1RE4C

Crystal structure of fragment d of bbetad398a fibrinogen
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
298
structure length
298
Chain Sequence
YEASILTHDSSIRYLQEIYNSNNQKIVNLKEKVAQLEAQCQEPCKDTVQIHDITGKDCQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQSAIPYALRVELEDWNGRTSTADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEGNCAEQDGSGWWMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIPFNRLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibrinogen alpha/alpha-E chain
publication title BbetaGlu397 and BbetaAsp398 but not BbetaAsp432 are required for "B:b" interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
total genus 82
structure length 298
sequence length 298
chains with identical sequence F
ec nomenclature
pdb deposition date 2003-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1re4C01
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 1re4C02
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 1re4C03
1LTJA 1RF1A 2WNPF 1M1JC 2OYIB 1FZEB 2J60A 1FIBA 1RF1C 1FZGC 2Z4EC 2J3OA 1FZFC 4M7FA 1LWUB 3GHGB 2A45G 2Q9IA 2J0HA 2JHKF 2J1GA 1RE3A 2HODA 1T3UA 2Q9IC 2HLOB 1RF0A 2HODC 2OYHC 2J5ZA 1FZCB 2XNXB 1RF0C 1Z3UA 2JHMF 3FIBA 1FZEA 2OYIA 3E1IB 1LTJC 3E1IA 2OYIC 2FFDB 1LT9B 1FZEC 4JZCA 1LT9A 1LWUA 3HUSB 1JY3N 1N73B 3GHGA 1FZDA 2J61B 2J3UA 4NYTA 1RE4B 1Z3SA 1JY2O 1LWUC 2GY7A 4ZFGA 1FZAB 3GHGC 1N86B 1FZBB 2J0YA 1JY2N 2HLOA 2H43B 1RE3C 2J3FD 1FICA 2J64A 3BVHB 4M7HA 2XNXA 1FZCA 2JHLF 2HLOC 4R9JA 1JY3O 2FIBA 3H32B 1FZCC 2XNXC 3H32A 4EPUA 2JHIF 2FFDA 2HPCB 2J0GA 3HUSA 3E1IC 1N73A 2JHHC 2J61A 1M1JB 1JY2P 2FFDC 1LT9C 1RE4A 3HUSC 1FZAA 1N86A 2J2PA 1RF1B 1FZGB 1FZBA 2Z4EB 1FZGA 2Z4EA 1RE4C 1FZFB 2H43A 1FZFA 1FZAC 1FIDA 1N86C 1FZBC 2J3FA 2A45H 3BVHA 1JC9A 2H43C 1W2EA 1JY3P 4JYOX 3BVHC 2Q9IB 2HODB 1RE3B 4R9TA 2OYHB 2HPCA 3H32C 2OYHA 2J3GA 1RF0B 2A45I 1M1JA 1N73C 2HPCC 2D39A 1LTJB
chains in the Genus database with same CATH superfamily
4IFMA 1FZEB 4IL6E 1PP9E 3BCCE 3C9IA 1KYOD 4EOTA 1OFCX 1AV1A 4U3FG 5KKZB 1OW8A 2R5BA 2A45G 2JEEA 2Q9IA 3AE5C 2JHKF 3A2AA 4PD4D 3AEDC 2KZIA 3N4XA 3H1JG 3L75E 1VQMP 4D6TJ 5DJTB 1OVVA 4YXWH 1IFPA 3SWKA 2GA1A 2PFXA 1H88A 1N7SB 4H44C 1VL2A 3C1LA 2W27A 2WSCJ 2FXPA 1N86B 1CZQA 1DD4A 3BRTB 1FJPA 1ZV8A 2KUBA 2GUVA 1GZLA 2LKMA 3CCMP 3N7NA 3ABVC 2ZYAA 1LNQA 1KYOH 3TNUB 3D71A 4KJMA 3Q3DA 1Q2NA 2H7HA 3KZIH 3H32B 3BRVB 3EQ2A 2FBWC 2ZVNB 4PD4H 3E1IC 1BCCE 2KNCA 4EIJA 1VQ8P 4GDOA 4DCKA 2QRXA 4H44D 4RO0A 1FOSE 1H0TB 2K9JA 4U7JA 5AVQB 5B66E 3SWYA 2MJZA 3L36A 3GF7A 2O1JA 1YITP 3L70J 2K37A 1P84D 3F89A 3D70A 1GL2B 4OWFA 3JSVC 3AE9C 2J3OA 1EC5A 3VTPC 1YIJP 3GF3A 1U7JA 1URQB 4YTPC 3H1LD 3ZDMA 2M5AB 3H1KD 1QL1A 1LTJC 3KXDA 5KAFH 4D6TG 1LTTC 3L71D 2J3UA 1FC2C 4C46A 4NPFX 3GHGC 1NOHA 1MUUA 1P84H 1BE3J 5E79E 2R3SA 2A06D 1T3JA 1ZRTD 4TT3H 2QEXP 2KNCB 1EDJA 4BRYA 1SQBD 5GTHH 1M7LA 3MD0A 3L37A 1RE4C 2WPSA 5AW4B 2K9JB 1PPJD 3LIDA 1JC9A 4L76A 1ZW0A 2Y0EA 3HE5A 3TGUD 4JYOX 4AUWA 3AEFC 2WSSH 1NTME 2PRRA 1G2CB 2Q5UA 4HH2A 5AVWB 2A45I 5KLVE 3II6A 1FBMA 1KQFB 2JDIH 2FYUE 3M9QA 2M8RA 2KZJA 4EYYQ 1QL2A 3CWBE 1OIPA 1NTMK 1YTZT 2QG4A 3L70G 3S1KA 1J1DC 3WU2H 5KLVK 2QJPC 2LXBA 3E7KA 4OVNF 2FYUK 2JR8A 3AE6C 2J5ZA 3WUUA 2W90A 1DIPA 3H1ID 2C0XA 2IBZD 3RK3C 1JY3N 1SQXD 1N2DC 1ZMEC 3GHGA 4JYCA 2I8DA 4KHXA 1FZBB 4R4LA 1VF5B 1JY2N 3FWLA 3KDPB 3AEEC 3KPEA 2OTJP 2JHLF 4U3FD 1VQ4P 3CX5E 3H6PA 2XNXC 4PV1C 2YXQB 3O6QB 2VRSA 1BE3G 1NTKE 3H1JD 3B5NB 1OXZA 5AW9B 1AQ5A 1RE4A 2CPBA 1JEKA 3RK3D 2IPPA 4C7NA 2WPQA 4UB8E 2WMMA 1L4AB 3H1HE 1GK6A 3PTZA 1S9KD 1NU1E 3M9BA 1VQ6P 2D2CC 3L74D 1A02F 3H1LJ 3H1KJ 2D39A 3L35A 2WITA 4PV1D 1M1JC 2BCCD 3L71J 1LWUB 5DJUB 3EWKA 1NU1K 2RH0A 3O8ZA 1QVGO 2BEQD 4ASWA 4I7ZB 3FGAD 2KIKA 2POHA 3CCJP 3NFQA 1R8EA 3PH0A 4C7RA 1EXIA 1Z3UA 3FIBA 2P2UA 2D2CD 1JTHA 1KN7A 1FZEC 2FFDB 1NYHA 3GW6A 2YO3A 3T97B 2G8YA 2YKOA 1OW6A 5KKZC 1BSHA 4W7YA 3TGUJ 2IDBA 2QVAA 3HTKB 2K88A 2AEJA 2XNXA 1L0NE 3W67A 4I6MC 2WWWA 2FXOA 2FIBA 2KS1B 4CPGA 3LW5J 2JWDA 1W5CE 1N7SC 1G1IA 1Q82Q 1CI6A 4D6TE 3HD7B 1L0NK 1E79H 1FIDA 1N86C 