1RE4C

Crystal structure of fragment d of bbetad398a fibrinogen
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
298
structure length
298
Chain Sequence
YEASILTHDSSIRYLQEIYNSNNQKIVNLKEKVAQLEAQCQEPCKDTVQIHDITGKDCQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQSAIPYALRVELEDWNGRTSTADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEGNCAEQDGSGWWMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIPFNRLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title BbetaGlu397 and BbetaAsp398 but not BbetaAsp432 are required for "B:b" interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
molecule keywords Fibrinogen alpha/alpha-E chain
total genus 82
structure length 298
sequence length 298
chains with identical sequence F
ec nomenclature
pdb deposition date 2003-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1re4C01
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 1re4C02
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 1re4C03
2JHLF 1Z3UA 2J3GA 3BVHC 2H43B 1RF0A 2D39A 1M1JB 1W2EA 3FIBA 2OYIB 1FZBA 2HLOA 2HODA 3H32A 4ZFGA 2JHKF 2J3FA 2H43A 1M1JC 1RE4A 3HUSC 2OYHA 3E1IB 2H43C 2J3UA 1JY3O 1JC9A 2J3FD 2J61A 2OYIC 2J0YA 2J60A 1RE3A 1LWUA 2J0HA 4M7FA 4R9TA 1RF0B 2A45H 1N73A 1RE4B 3BVHB 1T3UA 1N86A 2HLOB 2Q9IB 3GHGA 1LWUC 1RE3C 2J5ZA 4JZCA 1FIBA 3E1IA 1RF1B 1LT9B 4R9JA 2JHHC 2Z4EB 4EPUA 3GHGC 2JHMF 2HODC 3H32C 2FFDA 1FZFB 1FZBC 1FZCB 1FZAC 1LTJB 1FZCA 1N86C 2HPCC 1FZGC 4JYOX 1Z3SA 1FZEA 2OYHB 1N73C 2J64A 1FZEC 3BVHA 1FZGA 1FZAA 1JY2N 2GY7A 1JY3N 2FFDC 1FZBB 1JY2O 3GHGB 2OYHC 4M7HA 2J2PA 2Z4EA 2WNPF 2XNXB 1LT9C 2XNXC 2XNXA 1LT9A 2HODB 3H32B 1FZEB 1LWUB 1RE3B 1FZDA 1FZFA 1LTJA 2J1GA 2FFDB 1FZGB 1RF1C 1FZAB 2JHIF 2A45I 1JY2P 1N73B 2J3OA 1JY3P 4NYTA 1RF1A 2OYIA 2HPCB 2J61B 1LTJC 2HPCA 1N86B 1FZCC 3HUSA 1RE4C 1FZFC 1M1JA 2A45G 2Q9IA 2Q9IC 2HLOC 2Z4EC 1FICA 2FIBA 3E1IC 3HUSB 1RF0C 2J0GA 1FIDA
chains in the Genus database with same CATH superfamily
3P8MC 1D7MA 2KYVA 4LC1A 2Z5HA 1OXZA 1WMKA 5GTHH 1NTMK 1AV1A 1VDFA 2PGDA 2XV5A 5APUA 3B5NC 2CK3H 2RKLA 3E1IB 2AXTE 1PPJE 1JC9A 1T3JA 3M9QA 3O6QA 3F5HA 1YJWP 4WB4A 1NVOA 2ZVNB 1KORA 3S9OA 2B89A 1P84I 2PFXA 1NU1D 2GA1A 1X9VA 1HH0A 4XA4A 3M0DA 3V6IA 5APSA 1S72P 3G4SP 1BCCG 5AVZB 4BXLA 5KLVJ 3L72J 4U7JA 1Y47A 3KZIE 1M56D 1GU5A 3R4YA 1HWTC 4JPZB 1N73C 3VP8A 3Q5SA 1NHLA 3V5BA 1VF5C 2OYHC 1BDDA 3AE5C 5BVZA 1Q2NA 3BCCG 1VF5D 3B5NA 3HTKA 4IL6E 1G2CA 2UWJE 1ZRTE 4H13B 1LTJA 3A3YB 2FFDB 1JUNA 5AW1B 1IFJA 1NTZK 2QJKC 1JY2P 4UB6H 2RN0A 5K5GB 1KB9D 2E42A 5B66H 3AE4C 2OARA 1LTGC 1NH4A 1YYCA 1L0NG 2IPPA 1PFIA 1L4AD 2J3GA 1W2EA 2R3SA 1KFMA 1UIXA 4H44C 4H0LB 2J3FA 2IFMA 2M5AA 1KYOI 2Q1KA 1S5LH 1SQQE 1EDKA 3R2PA 1MFTA 4XE5B 4D6TG 2IZ0A 4PD4I 2Q6QA 1L0LJ 3S4RA 1L2PA 1DEBA 1G2CB 1PP9E 1SQVK 3BCCJ 2KZJA 1OIPA 2O01J 1NAFA 2QE7H 2BCCD 1EZVE 3B8EB 2E76B 3F89A 1IC2A 4RO0A 1FZEA 5KLVG 2O1JA 5APYA 3KZIH 2A06E 2H89C 5KLVK 3TDKA 2P2UA 3H1JJ 4M7HA 1LJ2A 2AEFA 1NTKJ 3TNUA 1FZFA 3BATA 1KC8Q 5KAIE 2LXBA 1NTME 2J3OA 3CCUP 1VL2A 2HPCA 3HUSA 3QWOC 3AEEC 2W90A 5TISE 1WT6A 2DW3A 3AE7C 5CCGD 4HH2A 1JOCA 1Z3UA 3O8ZA 1FE6A 4YTPC 2P10A 2ZXXA 2OYIB 1FZBA 1SFCA 3L72D 3MIWA 1MKMA 3RK2D 2XDJA 5B66E 2XNDH 4OH8B 1BGYJ 3V2QA 1NTKD 2HLOB 5CMZA 3L71D 2QJKB 2FYUJ 3CCLP 3VYIA 1W2BO 2L5GB 3H1HE 2K3RA 1NTMG 1BDCA 1E79H 5TJHA 4PJ0H 1HF9A 2PP6A 2OYHB 1YTZT 3ITKA 2CPSA 1L0LK 1NU1E 2ITAA 1KN7A 2GY7A 3L73G 1JY3N 3QH9A 4WBAA 1URQD 1BSNA 1GK4A 1FZGB 1RF1C 1OX3A 1N2DC 2BCCG 5AW9B 3GLMA 1YQ3C 2E5YA 2WSSH 3C8VA 3KPEA 4EIJA 4B86A 3A0BE 2K9JA 3CXHH 3H1LG 3AE3C 3H1HD 4NPFX 4RESB 5CBNA 2KB7P 2H43B 3SSUA 1AJYA 3I5CA 1JTHB 3E7KA 1T2KD 5KLIC 3L37A 2OYHA 3VTPC 1N7LA 1CSBA 1SFCC 1SLQA 2NZ2A 1KMIZ 1LTAC 2QG4A 1LWUA 1OVVA 3RK3D 2A45H 1N7SB 2QSIA 4PD4H 3ZDMA 1G1IA 3VOPA 4HYTB 1EC5A 1RE3C 2QM7A 1IFMA 3WUVA 3WUTA 3B71A 1QGKB 4HB1A 2Y0EA 3P8CD 1VQ9P 1XTCC 5CCGA 3RK3E 3FWLA 4ASVA 4EPUA 3RL0C 4NPDA 3GHGC 3KXDA 4GKGA 2HODC 2V7QJ 1EZVI 2WSFH 2E75C 2K88A 1YJNP 3MD0A 1Q86Q 2K9JB 1U7MA 1ZN5A 1T8ZA 2C9LY 4ZKUA 1SQBK 2C0XA 5AW0B 1LT9A 1H0TA 2J5UA 2HODB 4U3FD 4YXDC 2KP8A 2WSFJ 5KJ7D 1CI6A 1OVRA 3TF5A 1YITP 1QL2A 4MN4C 3H1ID 2QRXA 5KLVD 5L8RJ 3TGUD 1IFNA 1IJDB 2FXPA 1FZFC 1N7SA 1X8YA 3G71P 4NPEA 1QVGO 1NU1J 1L0LG 1L4AA 2FY8A 4OGQD 1KV4A 1EDLA 2JHLF 1EXIA 3TK1A 2O1KA 1N8RQ 2FXMA 3RK3B 5KAFH 1SQPD 2HLOA 1JCCA 2XKMA 1FOSF 1NTMD 4PJ0E 1NTKK 4JF7A 1PGPA 2OTLP 3M0DC 