4M3LA 2J64A 3P8CE 3H32C 1SFCD 1SQBK 1MUUA 3HD7A 1W2EA 1YYCA 3B5NA 1SLQA 3LIDA 1URQB 2OYHB 1HUCA 1X9VA 1L4AA 2H8PD 4HH2A 1FBMA 2L5GB 1A02F 3EQ2A 4LC1A 1N7LA 2FIBA 1CZQA 1X79B 4IFFA 5KJ7A 4JYBA 2KOGA 1RF0C 4W7ZA 1GK6A 3HTKA 1FZEB 5CCGD 3VP8A 2J3OA 4JZCA 1N7SB 4AQRD 1L0NK 2R5BA 1N86B 5APVA 2J3FA 5CJ4A 1KILC 3SWYA 2GY7A 4HYTB 3VOPA 5KLVK 1M1JC 3TNUB 2C9LY 1SFCA 1Z56A 2J3GA 4B86A 4EOTA 1T3JA 2J58A 1JMMA 3H32B 3RK2B 1RF1C 1SQQK 5AW8B 5CCHD 3CI9A 2JHMF 2IFNA 2Q3IA 1NO4A 3M9BA 1IFJA 1NKNA 2NPSD 1JY2N 1MV8A 1T3UA 2WPSA 2Z4EC 2FKWB 1T2KC 1QL1A 4WY4A 2XNXC 2XV5A 3E1IB 5CCGA 1GU4A 4IFDK 1GD2E 1RF0B 2JHLF 4N78E 2N9BA 1Z3UA 1GDTA 2N1TD 2JEEA 2I1JA 3M0AA 3HUSC 3HD7C 3GHGA 3L37A 5BU8B 3I5CA 2D39A 2JJLA 1KILB 1L4AC 1KZUB 1FZCA 1M1JB 1SQXK 1JUNA 4I1LA 2C0WA 1ZV8A 1LTTC 2KB7P 3L35A 1FJPA 5CCHA 3C9IA 4EIJA 2W6BA 5KJ7C 2O1JA 5AW1B 2MJZA 4I2LC 1DEBA 4R9TA 1RF1B 1YTZI 2P1JA 2NPSA 1JO5A 5AVRB 4XE5B 1GW3A 3V2QA 2WITA 2A45I 2Q5UA 2IX7C 2XNXB 3IR9A 4ZKPA 1FZEC 2HODA 3U59A 3LW5H 1AFOA 3VMXA 1ZN5A 2N1TA 2KP8A 1SFCC 2WTYA 1FZAA 2ZXEB 1PFIA 5BU5A 3R2PA 1KQLA 2GUVA 3P8CD 1S9KE 2XDJA 4C7NA 3BASA 3TYYA 1OWAA 3HD7B 2WNPF 1KFNA 1G1JA 3NMDA 1XTGB 2KYVA 2FXMA 2HLOA 1IFNA 4C46A 1L4AB 1HTLC 2FFDA 1GL2D 2QM8A 1IFDA 1SVFA 4WY4C 5AW3B 3RK2C 1AQ5A 1G2CA 1NAFA 4Y99C 2XZRA 3BATA 3HTKB 1NWQA 1EQ7A 4OH8B 2R5DA 2HPCA 2I1KA 1HBWA 1H88A 3VP9A 3B8EB 1JY3O 1JY2O 3E1IC 1X8YA 1IFMA 4IFMA 3V4WA 3V2NA 1FZCC 1SP4A 1N7SD 3WMM0 4R9JA 3BVHA 1SFCB 2YKOA 4NYTA 1LT9A 3P7KA 5CCHC 2R3CA 2J1GA 2WWWA 2J5ZA 1FZFA 2NPSC 4KHXA 3NXSA 1GL2A 5APQA 3N7NA 2WSFH 5AVTB 2H43A 1GK4A 4W7YA 1L0LK 3M9HA 1LWUA 4WY4B 2P7JA 3G3ZA 2E43A 4Y99B 2HODC 1E5WA 5AW6B 1CW5A 4N78D 1GZLA 3TK1A 3P32A 3RK3D 3RL0D 5CHXA 2O1KA 1FZAC 1N73A 3N4XA 1SQPK 2HYNA 1WT6A 2XKMA 1HGZA 3KYQA 1LTBC 4O9BA 2H7HA 3GHGB 3M06A 3L36A 3U1CA 3HE5A 2HLOC 1GW4A 1RE4A 2OYIA 2J0GA 1LTJA 2WZ7A 2Q9IA 2WPRA 2FFDC 1FZCB 4JYOX 1OXZA 1H8AA 2Z5IA 1FZGA 3KQGA 2POHA 2FYUK 3MIWA 1G1IA 1HVVA 3B5NC 4XA4A 3MUDA 1IJDB 2NPSB 2J3UA 1SQVK 5AVVB 4DOJA 1CI6A 2CPBA 4RESB 2A45H 1KFMA 2W27A 1FOSF 3OA7A 2J61A 4GT1A 3V2PA 1J1EC 5AW9B 2IPPA 1JCDA 4GIFA 1FAVA 2HODB 4ZKUA 5AVSB 1LTSC 2N1TB 2QM7A 3BVHC 2YMYA 4LGDE 1ZR2A 1LT9C 1FZAB 5AVYB 3VYIA 1J2JB 3NTNA 5AVUB 1S9KD 3CLQA 1FZFC 3TSIA 1JTHA 1GL2C 2GUSA 1WRGA 2WT7A 2HLOB 1IC2A 3SWFA 2H43C 3VMZA 2FFDB 3BRVB 1T8ZA 1LWUC 4AYCA 2E42A 1G2CB 2YO2A 1HH0A 1HJBA 1NKZB 3B5NB 3OJAB 1JY3P 1LTGC 2JHIF 2Z5HA 3MGNA 5AVZB 3V4QA 2CPSA 1N73C 2HPCB 2Q7CA 2W6AA 1IO4A 5CMZA 1J1DB 3U1AA 2C0XA 1J1EB 1URQD 5CCGC 3HE4A 3FIBA 3M9QA 2KSJA 1GU5A 2GM4A 2LKMA 1RE4C 2OYIC 1LTJC 1M7LA 1ZLLA 4GKGA 2Z4EA 2Q9IC 1FZBA 1RE3A 1FDMA 2A45G 5CJ0A 3BVHB 3OAKA 3A3YB 1DX7A 2WSEH 1LT9B 3GHGC 1A02J 4DZOA 5AW4B 3KDPB 1FZFB 3HRNA 1GL2B 3P8MC 2P2UA 1IK9A 3HUSA 2O01H 2H43B 3H6PA 4JF7A 1JCCA 3M0DA 4WBAA 1FIBA 1N2DC 4N3YB 1LWUB 3UIAA 3RK3C 3RL0C 2C9NY 3PP5A 2KLVA 4ZFGA 1YTZT 2IFMA 1N73B 1FZDA 4WY4D 3RK2D 1URQA 3A5TA 