1LP1A 2J58A 1ZN5A 1TU3F 3JCUE 5CCGC 3IFMA 1MZ9A 3H32C 2WVRA 3VMYA 1M1JA 3MHVA 1Q86Q 2Y9YA 1NAYA 1SS1A 2ZFCA 1N7SD 1VQKP 3H1LG 1OMIA 1S1CX 2QJKB 3H1KG 5APXA 3V2NA 1G1JA 4N3YB 1T3UA 3L71G 2SPZA 4GOEA 3CXHE 5APYA 2Q7CA 1PFIA 2GUSA 1KILE 2P1JA 1FZEA 5CCGD 3AECC 2K1AA 5B5EH 3CMAP 1L0LJ 5C39A 2O01J 1N73B 1GL2C 2ZYDA 3RBXA 2BASA 2YMYA 1SQPD 1Z3SA 4AQRD 5KLIB 2NRGA 2WSCH 5AVZB 3P8CE 5AVXB 2B89A 1Y9BA 2I1JA 3V4QA 4N78D 2Y0CA 1URQC 2IZ0A 3L74J 3TGUG 2M3EA 5BU8B 1KYOI 1N7LA 2BCCJ 1T6AA 1CI6B 1N86A 1MFTA 1KV4A 4QMAA 1GL2D 1VQOP 4PD4I 1YJ9P 3CCRP 4N6JA 5APQA 1SQQE 5AW0B 1RE3B 3KHUA 3L72D 2E75B 4Y28J 2OYHA 3L73D 1IZNB 1URQD 3G4SP 1SVFA 1JO5A 1BE3E 3V6IA 2WPRA 3CCVP 4O9BA 1H0TA 1AFOA 1NVOA 2E76B 2ZXXA 1SQQK 5EFWB 1K8AQ 2IBZG 1VDFA 4WB4A 2ZT9C 3CCQP 2IYPA 1JMBA 5APSA 5APUA 1KYOE 3A0HH 1HF9A 2QJYB 1M56D 1M1KQ 3HE4A 3KZIE 4WVZA 1GL2A 1SQVJ 4PD4E 1YQ3C 2OARA 1Q90D 3G9RA 2L91A 4Y99B 3CC7P 1L0LG 4MN4C 4I2LC 4UB6H 1FICA 1FJKA 4JQ0D 1URQA 1PP9D 2M5AA 1FS0E 3I55P 4RKUJ 2ZT9D 2L5GB 1P84I 2Q3EA 2RKLA 4JPZB 1EQ7A 4RJTA 1NTZG 2ZYGA 3L74G 1RHZB 2WQYC 1S72P 4BXLA 1FZBC 2OGUA 1VF5C 1L2PA 4LGDE 2BCCG 1QGKB 3AEGC 1ZR2A 2GM4A 4XA4A 3UIAA 2HODB 1N8RQ 4IL6X 2OYHB 5KAIH 1KB9D 1OW7A 1QX8A 2W83C 2P7JA 1IO4A 3CCEP 3B5NC 3KQGA 3VMZA 2V4HA 5KAFE 5AW3B 2WSFJ 4R4MA 1KILB 1SQPJ 4DOJA 4PJ0H 1L4AC 1G2CA 4W80A 5TISE 1VF5D 3AE1C 1P84E 3AE3C 1T2KC 1NWQA 3HE4B 2KB7P 1X0TA 1LT9A 1DX7A 2LR2A 5GTIH 1K73Q 1KB9H 4NYTA 2H88C 1LWUC 1CW5A 5GTHE 2YKQA 1SQVG 2J59M 2BEZF 1L4AD 3BVHB 4LLHA 2E74B 1JUNA 1XTCC 2WT7A 3L71E 3L72J 2QA4P 2O1KA 3L73J 3SSUA 1T2KD 3A0BH 2FFDC 1DH3A 1FZBA 1VQNP 2A06E 2AXTE 3TYYA 4OGQB 2KSJA 3O6QA 1SQBE 2G3AA 5B66H 3WU2E 2J3GA 3B5NA 2CPSA 2KP8A 2IBZI 5APWA 3V2PA 1KTMA 1PPJE 2PP6A 3IR9A 1GTWA 1AVYA 2WZ7A 1L4AA 3HD7C 1LJ2A 3AE2C 1FE6A 1SQBK 1SLQA 1HWTC 1YQ4C 2QSIA 3TF5A 1SQPG 1FAVA 2YMKA 3RK2B 1PP9J 3PJSK 3BCCJ 2Q1KA 1CSBA 2W8ZA 3GMAA 1LT9B 1S5LE 3VMXA 1LWUA 1EDKA 1OVUA 1NAFA 3L75J 2QJKC 5AVTB 3HD7D 2HYNA 4YXDC 2W6JH 3H1IE 2C9LY 2IBZE 3CLQA 5E79H 1M8OB 2WT7B 1SQXE 3F5HA 2B9BA 1EZVD 2FFDA 1JCCA 2LXCB 4YPCA 1FDMA 1BGYE 2W6AA 5AW5B 2JHHC 3LW5H 1NH4A 3T97A 3L72G 3CC2P 2KK7A 3NXSA 3L73G 3CI9A 4U3FE 4H0LB 3AEAC 3USSA 3HTKA 3I5CA 5KLIC 1SQXK 3H1JE 2KS1A 3U1CA 2KI7B 4WWIA 3SFEC 2XNDH 1L0LD 3AE4C 3RK3E 1ZP0C 4NPDA 1S5LX 3KYQA 3JC22 5BVZA 3RGUA 1HVVA 2OYIB 3NTNA 4H13B 1DEBA 2M0BA 3HD7A 3WUVA 1VQLP 1VQ9P 3WMM0 1S9KE 1K05A 3CX5D 5KTBA 2HG5D 4XE5B 4HYTB 2HFED 3MP7B 3OAKA 1MKMA 2R32A 5L8RJ 5AW8B 2J1GA 1LGHB 1NTKD 1JB0J 1NTZD 2HLOB 1SFCA 2KYVA 2FYNB 1DD3A 4M3LA 1FZCB 2K3RA 4Z1MH 2W6BA 2PGDA 1LTSC 2XU6A 3H1HD 3VP8A 4JZCA 1PP9G 5H2FH 3BCCG 1S4XA 1FDOA 4DJGA 1PGQA 2O01H 2E76C 2M3BA 1IK7A 2R44A 3L75G 2DW3A 3CX5H 1EDIA 2KLVA 2QJYC 1JM0A 2CK3H 1N73A 3G6EP 1YHQP 2H8PD 2YIUB 1FZGA 1R5LA 4Y99C 2E76D 2PAJA 2NPSB 3U1AA 3VMAA 2E43A 1YJNP 2IFMA 3PP5A 4R9TA 1SQVD 1PV3A 1K04A 1H89A 5CCHC 2ZJSE 3L4FA 2OTLP 2RN0A 1BCCG 2H89C 3G3ZA 5B5EE 3NMDA 3M06A 2YKPA 1NTMJ 3B8EB 1PGPA 5AW2B 3V5BA 1RE3A 3MTUE 5KLVJ 2KSEA 1SFCB 1YBKA 2HODC 2OYHC 3CWBJ 2MKVA 2ITAA 3IF4A 1IFNA 5CCHD 4HKZH 3CPWO 1EXJA 2J61B 1XTGB 5BU5A 5CBNA 2E5YA 2RMZA 1IK9A 1GD2E 5APTA 3D6YA 5AVUB 4M7HA 1R5SA 5AVRB 4R9JA 2B88A 4ZKUA 2JHIF 5KJ7A 2C9NY 1K9MQ 1IFMA 2J2PA 1RF1B 1FZGB 2Z4EA 3CXHD 3MZWB 4N78E 4IFFA 2J3FA 1MFZA 3L70E 4AYCA 1W2EA 4JYBA 4GOFA 1SQPK 1NTKJ 1NTZJ 4TLFA 3BVHC 1RQVA 1PIXA 2E74C 5CCHA 1RF0B 3K5BA 2NZ2A 1VQ7P 3RL0g 2N9YB 3A0HE 1FU1A 3H1HJ 3M0DC 3AE7C 1NU1J 4ZKPA 5CHXA 5AVYB 3L72E 3GG2A 4BWNA 2WSFH 1USEA 2HODA 4RESB 3FXDA 3VOPA 4OGQC 3CXHH 1NTMG 4UB6E 1IC2A 3B4SA 2E74D 5KLVG 1KQSO 3A7OA 2FYUG 1KILA 3RL0B 2Q3IA 3Q2YA 3CWBG 1JY2O 3CC4P 1EZVG 3QWOC 5AW6B 3GLMA 2J0YA 2H43B 1Q81Q 3ITKA 2B87A 3MIWA 1KB9I 2JWAA 2O01N 3RK2C 1PZQA 4OGQD 5KAIE 1VPCA 4ZNCA 1JY2P 1BDDA 1LT9C 4OH8B 1X79B 4IFDK 2Z4EB 3MUDA 2Y0DA 1L0NJ 4XFJA 1FZFA 1U7MA 3BVHA 1S3JA 1JCDA 3BCCD 1DEEG 3P8MC 4PJ0E 2N1TB 4WY4B 2ZXEB 1QVFO 2AEFA 3EFFK 1NKZB 3RK2D 2FKWB 1NTKG 3M0DA 4KT0J 3L75D 1VQPP 3CD6P 1WT6A 3VN0A 1FIBA 1Y47A 1PGJA 4H0LC 3BATA 3HRNA 5GTIE 5AVVB 1KB9E 3H1HG 3A5TA 