2KK7A 1S2EA 4C7RA 1M8OB 1YI2P 3VMZA 1CI6B 2G8YA 2ZFCA 2Y0DA 1YJ9P 4L76A 3CWBE 1RF1B 3EQ2A 4OVNF 3JSVC 2C9NY 1SQQD 3VMYA 5BU5A 1GL2C 1KB9I 2QM8A 2B88A 1R5LA 3L75G 2R3CA 2ZT9D 5BU8B 1NJIQ 3FWNA 3VMAA 4ASWA 3FX0A 5AW5B 2JR8A 1A02F 3CCVP 3L71J 2Z4EA 3KHUA 1ZLLA 5GTIE 3PP5A 3SFDC 1QEXA 2ZT9C 1N7SD 2KS1A 2L91A 1RHZB 5E79E 3G3ZA 4WY4A 1GU4A 5AW2B 2R44A 2Q9IA 1IFPA 5KLIB 1DH3A 3U59A 3CXHI 3CL3D 1S5LX 2RH0A 3A0BH 4EDFA 3U1CA 1VQPP 2H8PD 1KILE 3PHLA 2WPSA 2HG5D 2YXQB 5DJTB 3MUDA 1KQSO 4W80A 1K73Q 2QEXP 2M3EA 1M1JC 1QX8A 4LGDE 3W67A 1ZRTD 4R9TA 1RF0B 1G1JA 1W5CE 1SQXD 2KSJA 3LW5H 4D6TE 2OTJP 4JZCA 1FIBA 1EDJA 4N78E 5CCHC 4K35A 1KFNA 3L70E 1FZFB 1FJPA 1LP1B 1FZAC 1VQ7P 2AXCA 1SQBD 4O9BA 1DX7A 1FZEC 2Q3EA 2Y0CA 1GK6A 2NPSD 2OQQA 1KYOD 4ZMDA 2WNPF 1AFOA 2E76C 2FYUG 2ZXEB 5AW3B 3WUUA 1FZDA 3SWYA 4C46A 2M3BA 1M90Q 5KKZC 4N78D 1FBMA 2KNCB 1NTZD 1HGZA 2Y9ZA 5CJ4A 2XZRA 1H8AA 3M9HA 2E74C 3MGNA 3IF4A 3CC4P 2P1JA 2YKQA 1NAYA 2M8RA 1EDIA 5H2FE 4H44B 1T6AA 4D6TD 2ZYAA 3UIAA 3AEBC 1L0NK 1T2KC 3H32A 4IFFA 2HYNA 3IFMA 2FYUK 2YMKA 2WT7B 4OGQC 4DCKA 5APQA 2K1AA 3L74G 5GTIH 3CCJP 2J60A 2KI7B 1P84H 3L73E 3SWFA 1ZW0A 4EYYQ 3Q5PA 3KYQA 4C7NB 1NTMJ 2WMMA 4W7YA 3CX5E 1L4AB 1JMMA 3E1RA 3E1IA 2WQYC 2IYOA 3L73D 1AVYA 4Y28J 2V7QH 2I1KA 2JHMF 4D6TJ 1LTBC 3H1JE 1KQGB 1FS0E 3CCRP 1FZAA 1YHQP 5GTHE 2GM4A 2ZAEB 1H88A 4BRYA 1NKZB 3H1IJ 1SQXG 1NO4A 1EQ7A 1KD1Q 1PV3A 3IAOA 2A45I 1M1KQ 1FDIA 2LXCB 2J61B 2R5BA 1ZXGA 2PAJA 1BSHA 1NKNA 4H0LC 5CJ0A 4M3LA 1VQ6P 2FIBA 3E1IC 4DOJA 1BE3E 2YMYA 3CX5H 1OFCX 3A5TA 3RL0g 1NTKG 1FU1A 3WU2H 1EXJA 1FJKA 1LTIC 4GOEA 2J3UA 2J3FD 2OYIC 3CC7P 1PGQA 3GW6A 4H13D 1RE4B 1BGYE 4H13C 1ZV8A 1LNQA 4H44D 1SQXE 1JM0A 3T97A 3CCEP 5M1BA 2FFDA 1OW6A 1Y8AA 4DT0A 3KQGA 1Z3SA 4ZKPA 2ZYGA 4TT3H 1FZGA 2K37A 1FAVA 3A7OA 5AVXB 1SQVE 4JYBA 5AVSB 2H88C 2YIUC 1AVOA 1URQB 3P8CE 5B5EH 2NPSB 2WTYA 1OZHA 1L0NE 3MHVA 4I1LA 1YTZI 1SVFA 3TNUB 2IX7C 2JKVA 2FYUE 3BRVB 3L75J 2NPSA 3B5NB 1NTKE 1HGVA 1PP9J 3BCCE 2KSEA 1L0ND 3NTNA 3VP9A 3HD7D 3H1KG 4JBZA 2IBZI 1GMJA 1KILA 2YKPA 2K9YA 3HE5A 2KNCA 1PGOA 4Y99C 3M9BA 2N1TB 1PIXA 1JY3O 1GW4A 3V2NA 3B4SA 4GODA 2O01H 1N73A 1DIPA 1KQLA 1RH5B 3VMXA 1SQVD 1PPJD 2OTKE 1X79B 2E74B 1QVFO 2P67A 3CWBG 1OW7A 2E75D 2KLVA 4U3FG 4IL6X 2M5AB 3PRJA 4GIFA 2J64A 2E75B 2W83C 3CPWO 1JTHA 1KTMA 1SQQG 3GHGB 3Q3DA 4AYCA 1SQXK 2AEJA 2HFED 3H32B 3II6A 2ZVOB 1RE3B 1K8AQ 1BCCE 3GF3A 4JYCA 5EFWB 1NTZG 3PJSK 1SQVJ 2JHIF 1N73B 4YPCA 1QL1A 3RK2B 5KLVE 2N9BA 2E43A 2A45G 2E76D 1KB9H 3L71E 3A0HE 1FICA 2AEMA 1ZR4A 2A06G 1MFZA 1RQUA 3Q5RA 1H89A 4DZOA 2FYNB 3D6YA 1M1JB 3C1LA 5AVWB 3B5ND 4WY4B 2V4HA 3L72E 2HODA 1GL2A 3LIDA 1BCCJ 1ZP0C 2YNYA 2YKOA 3CWBJ 1RE3A 2WSEH 3TSIA 1QLED 1JO5A 1K9MQ 3PLNA 3H1HJ 1GDTA 2KOGA 4CPGA 3GHGA 4N6JA 4EOTA 2ZYDA 4DJGA 2IBZD 3LW5J 1PPJG 3H25A 4WVZA 3NFQA 3N4XA 1NTZJ 1LTJB 4XFJA 3MP7B 4JYOX 3L73J 1BGYG 2ZT9B 3WU2E 1P84E 2BCCJ 1SS1A 3FGAD 3I55P 1DEEG 1FZBB 3L75D 1J2JB 5CBOA 1PZQA 3AE2C 1U7JA 3HD7A 3OJAB 1Y9BA 2WITA 4IFDK 1Q7YQ 1HVVA 1K05A 3W68A 2OGUA 4RJTA 3V4QA 1RF1A 3H1LJ 2HPCB 4H0LD 5E79H 4KHXA 3AE1C 4QMAA 2WVRA 3TGUJ 3HUSB 3L70D 2LKMA 1SQPJ 1NOHA 2HR3A 2B87A 1VQOP 2A06D 1XTGB 2BEZF 2D39A 1K04A 2B9BA 3RGUA 3FIBA 2ZJSE 2M0BA 3RK3C 1VQKP 3AE8C 1EZVD 4I6MC 1S4XA 3IR9A 2FXOA 2W6BA 3SFEC 2MJZA 3JC22 1UIIA 2RMZA 2JEEA 3L70J 1MZ9A 3OW2O 1VQMP 3H1KD 1KILD 2NPSC 1OMIA 3H32C 4W7ZA 5APVA 1KB9E 1URQC 1FZCA 1JEKA 3HTKB 3BASA 1FC2C 1KZUB 2Q5UA 1VQ8P 3BVHA 4IFMA 4JQ0D 1AQ5A 1J1DC 1VQNP 4YXWH 1ZMEC 2FBWC 3IN6A 1LT9C 3AEGC 1LWUB 3TGUG 4PV1D 2W6JH 3RBZA 4UB8E 2CPBA 2QJPC 3CXHD 5APWA 1M1JA 4GDOA 1VQ4P 3BCCD 2Y9YA 2J0GA 5APTA 1S1CX 3C9IA 1L0NJ 2JJLA 3BVHC 4HKZH 3L71G 2R32A 1GTWA 3H1HG 4ZFGA 2N9YB 2H43A 5CCHA 1L0LD 3HE5B 4I7ZC 1NU1G 4UB6E 5AVQB 1FOSE 1NU1K 5KAIH 1BCCD 4PD4D 5CCHD 4ZNCA 4PV1C 1RY3A 2BCCE 2YIUB 1FZGC 2P58A 5AVYB 3CC2P 5AW8B 1YBKA 2WPQA 3CX5I 1BE3D 1R5SA 1JNMA 3CI9A 1JY2N 3L75E 1OWAA 3MZWB 1SQPE 4RKUJ 1OW8A 3K5BA 1KILC 1PL5A 4L74A 3CCSP 2MKVA 2VRSA 3S1KA 1IO4A 1PP9G 2IBZE 1PGJA 3A2AA 5CHXA 4U3FJ 2J59M 2OYIA 1J1EC 2QIWA 1P84D 1BE3J 2AXTH 2NRGA 1EZVG 2D2CC 2Z4EC 3MTUE 3V4WA 1HJBA 2JDIH 2FYUD 3ABVC 2YO3A 1DD3A 2JP3A 3EFFK 1LT1A 4OWFA 1S9KD 3M0AA 2D2CB 2KUBA 3H1IE 3T97B 3JCUH 2Z5IA 2FYZA 1L0LE 2PRRA 4BRYB 1MV8A 1T3UA 2QJPB 1GL2D 1TU3F 2J58A 4GOFA 3V2RA 1SQPK 2JHHC 3G9RA 3RBXA 3L35A 2OYOA 5KKZB 1IFIA 2KIKA 5AW4B 3MUDC 4R4LA 1URQA 2Q7CA 2FFDC 1BE3G 1JY2O 2SPZA 2WPRA 2XU6A 1NWQA 3M91A 2IBZG 3CXHE 4TLFA 3A0HH 1VQLP 5CCGC 3SWKA 4PV1B 2XNXB 2XNXC 2XNXA 3NXSA 1FZEB 1BGYD 3TYYA 2J1GA 1VF5B 1NYHA 4IOIH 1FZAB 4LLHA 3WMM0 1L4AC 4I7ZB 1WRGA 3HE4B 1S5LE 3H1IG 3CMEP 1AA0A 1M7LA 1Q90D 3H6PA 5C39A 1Q81Q 2QJYC 4Z1MH 3I56P 1USDA 3L74J 1ZOYC 5KTBA 2QA4P 1RF0C 4OGQB 4HJGH 3U1AA 1A02J 3EWKA 1NTZE 3AEAC 4UB8H 3D71A 3L4FA 4EI2A 1X22A 2JHKF 1YIJP 3HUSC 1DD4A 3O6QB 2JWDA 2KLUA 2J0YA 4M7FA 1LTTC 5AVUB 1FDOA 1N86A 5H2FH 1HJ0A 1LWUC 2R5DA 3HD7C 3LIEA 4PD4E 2BEQD 3V2PA 1LT9B 1H0TB 1SQBJ 4R9JA 2Z4EB 1HUCA 4R4MA 1LTSC 3AE9C 3D6ZA 1SQQK 1J1DB 1FZCB 1LP1A 3HE4A 1J1EB 5APXA 3TGUE 3H1LD 2IDBA 3CMAP 2LR2A 1SQXJ 1KILB 5AW6B 1KYOH 4C7NA 2FKWB 4WWIA 2IYPA 4BWNA 1GZLA 2JO1A 5DJUB 2IZ1A 5AVRB 4U3FE 3H1JG 4I2LC 2JWAA 1KQFB 3CCQP 1VPCA 1N86B 2KZIA 1GD2E 3OAKA 1JCDA 1VQ5P 1S9KE 4IL6H 1NGMB 3L74D 3CCMP 1PP9D 2FYNC 2WSEJ 3Q2YA 3PTZA 1S3JA 3L70G 1IFDA 3G6EP 2IFNA 2J61A 1IZNB 1R8EA 5B5EE 2D2CD 2H7HA 3BVHB 3AEFC 3RK2C 1LGHB 2J5ZA 1SP4A 3GG2A 1M57D 2I8DA 3PH0A 2N1TA 1HBWA 1RQVA 5KJ7C 1FZBC 3KDPB 3H1KJ 1JB0J 1YQ4C 1JMBA 3RL0D 1SQQJ 2P7JA 4GT1A 2I1JA 2YXRB 2J2PA 1IK7A 3GF7A 2W6AA 1GL2B 2BASA 4AQRD 3JCUE 1Z56A 3CLQA 3L74E 1AQTA 4N3YB 3GMAA 3RL0B 4NYTA 1HTLC 1USEA 2W27A 4WY4D 2WT7A 2POHA 2Q9IC 1U57A 3L72G 1SQVG 4WY4C 3N7NA 5AVVB 2N1TC 1SFCD 3L36A 5TISH 1CW5A 2E74D 4AUWA 1SFCB 2YO2A 3D70A 1RF0A 3OA7A 5AVTB 3CX5D 1ZR2A 2E5TA 2Q3IA 2QJYB 3H1LE 1RE4A 2WPVB 2H43C 1OVUA 1FDMA 2KS1B 1SQBG 2J0HA 3FXDA 1Q82Q 5AW7B 1X0TA 4KT0J 2QVAA 2Q9IB 2KXPB 3P32A 3AECC 3BRTB 3AEDC 4L75A 5KAFE 1E5WA 1IK9A 1N86C 2HPCC 3VN0A 3H1JD 4L73A 3HRNA 2B87B 3AE6C 1KYOE 3NMDA 2GUSA 2GUVA 3CWBD 2WSCJ 2G3AA 2WWWA 3H1KE 2WSCH 2O3JA 3P7KA 2C0WA 3FXEA 2O01N 1CZQA 2WZ7A 1JY3P 2N1TD 3USSA 1MUUA 1LTJC 1FZCC 2W8ZA 1RE4C 3CD6P 1N7SC 4Y99B 1SQBE 4KJMA 2HLOC 5KJ7A 1GW3A 3Q1MA 3EFGA 4A7PA 1SQPG 4K3AA 3HD7B 3M06A 1FIDA
chains in the Genus database with same CATH topology
3P8MC 3VP9A 3HD7D 2KYVA 2JHLF 4LC1A 2Z5HA 2YO3A 1OXZA 1NTMK 1KILA 3TK1A 2O1KA 1S9KD 2YKPA 2FXMA 3HE5A 1VDFA 2XV5A 3RK3B 3M0AA 2HLOA 5APUA 3B5NC 1JCCA 4Y99C 2XKMA 1FOSF 3M9BA 2N1TB 1NTKK 3E1IB 1JY3O 1GW4A 4JF7A 3V2NA 1JC9A 1T3JA 3M9QA 3M0DC 4C7RA 4WB4A 2Z5IA 2O01H 1N73A 2FYZA 1KQLA 3VMZA 1CI6B 1MV8A 1T3UA 2ZFCA 1GL2D 3VMXA 1X9VA 1HH0A 2J58A 1X79B 3V2RA 4XA4A 3M0DA 1SQPK 1RF1B 5APSA 3EQ2A 2JHHC 2C9NY 5AVZB 3VMYA 5BU5A 2P67A 3L35A 1GL2C 2QM8A 2KLVA 1IFIA 2R3CA 5AW4B 1GU5A 5BU8B 1HWTC 4GIFA 1N73C 2J64A 3VP8A 1URQA 2Q7CA 1JTHA 5AW5B 2FFDC 3M91A 1JY2O 1NHLA 2WPRA 2XU6A 3V5BA 1NWQA 3GHGB 1A02F 2OYHC 5BVZA 4AYCA 5CCGC 1SQXK 3B5NA 2Z4EA 2XNXB 2XNXC 2XNXA 1ZLLA 2HFED 3HTKA 3H32B 3II6A 1G2CA 3NXSA 3PP5A 1FZEB 1RE3B 3TYYA 1LTJA 4JYCA 2J1GA 1N7SD 3A3YB 2FFDB 1JUNA 1FZAB 4LLHA 5AW1B 1IFJA 1NTZK 2JHIF 3WMM0 1JY2P 1N73B 1L4AC 1QL1A 1WRGA 3RK2B 3HE4B 3G3ZA 4WY4A 1GU4A 2N9BA 5AW2B 2E43A 2A45G 2E42A 2Q9IA 1M7LA 3H6PA 1DH3A 3U59A 2OARA 3CL3D 1LTGC 1NH4A 1FICA 1ZR4A 3U1CA 5KTBA 1RF0C 1MFZA 2H8PD 1YYCA 1H89A 2IPPA 2WPSA 3U1AA 1A02J 1PFIA 1L4AD 4DZOA 2J3GA 2HG5D 1M1JB 3MUDA 1W2EA 5AVWB 1KFMA 3B5ND 3L4FA 4WY4B 4W80A 2HODA 1GL2A 2JHKF 2J3FA 2IFMA 1M1JC 3HUSC 3LIDA 2YNYA 4LGDE 2YKOA 2J0YA 3R2PA 4XE5B 1RE3A 2WSEH 3TSIA 4M7FA 1RF0B 4R9TA 1LTTC 5AVUB 1JO5A 1G1JA 2KSJA 1GDTA 1N86A 2KOGA 3LW5H 3GHGA 1LWUC 1DEBA 1G2CB 2R5DA 3HD7C 3LIEA 4N6JA 1SQVK 4EOTA 1FIBA 4JZCA 3V2PA 1LT9B 4R9JA 4N78E 2Z4EB 1HUCA 5CCHC 1NAFA 1KFNA 1LTSC 3NFQA 1SQQK 3B8EB 1FZFB 1J1DB 1FJPA 3N4XA 1FZCB 1FZAC 1LTJB 1IC2A 3HE4A 4JYOX 1J1EB 5APXA 1FZEA 4O9BA 1DX7A 1FZEC 1GK6A 2O1JA 5APYA 5KLVK 2NPSD 1FZBB 1J2JB 2P2UA 1KILB 5AW6B 4M7HA 4C7NA 2WNPF 2FKWB 1AFOA 3TNUA 3HD7A 2ZXEB 5AW3B 1FZDA 3OJAB 1FZFA 3BATA 3SWYA 1GZLA 4C46A 2WITA 4IFDK 1HVVA 5AVRB 2M3BA 4N78D 4I2LC 1FBMA 2J3OA 1HGZA 3V4QA 1RF1A 5CJ4A 1VPCA 2XZRA 2HPCB 1N86B 2HPCA 3HUSA 1H8AA 3M9HA 1GD2E 3MGNA 3OAKA 4KHXA 1JCDA 1WT6A 2P1JA 5CCGD 3HUSB 2LKMA 2YKQA 1NOHA 4HH2A 2M8RA 1S9KE 1XTGB 1JOCA 1Z3UA 3O8ZA 3UIAA 2D39A 3FIBA 1L0NK 1T2KC 3RK3C 2OYIB 1FZBA 3H32A 1SFCA 4IFFA 2HYNA 1IFDA 2FYUK 3IFMA 3MIWA 4I6MC 2WT7B 5APQA 3IR9A 3RK2D 2IFNA 2W6BA 2XDJA 2J61A 2MJZA 2J60A 2JEEA 4OH8B 3SWFA 2H7HA 3BVHB 3V2QA 3KYQA 4C7NB 4W7YA 3RK2C 2HLOB 1MZ9A 5CMZA 1L4AB 1JMMA 1LGHB 2J5ZA 1SP4A 2N1TA 3E1IA 1HBWA 1KILD 5KJ7C 3VYIA 2NPSC 2L5GB 2I1KA 2JHMF 3H32C 1FZBC 1LTBC 3KDPB 4W7ZA 5APVA 1URQC 1FZCA 3HTKB 3BASA 2PP6A 1KZUB 2Q5UA 2OYHB 1YTZT 3BVHA 2CPSA 