2OYHA 3MTUE 2YO3A 1NOHA 2P67A 1NHLA 1NU1K 5AW2B 5APUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A45 I;  2J64 A;  3H32 C;  2XNX B;  1FID A;  2OYI B;  1RE4 B;  1LTJ B;  1FZE C;  2HOD A;  2Q9I B;  2J3U A;  1W2E A;  2A45 H;  2OYH B;  1FZG B;  1FZE A;  2J60 A;  2J61 A;  1FZA A;  1Z3S A;  2FIB A;  2HOD B;  2WNP F;  1N86 A;  1RF0 C;  2HLO A;  3BVH C;  1FZE B;  2J61 B;  2JHK F;  2FFD A;  1LT9 C;  1FZA B;  1JC9 A;  2J3O A;  4JZC A;  1JY3 N;  1FZF C;  1RE3 C;  1FZB C;  1N86 B;  3H32 A;  2J3F A;  2HPC C;  2HLO B;  2H43 C;  2GY7 A;  2FFD B;  1M1J C;  2HPC A;  1LWU C;  2J3G A;  1JY3 O;  1JY2 O;  3E1I C;  4M7F A;  3H32 B;  2JHI F;  1JY3 P;  1RF1 C;  3E1I A;  2JHM F;  1FZC C;  1N73 C;  2HPC B;  2J2P A;  1RF0 A;  4R9J A;  3BVH A;  1JY2 N;  1T3U A;  4NYT A;  1LT9 A;  2J1G A;  2J5Z A;  2Z4E C;  3FIB A;  2XNX C;  2JHH C;  1RE4 C;  1FZF A;  2OYI C;  1FIC A;  1LTJ C;  2Z4E A;  3E1I B;  2Q9I C;  1FZB A;  1RE3 A;  2A45 G;  1RF0 B;  2J0H A;  2JHL F;  2OYH C;  3BVH B;  1Z3U A;  2H43 A;  1LT9 B;  1M1J A;  2J0Y A;  3GHG C;  1LWU A;  1JY2 P;  1FZF B;  3HUS C;  2Z4E B;  2HOD C;  3GHG A;  1FZB B;  1RE3 B;  1RF1 A;  2D39 A;  3HUS A;  2H43 B;  1FZC A;  1FZA C;  1N73 A;  1M1J B;  1FIB A;  1LWU B;  3GHG B;  4M7H A;  1N86 C;  2XNX A;  2HLO C;  4R9T A;  1RF1 B;  3HUS B;  1RE4 A;  2OYI A;  2J0G A;  1FZG C;  1LTJ A;  2Q9I A;  4ZFG A;  2FFD C;  1FZC B;  4JYO X;  1N73 B;  1FZD A;  2J3F D;  1FZG A;  2OYH A;  4EPU A; 
#chains in the Genus database with same CATH topology
 3II6 A;  4NPF X;  1LNQ A;  3L4F A;  1RE4 B;  4HKZ H;  3D6Z A;  1NTZ K;  1JOC A;  2Q9I B;  3F5H A;  2J60 A;  3V2R A;  1PL5 A;  1NTK K;  2FYU G;  1Z3S A;  3CME P;  5AVX B;  5L8R J;  1CI6 B;  3WUT A;  2KI7 B;  4H0L B;  1NTZ E;  3TNU A;  4I6M C;  1FZB C;  5AW0 B;  2HPC C;  2FYZ A;  2FBW C;  4WB4 A;  2E74 C;  5KKZ B;  4RO0 A;  1YQ3 C;  1KYO H;  3PH0 A;  3BCC E;  2J2P A;  1KN7 A;  3KPE A;  2OTL P;  2JHH C;  2NZ2 A;  4EYY Q;  1Y9B A;  3A0H E;  1H89 A;  2ZFC A;  1URQ C;  2OYH C;  1M56 D;  4JYC A;  3HE4 B;  3RGU A;  2AXT H;  1L4A D;  2XU6 A;  5APW A;  1S5L X;  1RF1 A;  2JP3 A;  2Y0C A;  2KS1 A;  1NTM K;  1N7S C;  1HGV A;  3A7O A;  1JMB A;  3E1R A;  3L70 G;  3USS A;  4DCK A;  3L73 G;  3HUS B;  1FZG C;  1BGY G;  3RL0 g;  2J3F D;  2BEZ F;  3TDK A;  5APT A;  2P10 A;  4L73 A;  3IN6 A;  1NTM E;  2E76 D;  1YYC A;  1R5L A;  1HUC A;  2E75 C;  1L4A A;  1OVU A;  1PGP A;  1FBM A;  1A02 F;  4NPE A;  1H0T B;  2FIB A;  1X79 B;  4W7Z A;  1GK6 A;  3H1I E;  1NTZ G;  1S72 P;  5CCG D;  1RH5 B;  1SS1 A;  3CCJ P;  2R5B A;  5APV A;  2J3F A;  2K9J B;  4WWI A;  1PP9 D;  1KIL C;  3SWY A;  1Q86 Q;  2GY7 A;  1RQV A;  3VOP A;  4RKU J;  1WMK A;  1Z56 A;  3B71 A;  3BCC G;  3H32 B;  1EDK A;  2JDI H;  2IFN A;  1NO4 A;  1X22 A;  1T2K C;  2L91 A;  4WY4 A;  2YXR B;  5CCG A;  1GU4 A;  2ZYG A;  1GD2 E;  2YIU B;  1GDT A;  3D71 A;  2G8Y A;  2WPV B;  2N1T D;  3M0A A;  1SQQ J;  2I8D A;  2K9Y A;  4I7Z B;  1M1J B;  1SQX K;  4I1L A;  3G4S P;  4R4L A;  2KB7 P;  1USE A;  2ZT9 B;  3C9I A;  2WQY C;  5AW1 B;  1P84 E;  4UB6 H;  4R9T A;  2P1J A;  2Q6Q A;  1GW3 A;  3L75 J;  4JPZ B;  2WIT A;  3ITK A;  2BEQ D;  1SQX E;  2Q5U A;  1NTM G;  2XNX B;  4ZKP A;  2QEX P;  2N1T A;  4DT0 A;  1SFC C;  2ZVO B;  5BU5 A;  1PFI A;  1KQL A;  4C7N A;  3GF3 A;  3HD7 B;  3H1I G;  1G1J A;  3NMD A;  3H1H E;  3QWO C;  4C46 A;  1QGK B;  3RK2 C;  2QJK C;  1NAF A;  4GOE A;  3BAT A;  1BDC A;  5B66 H;  4YPC A;  1EDI A;  1NGM B;  3VP9 A;  3B8E B;  1YIJ P;  1IFM A;  2QG4 A;  1BCC J;  3H1L J;  1BE3 J;  1FZC C;  3AE7 C;  3WMM 0;  1K73 Q;  3K5B A;  5CCH C;  2R3C A;  2J1G A;  4GOF A;  3GF7 A;  2NPS C;  5APQ A;  2K3R A;  5AVT B;  1GK4 A;  4W7Y A;  2HR3 A;  1VQ7 P;  3M9H A;  1LWU A;  1FDI A;  4Y99 B;  1KYO E;  1E5W A;  1M8O B;  3TK1 A;  3P32 A;  3RL0 D;  1FZA C;  2FXO A;  3N4X A;  1EZV E;  3TGU J;  3KYQ A;  1KTM A;  4O9B A;  2H7H A;  3U1C A;  2OYI A;  4DJG A;  2WPR A;  4JYO X;  2FYN B;  2W6J H;  4HB1 A;  3MIW A;  5GTH H;  1ZP0 C;  1SQX G;  1G1I A;  3CCS P;  3MUD A;  3CX5 H;  4BRY B;  1Q81 Q;  2J3U A;  2A45 H;  1SQP J;  1MKM A;  1ZRT E;  1J1E C;  5AW9 B;  4GIF A;  3FXD A;  2KK7 A;  3H1H G;  1VQP P;  1LTS C;  4D6T E;  4LGD E;  1J2J B;  5C39 A;  1FZF C;  1GL2 C;  2GUS A;  3Q3D A;  2E74 D;  1SQV J;  1AJY A;  3BRV B;  1KQF B;  1T8Z A;  1R5S A;  2KSE A;  2JKV A;  3B5N B;  2JHI F;  1LTG C;  2Z5H A;  3MGN A;  2HPC B;  2A06 E;  2Q7C A;  2W6A A;  1IO4 A;  2C0X A;  1URQ D;  5CCG C;  3H1J J;  1GU5 A;  2Z4E A;  1M7L A;  1FZB A;  4L74 A;  3BVH B;  3OAK A;  3A3Y B;  1JB0 J;  1S5L H;  1L2P A;  4PD4 H;  3KDP B;  3HRN A;  2WMM A;  3CX5 D;  1AVY A;  2AEF A;  2KIK A;  4JF7 A;  1EZV G;  4N3Y B;  5B5E E;  3WU2 E;  3PTZ A;  1YTZ T;  3A0B H;  1N73 B;  1IFP A;  2D2C C;  1URQ A;  2OYH A;  4OWF A;  3MTU E;  4PV1 D;  3HE5 B;  2N1T C;  4ZMD A;  1LTJ B;  1SQQ D;  1FZG B;  1FJK A;  1FZE A;  3CD6 P;  3AE9 C;  3S1K A;  4BWN A;  1YJN P;  5H2F H;  1N7S A;  1OVV A;  5AVW B;  5APS A;  3AEA C;  2WSS H;  4D6T G;  1QEX A;  1IK7 A;  1EDL A;  1JY3 N;  1KIL D;  3L75 D;  1U7J A;  2HG5 D;  3RK3 B;  3H1K J;  1XTC C;  1RE3 C;  4GDO A;  2K88 A;  2P58 A;  3S4R A;  1J1D C;  5KLV J;  5AW7 B;  4PD4 D;  1JTH B;  2WT7 B;  1YHQ P;  2A06 G;  1T2K D;  3VTP C;  3L72 E;  1QX8 A;  1QVF O;  2HFE D;  2PGD A;  1LT1 A;  4BXL A;  4KT0 J;  4AUW A;  3L74 J;  3BRT B;  1LGH B;  1FIC A;  1PIX A;  2J0H A;  3JC2 2;  1KIL A;  3VN0 A;  2BCC E;  1U7M A;  5K5G B;  1BCC D;  2PFX A;  3CWB E;  1FU1 A;  1PGQ A;  3H1L D;  1BE3 D;  2VRS A;  3O8Z A;  1OVR A;  1T6A A;  2QJY B;  1N86 C;  2M8R A;  3CPW O;  3AE8 C;  5TIS H;  1MZ9 A;  1JM0 A;  1NH4 A;  2YKQ A;  4EPU A;  2J64 A;  3P8C E;  1SFC D;  3PRJ A;  2WSF J;  1W2E A;  4TT3 H;  3LID A;  2L5G B;  3AEB C;  3TGU D;  4LC1 A;  3G71 P;  4U3F E;  1N7L A;  2R3S A;  4ASW A;  4IFF A;  4JYB A;  1RF0 C;  3HTK A;  3CC4 P;  