2JKVA 1NU1G 1AA0A 1KQLA 4IL6H 3P32A 4NPEA 1KORA 1LT1A 2OYIC 1NKNA 4H13C 2J5UA 4JF7A 2K9YA 3HUSB 2FXMA 3A0BE 1LTBC 1FZAB 2WSEH 1BCCD 1YTZI 1USDA 4H0LD 3WUTA 2B87B 1J1EB 1Y8AA 3Q1MA 2HLOC 1KQGB 3Q5SA 2FYNC 1FZCC 2HPCB 3B5ND 3FXEA 2YO2A 5APVA 4K35A 3H1LE 4H13D 4I7ZC 1FZFB 3H1KE 1EDLA 2Z5IA 3TSIA 4GODA 2Q9IB 1L0NG 3V2QA 3R4YA 5K5GB 2FYZA 1HTLC 4L75A 3Q5PA 2WNPF 1GW4A 2YIUC 3W68A 3LIEA 2C0WA 4HJGH 1LTGC 1ZRTE 3M91A 3D6ZA 1SQQJ 1H8AA 2NPSC 5TISH 4LC1A 2XDJA 1KMIZ 1X8YA 2KXPB 1EZVI 1RH5B 2JHMF 2OYIA 3TGUE 1NGMB 2ZVOB 3E1IA 2R5DA 2YXRB 4HB1A 1SP4A 4JBZA 4DT0A 3FWNA 2HLOA 4K3AA 1SFCC 2NPSD 1FZCA 2O3JA 1PL5A 2FY8A 1YYCA 2ZT9B 3AE8C 5TJHA 2WSEJ 2JO1A 1NTMD 3M0AA 1PGOA 3H25A 2V7QH 3CX5I 2E42A 2Z5HA 5KLVD 1Z56A 1S2EA 3BASA 2FYUD 2AXTH 1AQTA 1ZXGA 2QM7A 1EZVE 1UIXA 3CWBD 1M90Q 1WRGA 1KC8Q 2XZRA 1SFCD 1YJWP 1IJDB 1N73C 1LTJA 1GDTA 1M57D 4H44B 3P7KA 1RF1C 5AW1B 1FZGC 1GK4A 4M7FA 2NPSA 5H2FE 2P67A 1L0LE 1BCCJ 2J0HA 1KFNA 1ZLLA 1BGYD 3AEBC 1WMKA 3TK1A 1SQQG 3S9OA 1KD1Q 1A02J 1QLED 1RF0C 5CJ4A 3PHLA 3E1IB 1GMJA 3A3YB 2WPVB 2P10A 2IFNA 1L0LK 1S5LH 4EDFA 2WTYA 1NTZE 1X22A 4BRYB 3L74E 3I56P 4ZFGA 2ZAEB 2QM8A 4L73A 4GIFA 1RE3C 2BCCE 2E75C 1AVOA 1Q7YQ 3HE5B 1OZHA 1NTKK 1NTZK 1KFMA 3EFGA 2J0GA 1FOSF 1NU1D 2J61A 3RL0C 5CJ0A 1IFDA 2A45H 1LTIC 1JMMA 2H43C 4WBAA 1J2JB 2I1KA 2R3CA 5AW7B 2E75D 2AEMA 2V7QJ 1HJ0A 4B86A 5AVSB 2JP3A 1LTJB 4GT1A 5KJ7C 1RF1A 2J60A 2KOGA 4UB8H 3VP9A 2Z4EC 2HR3A 2QIWA 2Y9ZA 3IN6A 3RL0D 2UWJE 1NO4A 1SQBJ 3GHGB 1SQVE 1JOCA 2OQQA 4IOIH 1E5WA 2N1TC 4WY4C 1RF0A 2OTKE 1KZUB 1T8ZA 3FX0A 1L0ND 1RY3A 1SQVK 3CXHI 1OVRA 5KJ7D 4A7PA 1ZOYC 4ZMDA 1RE4B 1X9VA 3SWFA 3QH9A 3PRJA 4C7NB 2FYUJ 1W2BO 2J3FD 2J64A 3CCUP 4D6TD 4I1LA 2N1TD 4WY4D 1RQUA 3CCSP 2QE7H 1KILC 3HUSC 1HGVA 1HH0A 1GW3A 3H1IJ 2H43A 1FZAC 1YI2P 1SQXJ 1HJBA 1NJIQ 1FDIA 1J1DB 2QJPB 1BGYJ 1J1EC 4DZOA 1SQPE 3OW2O 3VYIA 4L74A 1UIIA 2JJLA 4U3FJ 1LTAC 2HPCC 2N9BA 1JTHB 4W7ZA 3RK3B 1ZR4A 4EI2A 3MUDC 3H1JJ 1KILD 1FZFC 3IAOA 1QEXA 2A06G 2N1TA 4WY4A 1HBWA 3JCUH 3OJAB 3RBZA 2Q9IC 2E5TA 4GKGA 1SQBG 2Q6QA 1VQ5P 3U59A 5M1BA 2XNXB 4PV1B 3CCLP 3MGNA 3P8CD 1BSNA 2AXCA 3L70D 3M9HA 1N7SA 1PPJG 3Q5RA 1FZDA 3L73E 2GY7A 3OA7A 3E1RA 1IFIA 2YNYA 3V2RA 1LP1B 1OWAA 3TNUA 2XV5A 2IYOA 1JY3O 2D2CB 1U57A 5CCGA 1MV8A 1HUCA 1OX3A 3C8VA 3H32A 4EPUA 5CBOA 3TDKA 2P58A 3HUSA 2IZ1A 1BDCA 3S4RA 1M1JB 1SQQD 3B71A 2IX7C 1FZAA 1IFJA 1JNMA 3V4WA 3SFDC 1AJYA 1NHLA 4ASVA 1BE3D 1JY3P 1D7MA 1GU4A 2XKMA 2KLUA 1GU5A 3H1IG 3CL3D 3R2PA 2OYOA 3PLNA 1SQXG 5CMZA 2HPCA 3G71P 3CMEP 1HGZA 1BGYG
chains in the Genus database with same CATH topology
2WNPF 1HVVA 4IFMA 2OYIB 3NTNA 1FZEB 1DEBA 1GW4A 3HD7A 3LIEA 3C9IA 2C0WA 1N7SD 2ZFCA 3WMM0 1LTGC 4EOTA 1S9KE 5APXA 3M91A 5KTBA 3V2NA 2HG5D 2R5BA 2A45G 2JEEA 4XE5B 4HYTB 2HFED 1G1JA 1H8AA 3OAKA 4N3YB 2NPSC 2R32A 2Q9IA 2JHKF 3A2AA 5AW8B 2J1GA 1LGHB 1T3UA 3N4XA 2HLOB 1SFCA 4LC1A 2KYVA 2XDJA 5APYA 1X8YA 2Q7CA 1PFIA 4M3LA 2GUSA 1FZCB 2JHMF 2P1JA 1FZEA 5CCGD 2OYIA 2W6BA 1H88A 1LTSC 3E1IA 2XU6A 1N7SB 3VP8A 4JZCA 1N73B 1GL2C 2W27A 2R5DA 2BASA 2O01H 2YMYA 1Z3SA 1SP4A 1N86B 1CZQA 3BRTB 4AQRD 1FJPA 1ZV8A 2GUVA 2HLOA 2WSCH 2M3BA 5AVZB 1GZLA 2LKMA 3P8CE 3N7NA 5AVXB 1FZCA 1SFCC 2NPSD 3TNUB 2I1JA 3V4QA 4N78D 2H7HA 3H32B 2KLVA 1URQC 3BRVB 3EQ2A 1YYCA 3E1IC 5BU8B 1N73A 2H8PD 3M0AA 4EIJA 1N7LA 1CI6B 1N86A 2E42A 1FZGA 2Z5HA 1FOSE 1GL2D 1Z56A 4Y99C 3BASA 2PAJA 2NPSB 2QM7A 3U1AA 2E43A 5AVQB 2IFMA 4N6JA 5APQA 5AW0B 3PP5A 1RE3B 1WRGA 4R9TA 2XZRA 1SFCD 2OYHA 3SWYA 2MJZA 3L36A 1IJDB 1H89A 2O1JA 5CCHC 3L4FA 1N73C 1URQD 3G3ZA 1LTJA 1SVFA 1JO5A 1GDTA 3NMDA 3M06A 1GL2B 3P7KA 2WPRA 1RF1C 5AW1B 1FZGC 1GK4A 4O9BA 2J3OA 1AFOA 4M7FA 2NPSA 2YKPA 3B8EB 3VTPC 2P67A 1SQQK 5AW2B 2J0HA 1KFNA 3V5BA 1VDFA 1ZLLA 1RE3A 3MTUE 4WB4A 1SFCB 3TK1A 2HODC 2OYHC 1URQB 1A02J 5APSA 1RF0C 5APUA 5CJ4A 3HE4A 3E1IB 1GL2A 1LTJC 1QL1A 3A3YB 1IFNA 2IFNA 5CCHD 1L0LK 2WTYA 1LTTC 2OARA 2J61B 2J3UA 1XTGB 4C46A 5BU5A 4ZFGA 4Y99B 3GHGC 1NOHA 2QM8A 1IK9A 1MUUA 4GIFA 1RE3C 1GD2E 5APTA 4I2LC 1FICA 1FJKA 5AVUB 4M7HA 1URQA 5AVRB 4R9JA 3HE5B 1T3JA 4ZKUA 1NTKK 2JHIF 