1L0LK 4IFMA 3RL0D 1AQ5A 1FZAA 2P7JA 2GY7A 1JY3N 1J1DC 2GM4A 4WBAA 1H88A 1URQD 4GT1A 2I1JA 2J2PA 1NKZB 1LT9C 2W6AA 1GL2B 2BASA 1LWUB 1NO4A 4AQRD 1EQ7A 1GK4A 1Z56A 1FZGB 1RF1C 2CPBA 2A45I 3CLQA 4N3YB 1N2DC 3RL0B 4NYTA 5AW9B 1HTLC 2J61B 2R5BA 3KPEA 5APWA 1M1JA 4B86A 4EIJA 2PAJA 2W27A 1NKNA 4WY4D 2WT7A 2POHA 2Q9IC 5CJ0A 4M3LA 4WY4C 2FIBA 3N7NA 5AVVB 2N1TC 3E1IC 1SFCD 4DOJA 3L36A 2J0GA 1CW5A 2YMYA 5APTA 4AUWA 1SFCB 2YO2A 4RESB 3C9IA 2JJLA 2KB7P 3BVHC 2H43B 1RF0A 3OA7A 3A5TA 5AVTB 3I5CA 1ZR2A 1FU1A 2Q3IA 1JTHB 2R32A 1GTWA 1T2KD 4ZFGA 2H43A 3L37A 1FJKA 1LTIC 1RE4A 2OYHA 3VTPC 1N7LA 5CCHA 2J3UA 2H43C 1CSBA 1SFCC 1FDMA 2J3FD 2OYIC 1SLQA 3HE5B 1LTAC 1LWUA 2J0HA 5AVQB 3RK3D 2A45H 1N7SB 1FOSE 1RE4B 1NU1K 5AW7B 1G1IA 3VOPA 2Q9IB 1ZV8A 4HYTB 3P32A 1RE3C 2QM7A 1IFMA 5CCHD 3T97A 3BRTB 3P8CD 1XTCC 5CCGA 1RY3A 4EPUA 3RL0C 1E5WA 1IK9A 3GHGC 4GKGA 2HODC 2FFDA 1N86C 1FZGC 2HPCC 2WSFH 5AVYB 3VN0A 3KQGA 1Z3SA 5AW8B 2WPQA 4ZKPA 3MD0A 3HRNA 1JNMA 3CI9A 1FZGA 1FAVA 1JY2N 1OWAA 1ZN5A 1T8ZA 3A7OA 3NMDA 2C9LY 5AVXB 2GUSA 4ZKUA 1SQBK 2C0XA 4JYBA 2GUVA 5AVSB 5AW0B 1LT9A 2HODB 2WWWA 1KILC 2KP8A 2WSCH 5KJ7D 1CI6A 2VRSA 1URQB 3P7KA 2C0WA 3P8CE 1IO4A 1QL2A 1CZQA 2NPSB 2WZ7A 1JY3P 3A2AA 5CHXA 2WTYA 2N1TD 2J59M 2OYIA 1J1EC 1IFNA 4I1LA 1MUUA 1YTZI 1IJDB 1LTJC 1SVFA 1FZCC 1RE4C 3TNUB 1FZFC 2IX7C 1N7SC 3BRVB 4Y99B 2NPSA 3B5NB 1N7SA 1HGVA 1X8YA 2HLOC 5KJ7A 1GW3A 2Z4EC 3EFGA 3MTUE 3V4WA 3HD7B 1L4AA 3NTNA 1HJBA 3M06A 1FIDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JHL F;  1Z3U A;  2J3G A;  3BVH C;  2H43 B;  1RF0 A;  2D39 A;  1M1J B;  1W2E A;  3FIB A;  2OYI B;  1FZB A;  2HLO A;  2HOD A;  3H32 A;  4ZFG A;  2JHK F;  2J3F A;  2H43 A;  1M1J C;  1RE4 A;  3HUS C;  2OYH A;  3E1I B;  2H43 C;  2J3U A;  1JY3 O;  1JC9 A;  2J3F D;  2J61 A;  2OYI C;  2J0Y A;  2J60 A;  1RE3 A;  1LWU A;  2J0H A;  4M7F A;  4R9T A;  1RF0 B;  2A45 H;  1N73 A;  1RE4 B;  3BVH B;  1T3U A;  1N86 A;  2HLO B;  2Q9I B;  3GHG A;  1LWU C;  1RE3 C;  2J5Z A;  4JZC A;  1FIB A;  3E1I A;  1RF1 B;  1LT9 B;  4R9J A;  2JHH C;  2Z4E B;  4EPU A;  3GHG C;  2JHM F;  2HOD C;  3H32 C;  2FFD A;  1FZF B;  1FZB C;  1FZC B;  1FZA C;  1LTJ B;  1FZC A;  1N86 C;  2HPC C;  1FZG C;  4JYO X;  1Z3S A;  1FZE A;  2OYH B;  1N73 C;  2J64 A;  1FZE C;  3BVH A;  1FZG A;  1FZA A;  1JY2 N;  2GY7 A;  1JY3 N;  2FFD C;  1FZB B;  1JY2 O;  3GHG B;  2OYH C;  4M7H A;  2J2P A;  2Z4E A;  2WNP F;  2XNX B;  1LT9 C;  2XNX C;  2XNX A;  1LT9 A;  2HOD B;  3H32 B;  1FZE B;  1LWU B;  1RE3 B;  1FZD A;  1FZF A;  1LTJ A;  2J1G A;  2FFD B;  1FZG B;  1RF1 C;  1FZA B;  2JHI F;  2A45 I;  1JY2 P;  1N73 B;  2J3O A;  1JY3 P;  4NYT A;  1RF1 A;  2OYI A;  2HPC B;  2J61 B;  1LTJ C;  2HPC A;  1N86 B;  1FZC C;  3HUS A;  1RE4 C;  1FZF C;  1M1J A;  2A45 G;  2Q9I A;  2Q9I C;  2HLO C;  2Z4E C;  1FIC A;  2FIB A;  3E1I C;  3HUS B;  1RF0 C;  2J0G A;  1FID A; 
#chains in the Genus database with same CATH topology
 3P8M C;  1D7M A;  2KYV A;  4LC1 A;  2Z5H A;  1OXZ A;  1WMK A;  5GTH H;  1NTM K;  1AV1 A;  1VDF A;  2PGD A;  2XV5 A;  5APU A;  3B5N C;  2CK3 H;  2RKL A;  3E1I B;  2AXT E;  1PPJ E;  1JC9 A;  1T3J A;  3M9Q A;  3O6Q A;  3F5H A;  1YJW P;  4WB4 A;  1NVO A;  2ZVN B;  1KOR A;  3S9O A;  2B89 A;  1P84 I;  2PFX A;  1NU1 D;  2GA1 A;  1X9V A;  1HH0 A;  4XA4 A;  3M0D A;  3V6I A;  5APS A;  1S72 P;  3G4S P;  1BCC G;  5AVZ B;  4BXL A;  5KLV J;  3L72 J;  4U7J A;  1Y47 A;  3KZI E;  1M56 D;  1GU5 A;  3R4Y A;  1HWT C;  4JPZ B;  1N73 C;  3VP8 A;  3Q5S A;  1NHL A;  3V5B A;  1VF5 C;  2OYH C;  1BDD A;  3AE5 C;  5BVZ A;  1Q2N A;  3BCC G;  1VF5 D;  3B5N A;  3HTK A;  4IL6 E;  1G2C A;  2UWJ E;  1ZRT E;  4H13 B;  1LTJ A;  3A3Y B;  2FFD B;  1JUN A;  5AW1 B;  1IFJ A;  1NTZ K;  2QJK C;  1JY2 P;  4UB6 H;  2RN0 A;  5K5G B;  1KB9 D;  2E42 A;  5B66 H;  3AE4 C;  2OAR A;  1LTG C;  1NH4 A;  1YYC A;  1L0N G;  2IPP A;  1PFI A;  1L4A D;  2J3G A;  1W2E A;  2R3S A;  1KFM A;  1UIX A;  4H44 C;  4H0L B;  2J3F A;  2IFM A;  2M5A A;  1KYO I;  2Q1K A;  1S5L H;  1SQQ E;  1EDK A;  3R2P A;  1MFT A;  4XE5 B;  4D6T G;  2IZ0 A;  4PD4 I;  2Q6Q A;  1L0L J;  3S4R A;  1L2P A;  1DEB A;  1G2C B;  1PP9 E;  1SQV K;  3BCC J;  2KZJ A;  1OIP A;  2O01 J;  1NAF A;  2QE7 H;  2BCC D;  1EZV E;  3B8E B;  2E76 B;  3F89 A;  1IC2 A;  4RO0 A;  1FZE A;  5KLV G;  2O1J A;  5APY A;  3KZI H;  2A06 E;  2H89 C;  5KLV K;  3TDK A;  2P2U A;  3H1J J;  4M7H