2CK3 H;  3VP8 A;  1P84 I;  2J3O A;  4JZC A;  1L0N K;  3AE5 C;  1SQB J;  2IBZ G;  2W83 C;  3JCU E;  3L71 J;  2QJP B;  5CJ4 A;  3TNU B;  1SFC A;  1SQP D;  5CBN A;  2J3G A;  3CXH E;  1VQM P;  3RK2 B;  1NU1 E;  3MHV A;  1SQQ K;  1Q7Y Q;  5AW8 B;  5CCH D;  3CI9 A;  3L72 G;  2JHM F;  4IOI H;  1L0N E;  4YXW H;  3M9B A;  2NPS D;  1JY2 N;  1HJ0 A;  1Q90 D;  2Z4E C;  1QL1 A;  1NTK E;  5KLI C;  1W5C E;  1KMI Z;  4N78 E;  1SQV D;  2N9B A;  4UB8 H;  2BCC G;  3RK3 E;  2KLU A;  1KQS O;  4OGQ D;  1L0L J;  3GHG A;  3L37 A;  3CWB G;  1RQU A;  1X0T A;  1NYH A;  1FZC A;  2KNC A;  1JUN A;  1PPJ D;  2C0W A;  1S3J A;  3L35 A;  5CCH A;  3VMA A;  5KJ7 C;  2O1J A;  2MJZ A;  1DEB A;  3H1J D;  1RF1 B;  3Q5P A;  2NPS A;  2Y9Y A;  1JO5 A;  5AVR B;  2KS1 B;  2FYU J;  2W8Z A;  3G6E P;  1FZE C;  4QMA A;  3GMA A;  1ZN5 A;  2QIW A;  2E5Y A;  1FZA A;  3R2P A;  4U3F G;  2GUV A;  1S9K E;  3BAS A;  3TYY A;  1EZV I;  1EXI A;  2FXM A;  1L4A B;  1GL2 D;  3Q2Y A;  2K1A A;  1AQ5 A;  2ZYD A;  1NAY A;  2KUB A;  3AE4 C;  4PV1 C;  2R5D A;  2I1K A;  1AV1 A;  1HBW A;  1JY2 O;  1YI2 P;  1NU1 G;  2RN0 A;  4H44 D;  3GG2 A;  3V4W A;  1L0N G;  1OIP A;  1SP4 A;  4R9J A;  1OMI A;  4Z1M H;  2E76 B;  2J5Z A;  1NTK G;  1KOR A;  1FE6 A;  4Y28 J;  2K37 A;  1FZF A;  5E79 E;  1GL2 A;  3H1K D;  2QA4 P;  1ZXG A;  2WSF H;  1KB9 E;  3T97 B;  5KLV D;  4WY4 B;  2P7J A;  3G3Z A;  3L70 J;  3L73 J;  2HOD C;  1CW5 A;  1BGY J;  4K3A A;  4EDF A;  5TJH A;  1SQP K;  1WT6 A;  2Q3E A;  2D2C D;  3L74 D;  3KXD A;  3L36 A;  4H13 D;  2HLO C;  3SWK A;  2WZ7 A;  2FFD C;  2Z5I A;  3PHL A;  1HVV A;  1SQV K;  1NTZ J;  2ZT9 D;  3OA7 A;  2J61 A;  2OGU A;  5KAI E;  1M90 Q;  5AVS B;  2N1T B;  1LT9 C;  2ZXX A;  1K8A Q;  5AVU B;  3BCC J;  4L75 A;  3TSI A;  1S1C X;  2B9B A;  1VQ5 P;  2H43 C;  1VF5 C;  3RBX A;  2YO2 A;  1HJB A;  4IL6 E;  1JY3 P;  5AVZ B;  5CMZ A;  2QRX A;  1J1D B;  3U1A A;  3S9O A;  3FIB A;  2GM4 A;  1VQ6 P;  1RE4 C;  2Q9I C;  4MN4 C;  1RE3 A;  1SQB D;  2IZ1 A;  3L71 D;  1DX7 A;  3GLM A;  2IBZ I;  3GHG C;  1IK9 A;  5KAF H;  4PJ0 H;  4XFJ A;  4H0L C;  1N2D C;  1LWU B;  1NTM J;  3W67 A;  1Y47 A;  4NPD A;  2C9N Y;  2KLV A;  4ZFG A;  2JO1 A;  2IFM A;  1NOH A;  5APY A;  3H1I J;  1ZME C;  2OTK E;  1BDD A;  2OYI B;  4OGQ C;  1L0L D;  1YJW P;  2PRR A;  1VQO P;  2PP6 A;  5GTI H;  1FOS E;  3CL3 D;  2LR2 A;  2JR8 A;  1VQ8 P;  2AXC A;  2BAS A;  1N86 A;  1VDF A;  2IBZ D;  3AE3 C;  1PP9 E;  5APX A;  1M1K Q;  1DH3 A;  1HWT C;  3O6Q A;  2AXT E;  4LLH A;  1N8R Q;  3RL0 B;  2FYU D;  1IZN B;  1LTI C;  2O3J A;  1ZR4 A;  4OVN F;  1ZW0 A;  3C1L A;  4ASV A;  2J59 M;  1RY3 A;  4M7F A;  2PAJ A;  1OFC X;  3E1I A;  3M0D C;  1RF0 A;  3SFE C;  1D7M A;  1DD4 A;  5EFW B;  4C7R A;  1NJI Q;  4HJG H;  3B5N D;  2J0Y A;  2AEJ A;  1JY2 P;  1E79 H;  2RH0 A;  2Z4E B;  3M91 A;  1FZB B;  1Q2N A;  4W80 A;  1LTA C;  1QL2 A;  3CXH I;  4H44 C;  2WSE J;  5KJ7 D;  1SQX J;  5BVZ A;  2E74 