1NTZK 1KFMA 2L5GB 3EFGA 2J0GA 1FOSF 5KJ7A 2J61A 1EQ7A 2C9NY 3RL0C 1IFMA 2J2PA 1RF1B 1FZGB 1M7LA 3MD0A 3L37A 2Z4EA 1RE4C 2WPSA 5AW4B 4N78E 5CJ0A 1IFDA 1FZBC 4IFFA 2J3FA 2A45H 1LTIC 1MFZA 4AYCA 3LIDA 1JC9A 1JMMA 2H43C 1W2EA 4LGDE 3HE5A 1J2JB 4WBAA 2I1KA 2R3CA 4JYBA 4JYOX 1SQPK 5AW7B 2GM4A 1ZR2A 3BVHC 4XA4A 4AUWA 3UIAA 1G2CB 2HODB 2Q5UA 4HH2A 5CCHA 2OYHB 5AVWB 1RF0B 4B86A 2A45I 2P7JA 3II6A 1FBMA 5AVSB 1IO4A 1LTJB 4GT1A 5KJ7C 3B5NC 1RF1A 3KQGA 3M9QA 1FU1A 2J60A 2M8RA 3M0DC 3VMZA 2KOGA 1QL2A 5AW3B 3VP9A 2Z4EC 3RL0D 5CHXA 1KILB 4ZKPA 5AVYB 1NO4A 3GHGB 4DOJA 1NTMK 1YTZT 1L4AC 2WSFH 1JOCA 1G2CA 2HODA 4W80A 4RESB 1J1DC 1E5WA 5KLVK 2N1TC 3VOPA 4WY4C 1RF0A 2FYUK 2J5ZA 1IC2A 1KZUB 1T2KC 1NWQA 3HE4B 2KB7P 1T8ZA 3A7OA 2C0XA 1RY3A 1LT9A 1SQVK 3RK3C 1KILA 1JY3N 5KJ7D 1N2DC 3RL0B 1DX7A 2Q3IA 3GHGA 4JYCA 4NYTA 1RE4B 1JY2O 1LWUC 4KHXA 1X9VA 3SWFA 1CW5A 5AW6B 2YKQA 1FZBB 4C7NB 1JY2N 2J0YA 2H43B 3KDPB 2J3FD 2J59M 3KPEA 1L4AD 2J64A 3BVHB 3MIWA 2JHLF 4LLHA 1JUNA 1XTCC 4I1LA 3RK2C 3H6PA 2WT7A 2N1TD 2XNXC 4WY4D 2O1KA 2VRSA 1VPCA 3B5NB 1T2KD 1OXZA 1JY2P 5AW9B 2FFDC 1LT9C 4OH8B 1AQ5A 1KILC 1RE4A 1DH3A 3HUSC 1X79B 1HGVA 4IFDK 1HH0A 2Z4EB 1FZBA 3MUDA 2CPBA 1GW3A 3RK3D 2IPPA 4C7NA 2H43A 1FZFA 1FZAC 2WPQA 1L4AB 3BVHA 1GK6A 1HJBA 1JCDA 3P8MC 3TYYA 1J1DB 1J1EC 1S9KD 2N1TB 4WY4B 4DZOA 2ZXEB 3M9BA 2KSJA 3VYIA 2J3GA 3B5NA 2CPSA 1NKZB 2KP8A 3RK2D 1A02F 2JJLA 2FKWB 1LTAC 2HPCC 3M0DA 5APWA 3V2PA 3L35A 2D39A 2WITA 2N9BA 1WT6A 1M1JC 3VN0A 2PP6A 3IR9A 1JTHB 4W7ZA 3RK3B 1ZR4A 1GTWA 1FIBA 2WZ7A 1L4AA 1KILD 1FZFC 1LWUB 3HD7C 3BATA 1NU1K 3HRNA 3O8ZA 5AVVB 1SQBK 3A5TA 2N1TA 4WY4A 1SLQA 1HWTC 1HBWA 3OJAB 2POHA 2Q9IC 4GKGA 3NFQA 1FAVA 3RK2B 4C7RA 3U59A 2XNXB 1KQLA 1Z3UA 1CSBA 3FIBA 3P32A 3MGNA 2P2UA 1JTHA 3P8CD 3M9HA 1N7SA 2FFDB 1LT9B 1NKNA 2OYIC 1FZEC 3VMXA 4JF7A 1LWUA 3HUSB 2FXMA 1FZDA 2YO3A 1NAFA 1LTBC 2GY7A 2YKOA 5AVTB 1FZAB 2WSEH 3OA7A 1YTZI 1IFIA 3HD7D 4W7YA 2HYNA 2YNYA 3V2RA 3HTKB 2XNXA 1J1EB 2C9LY 2HLOC 1OWAA 3TNUA 3CLQA 4I6MC 2XV5A 2WWWA 2WT7B 1JY3O 2FIBA 5CCGA 1MV8A 1HUCA 1FZCC 3H32A 4EPUA 2FFDA 1JCCA 2HPCB 3B5ND 3HUSA 1FDMA 2W6AA 5AW5B 2JHHC 3LW5H 1N7SC 1M1JB 1NH4A 2YO2A 3T97A 1G1IA 2IX7C 1FZAA 1IFJA 3NXSA 5APVA 1JNMA 1CI6A 3V4WA 3CI9A 1FZFB 3HD7B 1L0NK 1FIDA 1N86C 2Z5IA 3HTKA 3I5CA 1SQXK 1NHLA 2J58A 3TSIA 1JY3P 1GU4A 2XKMA 1ZN5A 3U1CA 1GU5A 2Q9IB 3CL3D 3R2PA 3V2QA 5CCGC 3IFMA 5CMZA 1MZ9A 2HPCA 3H32C 3VMYA 1M1JA 2FYZA 1HGZA 1HTLC 3KYQA 5BVZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LTJ A;  1RF1 A;  2WNP F;  1M1J C;  2OYI B;  1FZE B;  2J60 A;  1FIB A;  1RF1 C;  1FZG C;  2Z4E C;  2J3O A;  1FZF C;  4M7F A;  1LWU B;  3GHG B;  2A45 G;  2Q9I A;  2J0H A;  2JHK F;  2J1G A;  1RE3 A;  2HOD A;  1T3U A;  2Q9I C;  2HLO B;  1RF0 A;  2HOD C;  2OYH C;  2J5Z A;  1FZC B;  2XNX B;  1RF0 C;  1Z3U A;  2JHM F;  3FIB A;  1FZE A;  2OYI A;  3E1I B;  1LTJ C;  3E1I A;  2OYI C;  2FFD B;  1LT9 B;  1FZE C;  4JZC A;  1LT9 A;  1LWU A;  3HUS B;  1JY3 N;  1N73 B;  3GHG A;  1FZD A;  2J61 B;  2J3U A;  4NYT A;  1RE4 B;  1Z3S A;  1JY2 O;  1LWU C;  2GY7 A;  4ZFG A;  1FZA B;  3GHG C;  1N86 B;  1FZB B;  2J0Y A;  1JY2 N;  2HLO A;  2H43 B;  1RE3 C;  2J3F D;  1FIC A;  2J64 A;  3BVH B;  4M7H A;  2XNX A;  1FZC A;  2JHL F;  2HLO C;  4R9J A;  1JY3 O;  2FIB A;  3H32 B;  1FZC C;  2XNX C;  3H32 A;  4EPU A;  2JHI F;  2FFD A;  2HPC B;  2J0G A;  3HUS A;  3E1I C;  1N73 A;  2JHH C;  2J61 A;  1M1J B;  1JY2 P;  2FFD C;  1LT9 C;  1RE4 A;  3HUS C;  1FZA A;  1N86 A;  2J2P A;  1RF1 B;  1FZG B;  1FZB A;  2Z4E B;  1FZG A;  2Z4E A;  1RE4 C;  1FZF B;  2H43 A;  1FZF A;  1FZA C;  1FID A;  1N86 C;  1FZB C;  2J3F A;  2A45 H;  3BVH A;  1JC9 A;  2H43 C;  1W2E A;  1JY3 P;  4JYO X;  3BVH C;  2Q9I B;  2HOD B;  1RE3 B;  4R9T A;  2OYH B;  2HPC A;  3H32 C;  2OYH A;  2J3G A;  1RF0 B;  2A45 I;  1M1J A;  1N73 C;  2HPC C;  2D39 A;  1LTJ B; 
#chains in the Genus database with same CATH topology