A;  1LJ2 A;  2AEF A;  1NTK J;  3TNU A;  1FZF A;  3BAT A;  1KC8 Q;  5KAI E;  2LXB A;  1NTM E;  2J3O A;  3CCU P;  1VL2 A;  2HPC A;  3HUS A;  3QWO C;  3AEE C;  2W90 A;  5TIS E;  1WT6 A;  2DW3 A;  3AE7 C;  5CCG D;  4HH2 A;  1JOC A;  1Z3U A;  3O8Z A;  1FE6 A;  4YTP C;  2P10 A;  2ZXX A;  2OYI B;  1FZB A;  1SFC A;  3L72 D;  3MIW A;  1MKM A;  3RK2 D;  2XDJ A;  5B66 E;  2XND H;  4OH8 B;  1BGY J;  3V2Q A;  1NTK D;  2HLO B;  5CMZ A;  3L71 D;  2QJK B;  2FYU J;  3CCL P;  3VYI A;  1W2B O;  2L5G B;  3H1H E;  2K3R A;  1NTM G;  1BDC A;  1E79 H;  5TJH A;  4PJ0 H;  1HF9 A;  2PP6 A;  2OYH B;  1YTZ T;  3ITK A;  2CPS A;  1L0L K;  1NU1 E;  2ITA A;  1KN7 A;  2GY7 A;  3L73 G;  1JY3 N;  3QH9 A;  4WBA A;  1URQ D;  1BSN A;  1GK4 A;  1FZG B;  1RF1 C;  1OX3 A;  1N2D C;  2BCC G;  5AW9 B;  3GLM A;  1YQ3 C;  2E5Y A;  2WSS H;  3C8V A;  3KPE A;  4EIJ A;  4B86 A;  3A0B E;  2K9J A;  3CXH H;  3H1L G;  3AE3 C;  3H1H D;  4NPF X;  4RES B;  5CBN A;  2KB7 P;  2H43 B;  3SSU A;  1AJY A;  3I5C A;  1JTH B;  3E7K A;  1T2K D;  5KLI C;  3L37 A;  2OYH A;  3VTP C;  1N7L A;  1CSB A;  1SFC C;  1SLQ A;  2NZ2 A;  1KMI Z;  1LTA C;  2QG4 A;  1LWU A;  1OVV A;  3RK3 D;  2A45 H;  1N7S B;  2QSI A;  4PD4 H;  3ZDM A;  1G1I A;  3VOP A;  4HYT B;  1EC5 A;  1RE3 C;  2QM7 A;  1IFM A;  3WUV A;  3WUT A;  3B71 A;  1QGK B;  4HB1 A;  2Y0E A;  3P8C D;  1VQ9 P;  1XTC C;  5CCG A;  3RK3 E;  3FWL A;  4ASV A;  4EPU A;  3RL0 C;  4NPD A;  3GHG C;  3KXD A;  4GKG A;  2HOD C;  2V7Q J;  1EZV I;  2WSF H;  2E75 C;  2K88 A;  1YJN P;  3MD0 A;  1Q86 Q;  2K9J B;  1U7M A;  1ZN5 A;  1T8Z A;  2C9L Y;  4ZKU A;  1SQB K;  2C0X A;  5AW0 B;  1LT9 A;  1H0T A;  2J5U A;  2HOD B;  4U3F D;  4YXD C;  2KP8 A;  2WSF J;  5KJ7 D;  1CI6 A;  1OVR A;  3TF5 A;  1YIT P;  1QL2 A;  4MN4 C;  3H1I D;  2QRX A;  5KLV D;  5L8R J;  3TGU D;  1IFN A;  1IJD B;  2FXP A;  1FZF C;  1N7S A;  1X8Y A;  3G71 P;  4NPE A;  1QVG O;  1NU1 J;  1L0L G;  1L4A A;  2FY8 A;  4OGQ D;  1KV4 A;  1EDL A;  2JHL F;  1EXI A;  3TK1 A;  2O1K A;  1N8R Q;  2FXM A;  3RK3 B;  5KAF H;  1SQP D;  2HLO A;  1JCC A;  2XKM A;  1FOS F;  1NTM D;  4PJ0 E;  1NTK K;  4JF7 A;  1PGP A;  2OTL P;  3M0D C;  2KK7 A;  1S2E A;  4C7R A;  1M8O B;  1YI2 P;  3VMZ A;  1CI6 B;  2G8Y A;  2ZFC A;  2Y0D A;  1YJ9 P;  4L76 A;  3CWB E;  1RF1 B;  3EQ2 A;  4OVN F;  3JSV C;  2C9N Y;  1SQQ D;  3VMY A;  5BU5 A;  1GL2 C;  1KB9 I;  2QM8 A;  2B88 A;  1R5L A;  3L75 G;  2R3C A;  2ZT9 D;  5BU8 B;  1NJI Q;  3FWN A;  3VMA A;  4ASW A;  3FX0 A;  5AW5 B;  2JR8 A;  1A02 F;  3CCV P;  3L71 J;  2Z4E A;  3KHU A;  1ZLL A;  5GTI E;  3PP5 A;  3SFD C;  1QEX A;  2ZT9 C;  1N7S D;  2KS1 A;  2L91 A;  1RHZ B;  5E79 E;  3G3Z A;  4WY4 A;  1GU4 A;  5AW2 B;  2R44 A;  2Q9I A;  1IFP A;  5KLI B;  1DH3 A;  3U59 A;  3CXH I;  3CL3 D;  1S5L X;  2RH0 A;  3A0B H;  4EDF A;  3U1C A;  1VQP P;  2H8P D;  1KIL E;  3PHL A;  2WPS A;  2HG5 D;  2YXQ B;  5DJT B;  3MUD A;  1KQS O;  4W80 A;  1K73 Q;  2QEX P;  2M3E A;  1M1J C;  1QX8 A;  4LGD E;  3W67 A;  1ZRT D;  4R9T A;  1RF0 B;  1G1J A;  1W5C E;  1SQX D;  2KSJ A;  3LW5 H;  4D6T E;  2OTJ P;  4JZC A;  1FIB A;  1EDJ A;  4N78 E;  5CCH C;  4K35 A;  1KFN A;  3L70 E;  1FZF B;  1FJP A;  1LP1 B;  1FZA C;  1VQ7 P;  2AXC A;  1SQB D;  4O9B A;  1DX7 A;  1FZE C;  2Q3E A;  2Y0C A;  1GK6 A;  2NPS D;  2OQQ A;  1KYO D;  4ZMD A;  2WNP F;  1AFO A;  2E76 C;  2FYU G;  2ZXE B;  5AW3 B;  3WUU A;  1FZD A;  3SWY A;  4C46 A;  2M3B A;  1M90 Q;  5KKZ C;  4N78 D;  1FBM A;  2KNC B;  1NTZ D;  1HGZ A;  2Y9Z A;  5CJ4 A;  2XZR A;  1H8A A;  3M9H A;  2E74 C;  3MGN A;  3IF4 A;  3CC4 P;  2P1J A;  2YKQ A;  1NAY A;  2M8R A;  1EDI A;  5H2F E;  4H44 B;  1T6A A;  4D6T D;  2ZYA A;  3UIA A;  3AEB C;  1L0N K;  1T2K C;  3H32 A;  4IFF A;  2HYN A;  3IFM A;  2FYU K;  2YMK A;  2WT7 B;  4OGQ C;  4DCK A;  5APQ A;  2K1A A;  3L74 G;  5GTI H;  3CCJ P;  2J60 A;  2KI7 B;  1P84 H;  3L73 E;  3SWF A;  1ZW0 A;  4EYY Q;  3Q5P A;  3KYQ A;  4C7N B;  1NTM J;  2WMM A;  4W7Y A;  3CX5 E;  1L4A B;  1JMM A;  3E1R A;  3E1I A;  2WQY C;  2IYO A;  3L73 D;  1AVY A;  4Y28 J;  2V7Q H;  2I1K A;  2JHM F;  4D6T J;  1LTB C;  3H1J E;  1KQG B;  1FS0 E;  3CCR P;  1FZA A;  1YHQ P;  5GTH E;  2GM4 A;  2ZAE B;  1H88 A;  4BRY A;  1NKZ B;  3H1I J;  1SQX G;  1NO4 A;  1EQ7 A;  1KD1 Q;  1PV3 A;  3IAO A;  2A45 I;  1M1K Q;  1FDI A;  2LXC B;  2J61 B;  2R5B A;  1ZXG A;  2PAJ A;  1BSH A;  1NKN A;  4H0L C;  5CJ0 A;  4M3L