B;  1CSB A;  2LXC B;  2M3B A;  3AEE C;  4M7H A;  2B88 A;  3H1H J;  3H32 C;  1OW6 A;  2JWA A;  1HF9 A;  1SQB K;  3A0H H;  3L70 D;  3L73 D;  3B5N A;  1URQ B;  2OYH B;  1BGY D;  1X9V A;  2H8P D;  1PZQ A;  4HH2 A;  3QH9 A;  3RBZ A;  2ZYA A;  3EQ2 A;  5DJU B;  1JEK A;  1PV3 A;  5KJ7 A;  1PP9 G;  1UIX A;  1FZE B;  2YIU C;  4H13 C;  1N7S B;  3FXE A;  4I7Z C;  1VQL P;  4HYT B;  1M1J C;  1NTZ D;  2B87 A;  2ZT9 C;  4B86 A;  1T3J A;  4EOT A;  1JMM A;  1NVO A;  1W2B O;  4UB6 E;  2Q3I A;  1LP1 A;  1NKN A;  2E75 B;  1MV8 A;  4R4M A;  3CCQ P;  2YXQ B;  2FKW B;  2XNX C;  3AEC C;  3BCC D;  2W90 A;  2XV5 A;  3ABV C;  4ZNC A;  2JEE A;  2ZAE B;  2I1J A;  3OW2 O;  3MP7 B;  3HD7 C;  1YIT P;  5BU8 B;  3EWK A;  3I5C A;  3AED C;  2DW3 A;  3AE6 C;  1KIL B;  3CCM P;  1ZV8 A;  1YQ4 C;  1FJP A;  2M0B A;  4I2L C;  1YTZ I;  1QLE D;  4XE5 B;  4U7J A;  5B66 E;  2IX7 C;  4D6T J;  1KB9 I;  2JWD A;  2HOD A;  1K05 A;  3ZDM A;  2KP8 A;  1KD1 Q;  2XDJ A;  1NTM D;  1XTG B;  2KYV A;  2HLO A;  2FFD A;  2QM8 A;  1IFD A;  1EXJ A;  1SVF A;  2FXP A;  5AW3 B;  1G2C A;  4Y99 C;  1VF5 D;  1P84 H;  3H1I D;  3HTK B;  1NWQ A;  3MZW B;  3CCV P;  3E7K A;  1VQK P;  1H88 A;  1JY3 O;  5GTI E;  3E1I C;  1ZOY C;  2FYN C;  1SFC B;  1USD A;  2YKO A;  4NYT A;  1LT9 A;  1FDO A;  2WSC J;  3P7K A;  5GTH E;  2M5A A;  3CX5 E;  2H43 A;  5CBO A;  1KC8 Q;  4H0L D;  2QJK B;  2E43 A;  3Q1M A;  5AW6 B;  5DJT B;  3GHG B;  3M06 A;  1GW4 A;  1RE4 A;  2IZ0 A;  2J0G A;  2Q9I A;  1FZC B;  1OXZ A;  1AQT A;  1SQQ E;  2KNC B;  3FX0 A;  2UWJ E;  2OYO A;  1Q82 Q;  3CCU P;  3B5N C;  4XA4 A;  1P84 D;  2NPS B;  2XND H;  3CCR P;  4TLF A;  1CI6 A;  1AVO A;  3IF4 A;  3B4S A;  1KIL E;  1SQX D;  2IPP A;  3PJS K;  3L75 E;  1FAV A;  4OGQ B;  3BVH C;  1FZA B;  1YBK A;  2OQQ A;  3VYI A;  2GA1 A;  3NTN A;  1S5L E;  2OTJ P;  4PD4 E;  2QSI A;  1WRG A;  3L72 J;  2MKV A;  3H1H D;  1S2E A;  1IC2 A;  3EFF K;  1KYO I;  4JQ0 D;  2YMK A;  2BCC J;  2CPS A;  1N73 C;  3D6Y A;  3A0B E;  1J1E B;  3G9R A;  3HE4 A;  3M9Q A;  3CWB J;  2LKM A;  1LTJ C;  1ZLL A;  2KZJ A;  1FDM A;  2A45 G;  5CJ0 A;  1BCC E;  1U57 A;  3H1L E;  2B89 A;  1BE3 E;  1A02 J;  5H2F E;  4DZO A;  2V7Q J;  1FZF B;  1GL2 B;  3P8M C;  1Y8A A;  3HUS A;  2E5T A;  3M0D A;  4WBA A;  1FIB A;  3AE1 C;  2KXP B;  3RK3 C;  3CCE P;  2FY8 A;  1KYO D;  3PP5 A;  1SQQ G;  4WY4 D;  2IYO A;  4H44 B;  1EZV D;  4U3F J;  3C8V A;  1NHL A;  5AW2 B;  1VL2 A;  3TGU E;  1H0T A;  3VMY A;  1FID A;  3FWL A;  1VPC A;  1S4X A;  2V4H A;  3KZI H;  1M57 D;  2OAR A;  3L75 G;  3EFG A;  2WSC H;  3Q5S A;  3AEG C;  2K9J A;  4GOD A;  2J61 B;  1MFZ A;  1ZRT D;  2JHK F;  2QE7 H;  5B5E H;  3WU2 H;  1JC9 A;  1NU1 J;  1SQP E;  3T97 A;  2R32 A;  3MD0 A;  3A2A A;  3CCL P;  1L0N J;  3H32 A;  4D6T D;  3D70 A;  2IYP A;  2D2C B;  4K35 A;  1NTK J;  4H13 B;  2O01 N;  4KJM A;  2QJY C;  1DIP A;  2LXB A;  2YKP A;  3GW6 A;  1JNM A;  3LW5 J;  5TIS E;  1SQV E;  