 4IFM A;  1FZE B;  4IL6 E;  1PP9 E;  3BCC E;  3C9I A;  1KYO D;  4EOT A;  1OFC X;  1AV1 A;  4U3F G;  5KKZ B;  1OW8 A;  2R5B A;  2A45 G;  2JEE A;  2Q9I A;  3AE5 C;  2JHK F;  3A2A A;  4PD4 D;  3AED C;  2KZI A;  3N4X A;  3H1J G;  3L75 E;  1VQM P;  4D6T J;  5DJT B;  1OVV A;  4YXW H;  1IFP A;  3SWK A;  2GA1 A;  2PFX A;  1H88 A;  1N7S B;  4H44 C;  1VL2 A;  3C1L A;  2W27 A;  2WSC J;  2FXP A;  1N86 B;  1CZQ A;  1DD4 A;  3BRT B;  1FJP A;  1ZV8 A;  2KUB A;  2GUV A;  1GZL A;  2LKM A;  3CCM P;  3N7N A;  3ABV C;  2ZYA A;  1LNQ A;  1KYO H;  3TNU B;  3D71 A;  4KJM A;  3Q3D A;  1Q2N A;  2H7H A;  3KZI H;  3H32 B;  3BRV B;  3EQ2 A;  2FBW C;  2ZVN B;  4PD4 H;  3E1I C;  1BCC E;  2KNC A;  4EIJ A;  1VQ8 P;  4GDO A;  4DCK A;  2QRX A;  4H44 D;  4RO0 A;  1FOS E;  1H0T B;  2K9J A;  4U7J A;  5AVQ B;  5B66 E;  3SWY A;  2MJZ A;  3L36 A;  3GF7 A;  2O1J A;  1YIT P;  3L70 J;  2K37 A;  1P84 D;  3F89 A;  3D70 A;  1GL2 B;  4OWF A;  3JSV C;  3AE9 C;  2J3O A;  1EC5 A;  3VTP C;  1YIJ P;  3GF3 A;  1U7J A;  1URQ B;  4YTP C;  3H1L D;  3ZDM A;  2M5A B;  3H1K D;  1QL1 A;  1LTJ C;  3KXD A;  5KAF H;  4D6T G;  1LTT C;  3L71 D;  2J3U A;  1FC2 C;  4C46 A;  4NPF X;  3GHG C;  1NOH A;  1MUU A;  1P84 H;  1BE3 J;  5E79 E;  2R3S A;  2A06 D;  1T3J A;  1ZRT D;  4TT3 H;  2QEX P;  2KNC B;  1EDJ A;  4BRY A;  1SQB D;  5GTH H;  1M7L A;  3MD0 A;  3L37 A;  1RE4 C;  2WPS A;  5AW4 B;  2K9J B;  1PPJ D;  3LID A;  1JC9 A;  4L76 A;  1ZW0 A;  2Y0E A;  3HE5 A;  3TGU D;  4JYO X;  4AUW A;  3AEF C;  2WSS H;  1NTM E;  2PRR A;  1G2C B;  2Q5U A;  4HH2 A;  5AVW B;  2A45 I;  5KLV E;  3II6 A;  1FBM A;  1KQF B;  2JDI H;  2FYU E;  3M9Q A;  2M8R A;  2KZJ A;  4EYY Q;  1QL2 A;  3CWB E;  1OIP A;  1NTM K;  1YTZ T;  2QG4 A;  3L70 G;  3S1K A;  1J1D C;  3WU2 H;  5KLV K;  2QJP C;  2LXB A;  3E7K A;  4OVN F;  2FYU K;  2JR8 A;  3AE6 C;  2J5Z A;  3WUU A;  2W90 A;  1DIP A;  3H1I D;  2C0X A;  2IBZ D;  3RK3 C;  1JY3 N;  1SQX D;  1N2D C;  1ZME C;  3GHG A;  4JYC A;  2I8D A;  4KHX A;  1FZB B;  4R4L A;  1VF5 B;  1JY2 N;  3FWL A;  3KDP B;  3AEE C;  3KPE A;  2OTJ P;  2JHL F;  4U3F D;  1VQ4 P;  3CX5 E;  3H6P A;  2XNX C;  4PV1 C;  2YXQ B;  3O6Q B;  2VRS A;  1BE3 G;  1NTK E;  3H1J D;  3B5N B;  1OXZ A;  5AW9 B;  1AQ5 A;  1RE4 A;  2CPB A;  1JEK A;  3RK3 D;  2IPP A;  4C7N A;  2WPQ A;  4UB8 E;  2WMM A;  1L4A B;  3H1H E;  1GK6 A;  3PTZ A;  1S9K D;  1NU1 E;  3M9B A;  1VQ6 P;  2D2C C;  3L74 D;  1A02 F;  3H1L J;  3H1K J;  2D39 A;  3L35 A;  2WIT A;  4PV1 D;  1M1J C;  2BCC D;  3L71 J;  1LWU B;  5DJU B;  3EWK A;  1NU1 K;  2RH0 A;  3O8Z A;  1QVG O;  2BEQ D;  4ASW A;  4I7Z B;  3FGA D;  2KIK A;  2POH A;  3CCJ P;  3NFQ A;  1R8E A;  3PH0 A;  4C7R A;  1EXI A;  1Z3U A;  3FIB A;  2P2U A;  2D2C D;  1JTH A;  1KN7 A;  1FZE C;  2FFD B;  1NYH A;  3GW6 A;  2YO3 A;  3T97 B;  2G8Y A;  2YKO A;  1OW6 A;  5KKZ C;  1BSH A;  4W7Y A;  3TGU J;  2IDB A;  2QVA A;  3HTK B;  2K88 A;  2AEJ A;  2XNX A;  1L0N E;  3W67 A;  4I6M C;  2WWW A;  2FXO A;  2FIB A;  2KS1 B;  4CPG A;  3LW5 J;  2JWD A;  1W5C E;  1N7S C;  1G1I A;  1Q82 Q;  1CI6 A;  4D6T E;  3HD7 B;  1L0N K;  1E79 H;  1FID A;  1N86 C;  1LP1 A;  2J58 A;  1ZN5 A;  1TU3 F;  3JCU E;  5CCG C;  3IFM A;  1MZ9 A;  3H32 C;  2WVR A;  3VMY A;  1M1J A;  3MHV A;  1Q86 Q;  2Y9Y A;  1NAY A;  1SS1 A;  2ZFC A;  1N7S D;  1VQK P;  3H1L G;  1OMI A;  1S1C X;  2QJK B;  3H1K G;  5APX A;  3V2N A;  1G1J A;  4N3Y B;  1T3U A;  3L71 G;  2SPZ A;  4GOE A;  3CXH E;  5APY A;  2Q7C A;  1PFI A;  2GUS A;  1KIL E;  2P1J A;  1FZE A;  5CCG D;  3AEC C;  2K1A A;  5B5E H;  3CMA P;  1L0L J;  5C39 A;  2O01 J;  1N73 B;  1GL2 C;  2ZYD A;  3RBX A;  2BAS A;  2YMY A;  1SQP D;  1Z3S A;  4AQR D;  5KLI B;  2NRG A;  2WSC H;  5AVZ B;  3P8C E;  5AVX B;  2B89 A;  1Y9B A;  2I1J A;  3V4Q A;  4N78 D;  2Y0C A;  1URQ C;  2IZ0 A;  3L74 J;  3TGU G;  2M3E A;  5BU8 B;  1KYO I;  1N7L A;  2BCC J;  1T6A A;  1CI6 B;  1N86 A;  1MFT A;  1KV4 A;  4QMA A;  1GL2 D;  1VQO P;  4PD4 I;  1YJ9 P;  3CCR P;  4N6J A;  5APQ A;  1SQQ E;  5AW0 B;  1RE3 B;  3KHU A;  3L72 D;  2E75 B;  4Y28 J;  2OYH A;  3L73 D;  1IZN B;  1URQ D;  3G4S P;  1SVF A;  1JO5 A;  1BE3 E;  3V6I A;  2WPR A;  3CCV P;  4O9B A;  1H0T A;  1AFO A;  1NVO A;  2E76 