A;  1VQ6 P;  2FIB A;  3E1I C;  4DOJ A;  1BE3 E;  2YMY A;  3CX5 H;  1OFC X;  3A5T A;  3RL0 g;  1NTK G;  1FU1 A;  3WU2 H;  1EXJ A;  1FJK A;  1LTI C;  4GOE A;  2J3U A;  2J3F D;  2OYI C;  3CC7 P;  1PGQ A;  3GW6 A;  4H13 D;  1RE4 B;  1BGY E;  4H13 C;  1ZV8 A;  1LNQ A;  4H44 D;  1SQX E;  1JM0 A;  3T97 A;  3CCE P;  5M1B A;  2FFD A;  1OW6 A;  1Y8A A;  4DT0 A;  3KQG A;  1Z3S A;  4ZKP A;  2ZYG A;  4TT3 H;  1FZG A;  2K37 A;  1FAV A;  3A7O A;  5AVX B;  1SQV E;  4JYB A;  5AVS B;  2H88 C;  2YIU C;  1AVO A;  1URQ B;  3P8C E;  5B5E H;  2NPS B;  2WTY A;  1OZH A;  1L0N E;  3MHV A;  4I1L A;  1YTZ I;  1SVF A;  3TNU B;  2IX7 C;  2JKV A;  2FYU E;  3BRV B;  3L75 J;  2NPS A;  3B5N B;  1NTK E;  1HGV A;  1PP9 J;  3BCC E;  2KSE A;  1L0N D;  3NTN A;  3VP9 A;  3HD7 D;  3H1K G;  4JBZ A;  2IBZ I;  1GMJ A;  1KIL A;  2YKP A;  2K9Y A;  3HE5 A;  2KNC A;  1PGO A;  4Y99 C;  3M9B A;  2N1T B;  1PIX A;  1JY3 O;  1GW4 A;  3V2N A;  3B4S A;  4GOD A;  2O01 H;  1N73 A;  1DIP A;  1KQL A;  1RH5 B;  3VMX A;  1SQV D;  1PPJ D;  2OTK E;  1X79 B;  2E74 B;  1QVF O;  2P67 A;  3CWB G;  1OW7 A;  2E75 D;  2KLV A;  4U3F G;  4IL6 X;  2M5A B;  3PRJ A;  4GIF A;  2J64 A;  2E75 B;  2W83 C;  3CPW O;  1JTH A;  1KTM A;  1SQQ G;  3GHG B;  3Q3D A;  4AYC A;  1SQX K;  2AEJ A;  2HFE D;  3H32 B;  3II6 A;  2ZVO B;  1RE3 B;  1K8A Q;  1BCC E;  3GF3 A;  4JYC A;  5EFW B;  1NTZ G;  3PJS K;  1SQV J;  2JHI F;  1N73 B;  4YPC A;  1QL1 A;  3RK2 B;  5KLV E;  2N9B A;  2E43 A;  2A45 G;  2E76 D;  1KB9 H;  3L71 E;  3A0H E;  1FIC A;  2AEM A;  1ZR4 A;  2A06 G;  1MFZ A;  1RQU A;  3Q5R A;  1H89 A;  4DZO A;  2FYN B;  3D6Y A;  1M1J B;  3C1L A;  5AVW B;  3B5N D;  4WY4 B;  2V4H A;  3L72 E;  2HOD A;  1GL2 A;  3LID A;  1BCC J;  1ZP0 C;  2YNY A;  2YKO A;  3CWB J;  1RE3 A;  2WSE H;  3TSI A;  1QLE D;  1JO5 A;  1K9M Q;  3PLN A;  3H1H J;  1GDT A;  2KOG A;  4CPG A;  3GHG A;  4N6J A;  4EOT A;  2ZYD A;  4DJG A;  2IBZ D;  3LW5 J;  1PPJ G;  3H25 A;  4WVZ A;  3NFQ A;  3N4X A;  1NTZ J;  1LTJ B;  4XFJ A;  3MP7 B;  4JYO X;  3L73 J;  1BGY G;  2ZT9 B;  3WU2 E;  1P84 E;  2BCC J;  1SS1 A;  3FGA D;  3I55 P;  1DEE G;  1FZB B;  3L75 D;  1J2J B;  5CBO A;  1PZQ A;  3AE2 C;  1U7J A;  3HD7 A;  3OJA B;  1Y9B A;  2WIT A;  4IFD K;  1Q7Y Q;  1HVV A;  1K05 A;  3W68 A;  2OGU A;  4RJT A;  3V4Q A;  1RF1 A;  3H1L J;  2HPC B;  4H0L D;  5E79 H;  4KHX A;  3AE1 C;  4QMA A;  2WVR A;  3TGU J;  3HUS B;  3L70 D;  2LKM A;  1SQP J;  1NOH A;  2HR3 A;  2B87 A;  1VQO P;  2A06 D;  1XTG B;  2BEZ F;  2D39 A;  1K04 A;  2B9B A;  3RGU A;  3FIB A;  2ZJS E;  2M0B A;  3RK3 C;  1VQK P;  3AE8 C;  1EZV D;  4I6M C;  1S4X A;  3IR9 A;  2FXO A;  2W6B A;  3SFE C;  2MJZ A;  3JC2 2;  1UII A;  2RMZ A;  2JEE A;  3L70 J;  1MZ9 A;  3OW2 O;  1VQM P;  3H1K D;  1KIL D;  2NPS C;  1OMI A;  3H32 C;  4W7Z A;  5APV A;  1KB9 E;  1URQ C;  1FZC A;  1JEK A;  3HTK B;  3BAS A;  1FC2 C;  1KZU B;  2Q5U A;  1VQ8 P;  3BVH A;  4IFM A;  4JQ0 D;  1AQ5 A;  1J1D C;  1VQN P;  4YXW H;  1ZME C;  2FBW C;  3IN6 A;  1LT9 C;  3AEG C;  1LWU B;  3TGU G;  4PV1 D;  2W6J H;  3RBZ A;  4UB8 E;  2CPB A;  2QJP C;  3CXH D;  5APW A;  1M1J A;  4GDO A;  1VQ4 P;  3BCC D;  2Y9Y A;  2J0G A;  5APT A;  1S1C X;  3C9I A;  1L0N J;  2JJL A;  3BVH C;  4HKZ H;  3L71 G;  2R32 A;  1GTW A;  3H1H G;  4ZFG A;  2N9Y B;  2H43 A;  5CCH A;  1L0L D;  3HE5 B;  4I7Z C;  1NU1 G;  4UB6 E;  5AVQ B;  1FOS E;  1NU1 K;  5KAI H;  1BCC D;  4PD4 D;  5CCH D;  4ZNC A;  4PV1 C;  1RY3 A;  2BCC E;  2YIU B;  1FZG C;  2P58 A;  5AVY B;  3CC2 P;  5AW8 B;  1YBK A;  2WPQ A;  3CX5 I;  1BE3 D;  1R5S A;  1JNM A;  3CI9 A;  1JY2 N;  3L75 E;  1OWA A;  3MZW B;  1SQP E;  4RKU J;  1OW8 A;  3K5B A;  1KIL C;  1PL5 A;  4L74 A;  3CCS P;  2MKV A;  2VRS A;  3S1K A;  1IO4 A;  1PP9 G;  2IBZ E;  1PGJ A;  3A2A A;  5CHX A;  4U3F J;  2J59 M;  2OYI A;  1J1E C;  2QIW A;  1P84 D;  1BE3 J;  2AXT H;  2NRG A;  1EZV G;  2D2C C;  2Z4E C;  3MTU E;  3V4W A;  1HJB A;  2JDI H;  2FYU D;  3ABV C;  2YO3 A;  1DD3 A;  2JP3 A;  3EFF K;  1LT1 A;  4OWF A;  1S9K D;  3M0A A;  2D2C B;  2KUB A;  3H1I E;  3T97 B;  3JCU H;  2Z5I A;  2FYZ A;  1L0L E;  2PRR A;  4BRY B;  1MV8 A;  1T3U A;  2QJP B;  1GL2 D;  1TU3 F;  2J58 A;  4GOF A;  3V2R A;  1SQP K;  2JHH C;  3G9R A;  3RBX A;  3L35 A;  2OYO A;  5KKZ B;  1IFI A;  2KIK A;  5AW4 B;  3MUD C;  4R4L A;  1URQ A;  2Q7C A;  2FFD C;  1BE3 G;  1JY2 O;  2SPZ A;  2WPR A;  2XU6 A;  1NWQ A;  