2YNY A;  4C7N B;  4YTP C;  5KTB A;  1AA0 A;  1BCC G;  5AW5 B;  3H1L G;  1IFI A;  2A06 D;  1KV4 A;  1BE3 G;  1GTW A;  3LIE A;  3HD7 D;  2WPQ A;  4YXD C;  1PGO A;  1M1J A;  3WUV A;  1PPJ E;  3PLN A;  3NFQ A;  1RE3 B;  3H1J E;  4N6J A;  1FS0 E;  3V5B A;  2XNX A;  2QJP C;  2ITA A;  3IFM A;  5AVQ B;  4JBZ A;  4IL6 X;  1OW7 A;  3TGU G;  1LJ2 A;  4M3L A;  3FGA D;  1MUU A;  2Q1K A;  3HD7 A;  1SLQ A;  3WUU A;  3I55 P;  1CZQ A;  2KOG A;  2SPZ A;  4UB8 E;  5KKZ C;  1EC5 A;  1SQP G;  4AQR D;  1N86 B;  2V7Q H;  3F89 A;  5KLV K;  2QVA A;  2C9L Y;  3O6Q B;  2J58 A;  3AEF C;  1RF1 C;  3H1K E;  1SQV G;  1IFJ A;  1T3U A;  2WPS A;  1OX3 A;  5KLV E;  3SFD C;  2NRG A;  3E1I B;  4IFD K;  1RF0 B;  3L72 D;  2JHL F;  3H25 A;  1Z3U A;  1PPJ G;  2H89 C;  3FWN A;  3JCU H;  5M1B A;  3HUS C;  2H88 C;  3H1J G;  3L74 E;  2D39 A;  2JJL A;  1DEE G;  1L4A C;  1KZU B;  2J5U A;  1EDJ A;  2BCC D;  1LTT C;  3CXH H;  2R44 A;  4EIJ A;  2W6B A;  3I56 P;  3CWB D;  4BRY A;  3V6I A;  3V2Q A;  3CX5 I;  2A45 I;  3IR9 A;  5KLI B;  1KQG B;  3TF5 A;  3U59 A;  2ZJS E;  3LW5 H;  1AFO A;  3VMX A;  2WTY A;  2ZXE B;  1MFT A;  2E76 C;  3P8C D;  3KHU A;  1OWA A;  2O01 J;  2WNP F;  1KFN A;  1VQ9 P;  2Y0D A;  1K04 A;  1IFN A;  2Y0E A;  1HTL C;  4WY4 C;  4U3F D;  2XZR A;  1EQ7 A;  4OH8 B;  3Q5R A;  2HPC A;  3KZI E;  1X8Y A;  4IFM A;  1BSN A;  3H1K G;  3V2N A;  1SQB E;  3L71 E;  1N7S D;  2B87 B;  3BVH A;  5KLV G;  1RHZ B;  3CXH D;  2WWW A;  1NU1 D;  2RKL A;  4KHX A;  3NXS A;  3N7N A;  1L0N D;  1LP1 B;  4PD4 I;  1UII A;  2ZVN B;  4EI2 A;  1L0L K;  1NTK D;  3L74 G;  2E75 D;  4N78 D;  1GZL A;  4PV1 B;  3RK3 D;  5CHX A;  2O1K A;  1N73 A;  3CMA P;  1R8E A;  2HYN A;  2AEM A;  2XKM A;  1HGZ A;  3CC2 P;  1LTB C;  3HE5 A;  1L0L E;  1LTJ A;  2KZI A;  1H8A A;  1FZG A;  3KQG A;  2POH A;  2FYU K;  1DD3 A;  4L76 A;  1PP9 J;  5E79 H;  1IJD B;  1YJ9 P;  5AVV B;  4DOJ A;  1BSH A;  2CPB A;  2IBZ E;  4RES B;  1KFM A;  2W27 A;  1FOS F;  1KB9 H;  3R4Y A;  4GT1 A;  4WVZ A;  3V2P A;  1GMJ A;  1VQ4 P;  1JCD A;  2HOD B;  2FYU E;  4ZKU A;  2IDB A;  3JSV C;  2QM7 A;  1OW8 A;  2YMY A;  1ZR2 A;  5AVY B;  1S9K D;  3CLQ A;  1JTH A;  2N9Y B;  2WT7 A;  2HLO B;  2M3E A;  3SWF A;  3VMZ A;  2FFD B;  4A7P A;  4CPG A;  5KAF E;  4PJ0 E;  1VQN P;  1LWU C;  4AYC A;  2E42 A;  1G2C B;  1HH0 A;  4RJT A;  1K9M Q;  1NKZ B;  3OJA B;  1SQB G;  3L71 G;  3V4Q A;  2WVR A;  1TU3 F;  3IAO A;  2G3A A;  5KAI H;  2KSJ A;  2OYI C;  4GKG A;  1QVG O;  2WSE H;  1LT9 B;  2RMZ A;  2M5A B;  5AW4 B;  3MUD C;  1FC2 C;  1OZH A;  3CC7 P;  2P2U A;  2O01 H;  2H43 B;  3SSU A;  3H6P A;  1KB9 D;  1PGJ A;  1JCC A;  1VF5 B;  2Y9Z A;  3UIA A;  3RL0 C;  4IL6 H;  1L0L G;  3L70 E;  3L73 E;  1FZD A;  3RK2 D;  3AE2 C;  1BGY E;  3A5T A;  2YO3 A;  3W68 A;  2P67 A;  1NU1 K;  5APU A; 
#chains in the Genus database with same CATH homology