B;  2ZXX A;  1SQQ K;  5EFW B;  1K8A Q;  2IBZ G;  1VDF A;  4WB4 A;  2ZT9 C;  3CCQ P;  2IYP A;  1JMB A;  5APS A;  5APU A;  1KYO E;  3A0H H;  1HF9 A;  2QJY B;  1M56 D;  1M1K Q;  3HE4 A;  3KZI E;  4WVZ A;  1GL2 A;  1SQV J;  4PD4 E;  1YQ3 C;  2OAR A;  1Q90 D;  3G9R A;  2L91 A;  4Y99 B;  3CC7 P;  1L0L G;  4MN4 C;  4I2L C;  4UB6 H;  1FIC A;  1FJK A;  4JQ0 D;  1URQ A;  1PP9 D;  2M5A A;  1FS0 E;  3I55 P;  4RKU J;  2ZT9 D;  2L5G B;  1P84 I;  2Q3E A;  2RKL A;  4JPZ B;  1EQ7 A;  4RJT A;  1NTZ G;  2ZYG A;  3L74 G;  1RHZ B;  2WQY C;  1S72 P;  4BXL A;  1FZB C;  2OGU A;  1VF5 C;  1L2P A;  4LGD E;  2BCC G;  1QGK B;  3AEG C;  1ZR2 A;  2GM4 A;  4XA4 A;  3UIA A;  2HOD B;  1N8R Q;  4IL6 X;  2OYH B;  5KAI H;  1KB9 D;  1OW7 A;  1QX8 A;  2W83 C;  2P7J A;  1IO4 A;  3CCE P;  3B5N C;  3KQG A;  3VMZ A;  2V4H A;  5KAF E;  5AW3 B;  2WSF J;  4R4M A;  1KIL B;  1SQP J;  4DOJ A;  4PJ0 H;  1L4A C;  1G2C A;  4W80 A;  5TIS E;  1VF5 D;  3AE1 C;  1P84 E;  3AE3 C;  1T2K C;  1NWQ A;  3HE4 B;  2KB7 P;  1X0T A;  1LT9 A;  1DX7 A;  2LR2 A;  5GTI H;  1K73 Q;  1KB9 H;  4NYT A;  2H88 C;  1LWU C;  1CW5 A;  5GTH E;  2YKQ A;  1SQV G;  2J59 M;  2BEZ F;  1L4A D;  3BVH B;  4LLH A;  2E74 B;  1JUN A;  1XTC C;  2WT7 A;  3L71 E;  3L72 J;  2QA4 P;  2O1K A;  3L73 J;  3SSU A;  1T2K D;  3A0B H;  2FFD C;  1DH3 A;  1FZB A;  1VQN P;  2A06 E;  2AXT E;  3TYY A;  4OGQ B;  2KSJ A;  3O6Q A;  1SQB E;  2G3A A;  5B66 H;  3WU2 E;  2J3G A;  3B5N A;  2CPS A;  2KP8 A;  2IBZ I;  5APW A;  3V2P A;  1KTM A;  1PPJ E;  2PP6 A;  3IR9 A;  1GTW A;  1AVY A;  2WZ7 A;  1L4A A;  3HD7 C;  1LJ2 A;  3AE2 C;  1FE6 A;  1SQB K;  1SLQ A;  1HWT C;  1YQ4 C;  2QSI A;  3TF5 A;  1SQP G;  1FAV A;  2YMK A;  3RK2 B;  1PP9 J;  3PJS K;  3BCC J;  2Q1K A;  1CSB A;  2W8Z A;  3GMA A;  1LT9 B;  1S5L E;  3VMX A;  1LWU A;  1EDK A;  1OVU A;  1NAF A;  3L75 J;  2QJK C;  5AVT B;  3HD7 D;  2HYN A;  4YXD C;  2W6J H;  3H1I E;  2C9L Y;  2IBZ E;  3CLQ A;  5E79 H;  1M8O B;  2WT7 B;  1SQX E;  3F5H A;  2B9B A;  1EZV D;  2FFD A;  1JCC A;  2LXC B;  4YPC A;  1FDM A;  1BGY E;  2W6A A;  5AW5 B;  2JHH C;  3LW5 H;  1NH4 A;  3T97 A;  3L72 G;  3CC2 P;  2KK7 A;  3NXS A;  3L73 G;  3CI9 A;  4U3F E;  4H0L B;  3AEA C;  3USS A;  3HTK A;  3I5C A;  5KLI C;  1SQX K;  3H1J E;  2KS1 A;  3U1C A;  2KI7 B;  4WWI A;  3SFE C;  2XND H;  1L0L D;  3AE4 C;  3RK3 E;  1ZP0 C;  4NPD A;  1S5L X;  3KYQ A;  3JC2 2;  5BVZ A;  3RGU A;  1HVV A;  2OYI B;  3NTN A;  4H13 B;  1DEB A;  2M0B A;  3HD7 A;  3WUV A;  1VQL P;  1VQ9 P;  3WMM 0;  1S9K E;  1K05 A;  3CX5 D;  5KTB A;  2HG5 D;  4XE5 B;  4HYT B;  2HFE D;  3MP7 B;  3OAK A;  1MKM A;  2R32 A;  5L8R J;  5AW8 B;  2J1G A;  1LGH B;  1NTK D;  1JB0 J;  1NTZ D;  2HLO B;  1SFC A;  2KYV A;  2FYN B;  1DD3 A;  4M3L A;  1FZC B;  2K3R A;  4Z1M H;  2W6B A;  2PGD A;  1LTS C;  2XU6 A;  3H1H D;  3VP8 A;  4JZC A;  1PP9 G;  5H2F H;  3BCC G;  1S4X A;  1FDO A;  4DJG A;  1PGQ A;  2O01 H;  2E76 C;  2M3B A;  1IK7 A;  2R44 A;  3L75 G;  2DW3 A;  3CX5 H;  1EDI A;  2KLV A;  2QJY C;  1JM0 A;  2CK3 H;  1N73 A;  3G6E P;  1YHQ P;  2H8P D;  2YIU B;  1FZG A;  1R5L A;  4Y99 C;  2E76 D;  2PAJ A;  2NPS B;  3U1A A;  3VMA A;  2E43 A;  1YJN P;  2IFM A;  3PP5 A;  4R9T A;  1SQV D;  1PV3 A;  1K04 A;  1H89 A;  5CCH C;  2ZJS E;  3L4F A;  2OTL P;  2RN0 A;  1BCC G;  2H89 C;  3G3Z A;  5B5E E;  3NMD A;  3M06 A;  2YKP A;  1NTM J;  3B8E B;  1PGP A;  5AW2 B;  3V5B A;  1RE3 A;  3MTU E;  5KLV J;  2KSE A;  1SFC B;  1YBK A;  2HOD C;  2OYH C;  3CWB J;  2MKV A;  2ITA A;  3IF4 A;  1IFN A;  5CCH D;  4HKZ H;  3CPW O;  1EXJ A;  2J61 B;  1XTG B;  5BU5 A;  5CBN A;  2E5Y A;  2RMZ A;  1IK9 A;  1GD2 E;  5APT A;  3D6Y A;  5AVU B;  4M7H A;  1R5S A;  5AVR B;  4R9J A;  2B88 A;  4ZKU A;  2JHI F;  5KJ7 A;  2C9N Y;  1K9M Q;  1IFM A;  2J2P A;  1RF1 B;  1FZG B;  2Z4E A;  3CXH D;  3MZW B;  4N78 E;  4IFF A;  2J3F A;  1MFZ A;  3L70 E;  4AYC A;  1W2E A;  4JYB A;  4GOF A;  1SQP K;  1NTK J;  1NTZ J;  4TLF A;  3BVH C;  1RQV A;  1PIX A;  2E74 C;  5CCH A;  1RF0 B;  3K5B A;  2NZ2 A;  1VQ7 P;  3RL0 g;  2N9Y B;  3A0H