3M91 A;  2IBZ G;  3CXH E;  4TLF A;  3A0H H;  1VQL P;  5CCG C;  3SWK A;  4PV1 B;  2XNX B;  2XNX C;  2XNX A;  3NXS A;  1FZE B;  1BGY D;  3TYY A;  2J1G A;  1VF5 B;  1NYH A;  4IOI H;  1FZA B;  4LLH A;  3WMM 0;  1L4A C;  4I7Z B;  1WRG A;  3HE4 B;  1S5L E;  3H1I G;  3CME P;  1AA0 A;  1M7L A;  1Q90 D;  3H6P A;  5C39 A;  1Q81 Q;  2QJY C;  4Z1M H;  3I56 P;  1USD A;  3L74 J;  1ZOY C;  5KTB A;  2QA4 P;  1RF0 C;  4OGQ B;  4HJG H;  3U1A A;  1A02 J;  3EWK A;  1NTZ E;  3AEA C;  4UB8 H;  3D71 A;  3L4F A;  4EI2 A;  1X22 A;  2JHK F;  1YIJ P;  3HUS C;  1DD4 A;  3O6Q B;  2JWD A;  2KLU A;  2J0Y A;  4M7F A;  1LTT C;  5AVU B;  1FDO A;  1N86 A;  5H2F H;  1HJ0 A;  1LWU C;  2R5D A;  3HD7 C;  3LIE A;  4PD4 E;  2BEQ D;  3V2P A;  1LT9 B;  1H0T B;  1SQB J;  4R9J A;  2Z4E B;  1HUC A;  4R4M A;  1LTS C;  3AE9 C;  3D6Z A;  1SQQ K;  1J1D B;  1FZC B;  1LP1 A;  3HE4 A;  1J1E B;  5APX A;  3TGU E;  3H1L D;  2IDB A;  3CMA P;  2LR2 A;  1SQX J;  1KIL B;  5AW6 B;  1KYO H;  4C7N A;  2FKW B;  4WWI A;  2IYP A;  4BWN A;  1GZL A;  2JO1 A;  5DJU B;  2IZ1 A;  5AVR B;  4U3F E;  3H1J G;  4I2L C;  2JWA A;  1KQF B;  3CCQ P;  1VPC A;  1N86 B;  2KZI A;  1GD2 E;  3OAK A;  1JCD A;  1VQ5 P;  1S9K E;  4IL6 H;  1NGM B;  3L74 D;  3CCM P;  1PP9 D;  2FYN C;  2WSE J;  3Q2Y A;  3PTZ A;  1S3J A;  3L70 G;  1IFD A;  3G6E P;  2IFN A;  2J61 A;  1IZN B;  1R8E A;  5B5E E;  2D2C D;  2H7H A;  3BVH B;  3AEF C;  3RK2 C;  1LGH B;  2J5Z A;  1SP4 A;  3GG2 A;  1M57 D;  2I8D A;  3PH0 A;  2N1T A;  1HBW A;  1RQV A;  5KJ7 C;  1FZB C;  3KDP B;  3H1K J;  1JB0 J;  1YQ4 C;  1JMB A;  3RL0 D;  1SQQ J;  2P7J A;  4GT1 A;  2I1J A;  2YXR B;  2J2P A;  1IK7 A;  3GF7 A;  2W6A A;  1GL2 B;  2BAS A;  4AQR D;  3JCU E;  1Z56 A;  3CLQ A;  3L74 E;  1AQT A;  4N3Y B;  3GMA A;  3RL0 B;  4NYT A;  1HTL C;  1USE A;  2W27 A;  4WY4 D;  2WT7 A;  2POH A;  2Q9I C;  1U57 A;  3L72 G;  1SQV G;  4WY4 C;  3N7N A;  5AVV B;  2N1T C;  1SFC D;  3L36 A;  5TIS H;  1CW5 A;  2E74 D;  4AUW A;  1SFC B;  2YO2 A;  3D70 A;  1RF0 A;  3OA7 A;  5AVT B;  3CX5 D;  1ZR2 A;  2E5T A;  2Q3I A;  2QJY B;  3H1L E;  1RE4 A;  2WPV B;  2H43 C;  1OVU A;  1FDM A;  2KS1 B;  1SQB G;  2J0H A;  3FXD A;  1Q82 Q;  5AW7 B;  1X0T A;  4KT0 J;  2QVA A;  2Q9I B;  2KXP B;  3P32 A;  3AEC C;  3BRT B;  3AED C;  4L75 A;  5KAF E;  1E5W A;  1IK9 A;  1N86 C;  2HPC C;  3VN0 A;  3H1J D;  4L73 A;  3HRN A;  2B87 B;  3AE6 C;  1KYO E;  3NMD A;  2GUS A;  2GUV A;  3CWB D;  2WSC J;  2G3A A;  2WWW A;  3H1K E;  2WSC H;  2O3J A;  3P7K A;  2C0W A;  3FXE A;  2O01 N;  1CZQ A;  2WZ7 A;  1JY3 P;  2N1T D;  3USS A;  1MUU A;  1LTJ C;  1FZC C;  2W8Z A;  1RE4 C;  3CD6 P;  1N7S C;  4Y99 B;  1SQB E;  4KJM A;  2HLO C;  5KJ7 A;  1GW3 A;  3Q1M A;  3EFG A;  4A7P A;  1SQP G;  4K3A A;  3HD7 B;  3M06 A;  1FID A; 
#chains in the Genus database with same CATH homology
 3P8M C;  3VP9 A;  3HD7 D;  2KYV A;  2JHL F;  4LC1 A;  2Z5H A;  2YO3 A;  1OXZ A;  1NTM K;  1KIL A;  3TK1 A;  2O1K A;  1S9K D;  2YKP A;  2FXM A;  3HE5 A;  1VDF A;  2XV5 A;  3RK3 B;  3M0A A;  2HLO A;  5APU A;  3B5N C;  1JCC A;  4Y99 C;  2XKM A;  1FOS F;  3M9B A;  2N1T B;  1NTK K;  3E1I B;  1JY3 O;  1GW4 A;  4JF7 A;  3V2N A;  1JC9 A;  1T3J A;  3M9Q A;  3M0D C;  4C7R A;  4WB4 A;  2Z5I A;  2O01 H;  1N73 A;  2FYZ A;  1KQL A;  3VMZ A;  1CI6 B;  1MV8 A;  1T3U A;  2ZFC A;  1GL2 D;  3VMX A;  1X9V A;  1HH0 A;  2J58 A;  1X79 B;  3V2R A;  4XA4 A;  3M0D A;  1SQP K;  1RF1 B;  5APS A;  3EQ2 A;  2JHH C;  2C9N Y;  5AVZ B;  3VMY A;  5BU5 A;  2P67 A;  3L35 A;  1GL2 C;  2QM8 A;  2KLV A;  1IFI A;  2R3C A;  5AW4 B;  1GU5 A;  5BU8 B;  1HWT C;  4GIF A;  1N73 C;  2J64 A;  3VP8 A;  1URQ A;  2Q7C A;  1JTH A;  5AW5 B;  2FFD C;  3M91 A;  1JY2 O;  1NHL A;  2WPR A;  2XU6 A;  3V5B A;  1NWQ A;  3GHG B;  1A02 F;  2OYH C;  5BVZ A;  4AYC A;  5CCG C;  1SQX K;  3B5N A;  2Z4E A;  2XNX B;  2XNX C;  2XNX A;  1ZLL A;  2HFE D;  3HTK A;  3H32 B;  3II6 A;  1G2C A;  3NXS A;  3PP5 A;  1FZE B;  1RE3 B;  3TYY A;  1LTJ A;  4JYC A;  2J1G A;  1N7S D;  3A3Y B;  2FFD B;  1JUN A;  1FZA B;  4LLH A;  5AW1 B;  1IFJ A;  1NTZ K;  2JHI F;  3WMM 0;  1JY2 P;  1N73 B;  1L4A C;  1QL1 A;  1WRG A;  3RK2 B;  3HE4 B;  3G3Z A;  4WY4 A;  1GU4 A;  2N9B A;  5AW2 B;  2E43 A;  2A45 G;  2E42 A;  2Q9I A;  1M7L A;  3H6P A;  1DH3 A;  3U59 A;  2OAR A;  3CL3 D;  1LTG C;  1NH4 A;  1FIC A;  1ZR4 A;  3U1C A;  5KTB A;  1RF0 C;  1MFZ A;  2H8P D;  1YYC