 3II6 A;  1FID A;  3HE5 B;  3VMY A;  3L4F A;  2OYI B;  1RE4 B;  2N1T C;  1LTJ B;  1NTZ K;  1JOC A;  2Q9I B;  1FZG B;  1FJK A;  1FZE A;  2J60 A;  1VPC A;  2PP6 A;  3V2R A;  1FOS E;  1NTK K;  3CL3 D;  2OAR A;  3EFG A;  2WSC H;  1N7S A;  5AVW B;  1Z3S A;  5APS A;  5AVX B;  2BAS A;  1N86 A;  1CI6 B;  1VDF A;  5APY A;  5APX A;  2J61 B;  1MFZ A;  2JHK F;  1DH3 A;  1HWT C;  1JC9 A;  3TNU A;  4I6M C;  1JY3 N;  1KIL D;  4LLH A;  2HG5 D;  2R32 A;  3RK3 B;  3MD0 A;  3RL0 B;  3A2A A;  3T97 A;  1XTC C;  1RE3 C;  5AW0 B;  1FZB C;  3H32 A;  1LTI C;  2HPC C;  2FYZ A;  1ZR4 A;  1J1D C;  4WB4 A;  5AW7 B;  1JTH B;  2J59 M;  1RY3 A;  2WT7 B;  4M7F A;  2YKP A;  1JNM A;  2PAJ A;  3E1I A;  1T2K D;  3VTP C;  2J2P A;  3M0D C;  1RF0 A;  2HFE D;  2YNY A;  4C7N B;  3KPE A;  4AUW A;  3BRT B;  2JHH C;  1LGH B;  5KTB A;  1FIC A;  5AW5 B;  1H89 A;  2ZFC A;  2J0H A;  1URQ C;  1IFI A;  2OYH C;  1KIL A;  1GTW A;  3LIE A;  4C7R A;  3HD7 D;  2WPQ A;  3VN0 A;  4JYC A;  3B5N D;  1M1J A;  2J0Y A;  3HE4 B;  1L4A D;  2XU6 A;  1JY2 P;  5APW A;  3NFQ A;  2Z4E B;  3M91 A;  1FZB B;  1RE3 B;  4W80 A;  1LTA C;  1QL2 A;  1RF1 A;  4N6J A;  1FU1 A;  5KJ7 D;  2VRS A;  3O8Z A;  5BVZ A;  1NTM K;  1N7S C;  1CSB A;  1HGV A;  2M3B A;  3A7O A;  4M7H A;  3V5B A;  1N86 C;  2M8R A;  2XNX A;  3HUS B;  3IFM A;  1FZG C;  1MZ9 A;  5AVQ B;  2J3F D;  1NH4 A;  2YKQ A;  5APT A;  4EPU A;  4M3L A;  2J64 A;  3P8C E;  3H32 C;  1SFC D;  1SQB K;  1MUU A;  3HD7 A;  1W2E A;  1YYC A;  3B5N A;  1SLQ A;  3LID A;  1URQ B;  2OYH B;  1HUC A;  1X9V A;  1L4A A;  2H8P D;  4HH2 A;  1FBM A;  2L5G B;  1A02 F;  3EQ2 A;  4LC1 A;  1N7L A;  2FIB A;  1CZQ A;  1X79 B;  4IFF A;  5KJ7 A;  4JYB A;  2KOG A;  1RF0 C;  4W7Z A;  1GK6 A;  3HTK A;  1FZE B;  5CCG D;  3VP8 A;  2J3O A;  4JZC A;  1N7S B;  4AQR D;  1L0N K;  2R5B A;  1N86 B;  5APV A;  2J3F A;  5CJ4 A;  1KIL C;  3SWY A;  2GY7 A;  4HYT B;  3VOP A;  5KLV K;  1M1J C;  3TNU B;  2C9L Y;  1SFC A;  1Z56 A;  2J3G A;  4B86 A;  4EOT A;  1T3J A;  2J58 A;  1JMM A;  3H32 B;  3RK2 B;  1RF1 C;  1SQQ K;  5AW8 B;  5CCH D;  3CI9 A;  2JHM F;  2IFN A;  2Q3I A;  1NO4 A;  3M9B A;  1IFJ A;  1NKN A;  2NPS D;  1JY2 N;  1MV8 A;  1T3U A;  2WPS A;  2Z4E C;  2FKW B;  1T2K C;  1QL1 A;  4WY4 A;  2XNX C;  2XV5 A;  3E1I B;  5CCG A;  1GU4 A;  4IFD K;  1GD2 E;  1RF0 B;  2JHL F;  4N78 E;  2N9B A;  1Z3U A;  1GDT A;  2N1T D;  2JEE A;  2I1J A;  3M0A A;  3HUS C;  3HD7 C;  3GHG A;  3L37 A;  5BU8 B;  3I5C A;  2D39 A;  2JJL A;  1KIL B;  1L4A C;  1KZU B;  1FZC A;  1M1J B;  1SQX K;  1JUN A;  4I1L A;  2C0W A;  1ZV8 A;  1LTT C;  2KB7 P;  3L35 A;  1FJP A;  5CCH A;  3C9I A;  4EIJ A;  2W6B A;  5KJ7 C;  2O1J A;  5AW1 B;  2MJZ A;  4I2L C;  1DEB A;  4R9T A;  1RF1 B;  1YTZ I;  2P1J A;  2NPS A;  1JO5 A;  5AVR B;  4XE5 B;  1GW3 A;  3V2Q A;  2WIT A;  2A45 I;  2Q5U A;  2IX7 C;  2XNX B;  3IR9 A;  4ZKP A;  1FZE C;  2HOD A;  3U59 A;  3LW5 H;  1AFO A;  3VMX A;  1ZN5 A;  2N1T A;  2KP8 A;  1SFC C;  2WTY A;  1FZA A;  2ZXE B;  1PFI A;  