E;  1FU1 A;  3H1H J;  3M0D C;  3AE7 C;  1NU1 J;  4ZKP A;  5CHX A;  5AVY B;  3L72 E;  3GG2 A;  4BWN A;  2WSF H;  1USE A;  2HOD A;  4RES B;  3FXD A;  3VOP A;  4OGQ C;  3CXH H;  1NTM G;  4UB6 E;  1IC2 A;  3B4S A;  2E74 D;  5KLV G;  1KQS O;  3A7O A;  2FYU G;  1KIL A;  3RL0 B;  2Q3I A;  3Q2Y A;  3CWB G;  1JY2 O;  3CC4 P;  1EZV G;  3QWO C;  5AW6 B;  3GLM A;  2J0Y A;  2H43 B;  1Q81 Q;  3ITK A;  2B87 A;  3MIW A;  1KB9 I;  2JWA A;  2O01 N;  3RK2 C;  1PZQ A;  4OGQ D;  5KAI E;  1VPC A;  4ZNC A;  1JY2 P;  1BDD A;  1LT9 C;  4OH8 B;  1X79 B;  4IFD K;  2Z4E B;  3MUD A;  2Y0D A;  1L0N J;  4XFJ A;  1FZF A;  1U7M A;  3BVH A;  1S3J A;  1JCD A;  3BCC D;  1DEE G;  3P8M C;  4PJ0 E;  2N1T B;  4WY4 B;  2ZXE B;  1QVF O;  2AEF A;  3EFF K;  1NKZ B;  3RK2 D;  2FKW B;  1NTK G;  3M0D A;  4KT0 J;  3L75 D;  1VQP P;  3CD6 P;  1WT6 A;  3VN0 A;  1FIB A;  1Y47 A;  1PGJ A;  4H0L C;  3BAT A;  3HRN A;  5GTI E;  5AVV B;  1KB9 E;  3H1H G;  3A5T A;  2JKV A;  1NU1 G;  1AA0 A;  1KQL A;  4IL6 H;  3P32 A;  4NPE A;  1KOR A;  1LT1 A;  2OYI C;  1NKN A;  4H13 C;  2J5U A;  4JF7 A;  2K9Y A;  3HUS B;  2FXM A;  3A0B E;  1LTB C;  1FZA B;  2WSE H;  1BCC D;  1YTZ I;  1USD A;  4H0L D;  3WUT A;  2B87 B;  1J1E B;  1Y8A A;  3Q1M A;  2HLO C;  1KQG B;  3Q5S A;  2FYN C;  1FZC C;  2HPC B;  3B5N D;  3FXE A;  2YO2 A;  5APV A;  4K35 A;  3H1L E;  4H13 D;  4I7Z C;  1FZF B;  3H1K E;  1EDL A;  2Z5I A;  3TSI A;  4GOD A;  2Q9I B;  1L0N G;  3V2Q A;  3R4Y A;  5K5G B;  2FYZ A;  1HTL C;  4L75 A;  3Q5P A;  2WNP F;  1GW4 A;  2YIU C;  3W68 A;  3LIE A;  2C0W A;  4HJG H;  1LTG C;  1ZRT E;  3M91 A;  3D6Z A;  1SQQ J;  1H8A A;  2NPS C;  5TIS H;  4LC1 A;  2XDJ A;  1KMI Z;  1X8Y A;  2KXP B;  1EZV I;  1RH5 B;  2JHM F;  2OYI A;  3TGU E;  1NGM B;  2ZVO B;  3E1I A;  2R5D A;  2YXR B;  4HB1 A;  1SP4 A;  4JBZ A;  4DT0 A;  3FWN A;  2HLO A;  4K3A A;  1SFC C;  2NPS D;  1FZC A;  2O3J A;  1PL5 A;  2FY8 A;  1YYC A;  2ZT9 B;  3AE8 C;  5TJH A;  2WSE J;  2JO1 A;  1NTM D;  3M0A A;  1PGO A;  3H25 A;  2V7Q H;  3CX5 I;  2E42 A;  2Z5H A;  5KLV D;  1Z56 A;  1S2E A;  3BAS A;  2FYU D;  2AXT H;  1AQT A;  1ZXG A;  2QM7 A;  1EZV E;  1UIX A;  3CWB D;  1M90 Q;  1WRG A;  1KC8 Q;  2XZR A;  1SFC D;  1YJW P;  1IJD B;  1N73 C;  1LTJ A;  1GDT A;  1M57 D;  4H44 B;  3P7K A;  1RF1 C;  5AW1 B;  1FZG C;  1GK4 A;  4M7F A;  2NPS A;  5H2F E;  2P67 A;  1L0L E;  1BCC J;  2J0H A;  1KFN A;  1ZLL A;  1BGY D;  3AEB C;  1WMK A;  3TK1 A;  1SQQ G;  3S9O A;  1KD1 Q;  1A02 J;  1QLE D;  1RF0 C;  5CJ4 A;  3PHL A;  3E1I B;  1GMJ A;  3A3Y B;  2WPV B;  2P10 A;  2IFN A;  1L0L K;  1S5L H;  4EDF A;  2WTY A;  1NTZ E;  1X22 A;  4BRY B;  3L74 E;  3I56 P;  4ZFG A;  2ZAE B;  2QM8 A;  4L73 A;  4GIF A;  1RE3 C;  2BCC E;  2E75 C;  1AVO A;  1Q7Y Q;  3HE5 B;  1OZH A;  1NTK K;  1NTZ K;  1KFM A;  3EFG A;  2J0G A;  1FOS F;  1NU1 D;  2J61 A;  3RL0 C;  5CJ0 A;  1IFD A;  2A45 H;  1LTI C;  1JMM A;  2H43 C;  4WBA A;  1J2J B;  2I1K A;  2R3C A;  5AW7 B;  2E75 D;  2AEM A;  2V7Q J;  1HJ0 A;  4B86 A;  5AVS B;  2JP3 A;  1LTJ B;  4GT1 A;  5KJ7 C;  1RF1 A;  2J60 A;  2KOG A;  4UB8 H;  3VP9 A;  2Z4E C;  2HR3 A;  2QIW A;  2Y9Z A;  3IN6 A;  3RL0 D;  2UWJ E;  1NO4 A;  1SQB J;  3GHG B;  1SQV E;  1JOC A;  2OQQ A;  4IOI H;  1E5W A;  2N1T C;  4WY4 C;  1RF0 A;  2OTK E;  1KZU B;  1T8Z A;  3FX0 A;  1L0N D;  1RY3 A;  1SQV K;  3CXH I;  1OVR A;  5KJ7 D;  4A7P A;  1ZOY C;  4ZMD A;  1RE4 B;  1X9V A;  3SWF A;  3QH9 A;  3PRJ A;  4C7N B;  2FYU J;  1W2B O;  2J3F D;  2J64 A;  3CCU P;  4D6T D;  4I1L A;  2N1T D;  4WY4 D;  1RQU A;  3CCS P;  2QE7 H;  1KIL C;  3HUS C;  1HGV A;  1HH0 A;  1GW3 A;  3H1I J;  2H43 A;  1FZA C;  1YI2 P;  1SQX J;  1HJB A;  1NJI Q;  1FDI A;  1J1D B;  2QJP B;  1BGY J;  1J1E C;  4DZO A;  1SQP E;  3OW2 O;  3VYI A;  4L74 A;  1UII A;  2JJL A;  4U3F J;  1LTA C;  2HPC C;  2N9B A;  1JTH B;  4W7Z A;  3RK3 B;  1ZR4 A;  4EI2 A;  3MUD C;  3H1J J;  1KIL D;  1FZF C;  3IAO A;  1QEX A;  2A06 G;  2N1T A;  4WY4 A;  1HBW A;  3JCU H;  3OJA B;  3RBZ A;  2Q9I C;  2E5T A;  4GKG A;  1SQB G;  2Q6Q A;  1VQ5 P;  3U59 A;  