A;  1H89 A;  2IPP A;  2WPS A;  3U1A A;  1A02 J;  1PFI A;  1L4A D;  4DZO A;  2J3G A;  2HG5 D;  1M1J B;  3MUD A;  1W2E A;  5AVW B;  1KFM A;  3B5N D;  3L4F A;  4WY4 B;  4W80 A;  2HOD A;  1GL2 A;  2JHK F;  2J3F A;  2IFM A;  1M1J C;  3HUS C;  3LID A;  2YNY A;  4LGD E;  2YKO A;  2J0Y A;  3R2P A;  4XE5 B;  1RE3 A;  2WSE H;  3TSI A;  4M7F A;  1RF0 B;  4R9T A;  1LTT C;  5AVU B;  1JO5 A;  1G1J A;  2KSJ A;  1GDT A;  1N86 A;  2KOG A;  3LW5 H;  3GHG A;  1LWU C;  1DEB A;  1G2C B;  2R5D A;  3HD7 C;  3LIE A;  4N6J A;  1SQV K;  4EOT A;  1FIB A;  4JZC A;  3V2P A;  1LT9 B;  4R9J A;  4N78 E;  2Z4E B;  1HUC A;  5CCH C;  1NAF A;  1KFN A;  1LTS C;  3NFQ A;  1SQQ K;  3B8E B;  1FZF B;  1J1D B;  1FJP A;  3N4X A;  1FZC B;  1FZA C;  1LTJ B;  1IC2 A;  3HE4 A;  4JYO X;  1J1E B;  5APX A;  1FZE A;  4O9B A;  1DX7 A;  1FZE C;  1GK6 A;  2O1J A;  5APY A;  5KLV K;  2NPS D;  1FZB B;  1J2J B;  2P2U A;  1KIL B;  5AW6 B;  4M7H A;  4C7N A;  2WNP F;  2FKW B;  1AFO A;  3TNU A;  3HD7 A;  2ZXE B;  5AW3 B;  1FZD A;  3OJA B;  1FZF A;  3BAT A;  3SWY A;  1GZL A;  4C46 A;  2WIT A;  4IFD K;  1HVV A;  5AVR B;  2M3B A;  4N78 D;  4I2L C;  1FBM A;  2J3O A;  1HGZ A;  3V4Q A;  1RF1 A;  5CJ4 A;  1VPC A;  2XZR A;  2HPC B;  1N86 B;  2HPC A;  3HUS A;  1H8A A;  3M9H A;  1GD2 E;  3MGN A;  3OAK A;  4KHX A;  1JCD A;  1WT6 A;  2P1J A;  5CCG D;  3HUS B;  2LKM A;  2YKQ A;  1NOH A;  4HH2 A;  2M8R A;  1S9K E;  1XTG B;  1JOC A;  1Z3U A;  3O8Z A;  3UIA A;  2D39 A;  3FIB A;  1L0N K;  1T2K C;  3RK3 C;  2OYI B;  1FZB A;  3H32 A;  1SFC A;  4IFF A;  2HYN A;  1IFD A;  2FYU K;  3IFM A;  3MIW A;  4I6M C;  2WT7 B;  5APQ A;  3IR9 A;  3RK2 D;  2IFN A;  2W6B A;  2XDJ A;  2J61 A;  2MJZ A;  2J60 A;  2JEE A;  4OH8 B;  3SWF A;  2H7H A;  3BVH B;  3V2Q A;  3KYQ A;  4C7N B;  4W7Y A;  3RK2 C;  2HLO B;  1MZ9 A;  5CMZ A;  1L4A B;  1JMM A;  1LGH B;  2J5Z A;  1SP4 A;  2N1T A;  3E1I A;  1HBW A;  1KIL D;  5KJ7 C;  3VYI A;  2NPS C;  2L5G B;  2I1K A;  2JHM F;  3H32 C;  1FZB C;  1LTB C;  3KDP B;  4W7Z A;  5APV A;  1URQ C;  1FZC A;  3HTK B;  3BAS A;  2PP6 A;  1KZU B;  2Q5U A;  2OYH B;  1YTZ T;  3BVH A;  2CPS A;  1L0L K;  4IFM A;  3RL0 D;  1AQ5 A;  1FZA A;  2P7J A;  2GY7 A;  1JY3 N;  1J1D C;  2GM4 A;  4WBA A;  1H88 A;  1URQ D;  4GT1 A;  2I1J A;  2J2P A;  1NKZ B;  1LT9 C;  2W6A A;  1GL2 B;  2BAS A;  1LWU B;  1NO4 A;  4AQR D;  1EQ7 A;  1GK4 A;  1Z56 A;  1FZG B;  1RF1 C;  2CPB A;  2A45 I;  3CLQ A;  4N3Y B;  1N2D C;  3RL0 B;  4NYT A;  5AW9 B;  1HTL C;  2J61 B;  2R5B A;  3KPE A;  5APW A;  1M1J A;  4B86 A;  4EIJ A;  2PAJ A;  2W27 A;  1NKN A;  4WY4 D;  2WT7 A;  2POH A;  2Q9I C;  5CJ0 A;  4M3L A;  4WY4 C;  2FIB A;  3N7N A;  5AVV B;  2N1T C;  3E1I C;  1SFC D;  4DOJ A;  3L36 A;  2J0G A;  1CW5 A;  2YMY A;  5APT A;  4AUW A;  1SFC B;  2YO2 A;  4RES B;  3C9I A;  2JJL A;  2KB7 P;  3BVH C;  2H43 B;  1RF0 A;  3OA7 A;  3A5T A;  5AVT B;  3I5C A;  1ZR2 A;  1FU1 A;  2Q3I A;  1JTH B;  2R32 A;  1GTW A;  1T2K D;  4ZFG A;  2H43 A;  3L37 A;  1FJK A;  1LTI C;  1RE4 A;  2OYH A;  3VTP C;  1N7L A;  5CCH A;  2J3U A;  2H43 C;  1CSB A;  1SFC C;  1FDM A;  2J3F D;  2OYI C;  1SLQ A;  3HE5 B;  1LTA C;  1LWU A;  2J0H A;  5AVQ B;  3RK3 D;  2A45 H;  1N7S B;  1FOS E;  1RE4 B;  1NU1 K;  5AW7 B;  1G1I A;  3VOP A;  2Q9I B;  1ZV8 A;  4HYT B;  3P32 A;  1RE3 C;  2QM7 A;  1IFM A;  5CCH D;  3T97 A;  3BRT B;  3P8C D;  1XTC C;  5CCG A;  1RY3 A;  4EPU A;  3RL0 C;  1E5W A;  1IK9 A;  3GHG C;  4GKG A;  2HOD C;  2FFD A;  1N86 C;  1FZG C;  2HPC C;  2WSF H;  5AVY B;  3VN0 A;  3KQG A;  1Z3S A;  5AW8 B;  2WPQ A;  4ZKP A;  3MD0 A;  3HRN A;  1JNM A;  3CI9 A;  1FZG A;  1FAV A;  1JY2 N;  1OWA A;  1ZN5 A;  1T8Z A;  3A7O A;  3NMD A;  2C9L Y;  5AVX B;  2GUS A;  4ZKU A;  1SQB K;  2C0X A;  4JYB A;  2GUV A;  5AVS B;  5AW0 B;  1LT9 A;  2HOD B;  2WWW A;  1KIL C;  2KP8 A;  2WSC H;  5KJ7 D;  1CI6 A;  2VRS A;  1URQ B;  3P7K A;  2C0W A;  3P8C E;  1IO4 A;  1QL2 A;  1CZQ A;  2NPS B;  2WZ7 A;  1JY3 P;  3A2A A;  5CHX A;  2WTY A;  2N1T D;  2J59 M;  2OYI A;  1J1E C;  1IFN A;  4I1L A;  1MUU A;  1YTZ I;  1IJD B;  1LTJ C;  1SVF A;  1FZC C;  1RE4 C;  3TNU B;  1FZF C;  2IX7 C;  1N7S C;  3BRV B;  4Y99 B;  2NPS A;  3B5N B;  1N7S A;  1HGV A;  1X8Y A;  2HLO C;  5KJ7 A;  1GW3 A;  2Z4E C;  3EFG A;  3MTU E;  3V4W A;  3HD7 B;  1L4A A;  3NTN A;  1HJB A;  3M06 A;  1FID A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...