5BU5 A;  3R2P A;  1KQL A;  2GUV A;  3P8C D;  1S9K E;  2XDJ A;  4C7N A;  3BAS A;  3TYY A;  1OWA A;  3HD7 B;  2WNP F;  1KFN A;  1G1J A;  3NMD A;  1XTG B;  2KYV A;  2FXM A;  2HLO A;  1IFN A;  4C46 A;  1L4A B;  1HTL C;  2FFD A;  1GL2 D;  2QM8 A;  1IFD A;  1SVF A;  4WY4 C;  5AW3 B;  3RK2 C;  1AQ5 A;  1G2C A;  1NAF A;  4Y99 C;  2XZR A;  3BAT A;  3HTK B;  1NWQ A;  1EQ7 A;  4OH8 B;  2R5D A;  2HPC A;  2I1K A;  1HBW A;  1H88 A;  3VP9 A;  3B8E B;  1JY3 O;  1JY2 O;  3E1I C;  1X8Y A;  1IFM A;  4IFM A;  3V4W A;  3V2N A;  1FZC C;  1SP4 A;  1N7S D;  3WMM 0;  4R9J A;  3BVH A;  1SFC B;  2YKO A;  4NYT A;  1LT9 A;  3P7K A;  5CCH C;  2R3C A;  2J1G A;  2WWW A;  2J5Z A;  1FZF A;  2NPS C;  4KHX A;  3NXS A;  1GL2 A;  5APQ A;  3N7N A;  2WSF H;  5AVT B;  2H43 A;  1GK4 A;  4W7Y A;  1L0L K;  3M9H A;  1LWU A;  4WY4 B;  2P7J A;  3G3Z A;  2E43 A;  4Y99 B;  2HOD C;  1E5W A;  5AW6 B;  1CW5 A;  4N78 D;  1GZL A;  3TK1 A;  3P32 A;  3RK3 D;  3RL0 D;  5CHX A;  2O1K A;  1FZA C;  1N73 A;  3N4X A;  1SQP K;  2HYN A;  1WT6 A;  2XKM A;  1HGZ A;  3KYQ A;  1LTB C;  4O9B A;  2H7H A;  3GHG B;  3M06 A;  3L36 A;  3U1C A;  3HE5 A;  2HLO C;  1GW4 A;  1RE4 A;  2OYI A;  2J0G A;  1LTJ A;  2WZ7 A;  2Q9I A;  2WPR A;  2FFD C;  1FZC B;  4JYO X;  1OXZ A;  1H8A A;  2Z5I A;  1FZG A;  3KQG A;  2POH A;  2FYU K;  3MIW A;  1G1I A;  1HVV A;  3B5N C;  4XA4 A;  3MUD A;  1IJD B;  2NPS B;  2J3U A;  1SQV K;  5AVV B;  4DOJ A;  1CI6 A;  2CPB A;  4RES B;  2A45 H;  1KFM A;  2W27 A;  1FOS F;  3OA7 A;  2J61 A;  4GT1 A;  3V2P A;  1J1E C;  5AW9 B;  2IPP A;  1JCD A;  4GIF A;  1FAV A;  2HOD B;  4ZKU A;  5AVS B;  1LTS C;  2N1T B;  2QM7 A;  3BVH C;  2YMY A;  4LGD E;  1ZR2 A;  1LT9 C;  1FZA B;  5AVY B;  3VYI A;  1J2J B;  3NTN A;  5AVU B;  1S9K D;  3CLQ A;  1FZF C;  3TSI A;  1JTH A;  1GL2 C;  2GUS A;  1WRG A;  2WT7 A;  2HLO B;  1IC2 A;  3SWF A;  2H43 C;  3VMZ A;  2FFD B;  3BRV B;  1T8Z A;  1LWU C;  4AYC A;  2E42 A;  1G2C B;  2YO2 A;  1HH0 A;  1HJB A;  1NKZ B;  3B5N B;  3OJA B;  1JY3 P;  1LTG C;  2JHI F;  2Z5H A;  3MGN A;  5AVZ B;  3V4Q A;  2CPS A;  1N73 C;  2HPC B;  2Q7C A;  2W6A A;  1IO4 A;  5CMZ A;  1J1D B;  3U1A A;  2C0X A;  1J1E B;  1URQ D;  5CCG C;  3HE4 A;  3FIB A;  3M9Q A;  2KSJ A;  1GU5 A;  2GM4 A;  2LKM A;  1RE4 C;  2OYI C;  1LTJ C;  1M7L A;  1ZLL A;  4GKG A;  2Z4E A;  2Q9I C;  1FZB A;  1RE3 A;  1FDM A;  2A45 G;  5CJ0 A;  3BVH B;  3OAK A;  3A3Y B;  1DX7 A;  2WSE H;  1LT9 B;  3GHG C;  1A02 J;  4DZO A;  5AW4 B;  3KDP B;  1FZF B;  3HRN A;  1GL2 B;  3P8M C;  2P2U A;  1IK9 A;  3HUS A;  2O01 H;  2H43 B;  3H6P A;  4JF7 A;  1JCC A;  3M0D A;  4WBA A;  1FIB A;  1N2D C;  4N3Y B;  1LWU B;  3UIA A;  3RK3 C;  3RL0 C;  2C9N Y;  3PP5 A;  2KLV A;  4ZFG A;  1YTZ T;  2IFM A;  1N73 B;  1FZD A;  4WY4 D;  3RK2 D;  1URQ A;  3A5T A;  2OYH A;  3MTU E;  2YO3 A;  1NOH A;  2P67 A;  1NHL A;  1NU1 K;  5AW2 B;  5APU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...