5M1B A;  2XNX B;  4PV1 B;  3CCL P;  3MGN A;  3P8C D;  1BSN A;  2AXC A;  3L70 D;  3M9H A;  1N7S A;  1PPJ G;  3Q5R A;  1FZD A;  3L73 E;  2GY7 A;  3OA7 A;  3E1R A;  1IFI A;  2YNY A;  3V2R A;  1LP1 B;  1OWA A;  3TNU A;  2XV5 A;  2IYO A;  1JY3 O;  2D2C B;  1U57 A;  5CCG A;  1MV8 A;  1HUC A;  1OX3 A;  3C8V A;  3H32 A;  4EPU A;  5CBO A;  3TDK A;  2P58 A;  3HUS A;  2IZ1 A;  1BDC A;  3S4R A;  1M1J B;  1SQQ D;  3B71 A;  2IX7 C;  1FZA A;  1IFJ A;  1JNM A;  3V4W A;  3SFD C;  1AJY A;  1NHL A;  4ASV A;  1BE3 D;  1JY3 P;  1D7M A;  1GU4 A;  2XKM A;  2KLU A;  1GU5 A;  3H1I G;  3CL3 D;  3R2P A;  2OYO A;  3PLN A;  1SQX G;  5CMZ A;  2HPC A;  3G71 P;  3CME P;  1HGZ A;  1BGY G; 
#chains in the Genus database with same CATH homology
 2WNP F;  1HVV A;  4IFM A;  2OYI B;  3NTN A;  1FZE B;  1DEB A;  1GW4 A;  3HD7 A;  3LIE A;  3C9I A;  2C0W A;  1N7S D;  2ZFC A;  3WMM 0;  1LTG C;  4EOT A;  1S9K E;  5APX A;  3M91 A;  5KTB A;  3V2N A;  2HG5 D;  2R5B A;  2A45 G;  2JEE A;  4XE5 B;  4HYT B;  2HFE D;  1G1J A;  1H8A A;  3OAK A;  4N3Y B;  2NPS C;  2R32 A;  2Q9I A;  2JHK F;  3A2A A;  5AW8 B;  2J1G A;  1LGH B;  1T3U A;  3N4X A;  2HLO B;  1SFC A;  4LC1 A;  2KYV A;  2XDJ A;  5APY A;  1X8Y A;  2Q7C A;  1PFI A;  4M3L A;  2GUS A;  1FZC B;  2JHM F;  2P1J A;  1FZE A;  5CCG D;  2OYI A;  2W6B A;  1H88 A;  1LTS C;  3E1I A;  2XU6 A;  1N7S B;  3VP8 A;  4JZC A;  1N73 B;  1GL2 C;  2W27 A;  2R5D A;  2BAS A;  2O01 H;  2YMY A;  1Z3S A;  1SP4 A;  1N86 B;  1CZQ A;  3BRT B;  4AQR D;  1FJP A;  1ZV8 A;  2GUV A;  2HLO A;  2WSC H;  2M3B A;  5AVZ B;  1GZL A;  2LKM A;  3P8C E;  3N7N A;  5AVX B;  1FZC A;  1SFC C;  2NPS D;  3TNU B;  2I1J A;  3V4Q A;  4N78 D;  2H7H A;  3H32 B;  2KLV A;  1URQ C;  3BRV B;  3EQ2 A;  1YYC A;  3E1I C;  5BU8 B;  1N73 A;  2H8P D;  3M0A A;  4EIJ A;  1N7L A;  1CI6 B;  1N86 A;  2E42 A;  1FZG A;  2Z5H A;  1FOS E;  1GL2 D;  1Z56 A;  4Y99 C;  3BAS A;  2PAJ A;  2NPS B;  2QM7 A;  3U1A A;  2E43 A;  5AVQ B;  2IFM A;  4N6J A;  5APQ A;  5AW0 B;  3PP5 A;  1RE3 B;  1WRG A;  4R9T A;  2XZR A;  1SFC D;  2OYH A;  3SWY A;  2MJZ A;  3L36 A;  1IJD B;  1H89 A;  2O1J A;  5CCH C;  3L4F A;  1N73 C;  1URQ D;  3G3Z A;  1LTJ A;  1SVF A;  1JO5 A;  1GDT A;  3NMD A;  3M06 A;  1GL2 B;  3P7K A;  2WPR A;  1RF1 C;  5AW1 B;  1FZG C;  1GK4 A;  4O9B A;  2J3O A;  1AFO A;  4M7F A;  2NPS A;  2YKP A;  3B8E B;  3VTP C;  2P67 A;  1SQQ K;  5AW2 B;  2J0H A;  1KFN A;  3V5B A;  1VDF A;  1ZLL A;  1RE3 A;  3MTU E;  4WB4 A;  1SFC B;  3TK1 A;  2HOD C;  2OYH C;  1URQ B;  1A02 J;  5APS A;  1RF0 C;  5APU A;  5CJ4 A;  3HE4 A;  3E1I B;  1GL2 A;  1LTJ C;  1QL1 A;  3A3Y B;  1IFN A;  2IFN A;  5CCH D;  1L0L K;  2WTY A;  1LTT C;  2OAR A;  2J61 B;  2J3U A;  1XTG B;  4C46 A;  5BU5 A;  4ZFG A;  4Y99 B;  3GHG C;  1NOH A;  2QM8 A;  1IK9 A;  1MUU A;  4GIF A;  1RE3 C;  1GD2 E;  5APT A;  4I2L C;  1FIC A;  1FJK A;  5AVU B;  4M7H A;  1URQ A;  5AVR B;  4R9J A;  3HE5 B;  1T3J A;  4ZKU A;  1NTK K;  2JHI F;  1NTZ K;  1KFM A;  2L5G B;  3EFG A;  2J0G A;  1FOS F;  5KJ7 A;  2J61 A;  1EQ7 A;  2C9N Y;  3RL0 C;  1IFM A;  2J2P A;  1RF1 B;  1FZG B;  1M7L A;  3MD0 A;  3L37 A;  2Z4E A;  1RE4 C;  2WPS A;  5AW4 B;  4N78 E;  5CJ0 A;  1IFD A;  1FZB C;  4IFF A;  2J3F A;  2A45 H;  1LTI C;  1MFZ A;  4AYC A;  3LID A;  1JC9 A;  1JMM A;  2H43 C;  1W2E A;  4LGD E;  3HE5 A;  1J2J B;  4WBA A;  2I1K A;  2R3C A;  4JYB A;  4JYO X;  1SQP K;  5AW7 B;  2GM4 A;  1ZR2 A;  3BVH C;  4XA4 A;  4AUW A;  3UIA A;  1G2C B;  2HOD B;  2Q5U A;  4HH2 A;  5CCH A;  2OYH B;  5AVW B;  1RF0 B;  4B86 A;  2A45 I;  2P7J A;  3II6 A;  1FBM A;  5AVS B;  1IO4 A;  1LTJ B;  4GT1 A;  5KJ7 C;  3B5N C;  1RF1 A;  3KQG A;  3M9Q A;  1FU1 A;  2J60 A;  2M8R A;  3M0D C;  3VMZ A;  2KOG A;  1QL2 A;  5AW3 B;  3VP9 A;  2Z4E C;  3RL0 D;  5CHX A;  1KIL B;  4ZKP A;  5AVY B;  1NO4 A;  3GHG B;  4DOJ A;  1NTM K;  1YTZ T;  1L4A C;  2WSF H;  1JOC A;  1G2C A;  2HOD A;  4W80 A;  4RES B;  1J1D C;  1E5W A;  5KLV K;  2N1T C;  3VOP A;  4WY4 C;  1RF0 A;  2FYU K;  2J5Z A;  1IC2 A;  1KZU B;  1T2K C;  1NWQ A;  3HE4 B;  2KB7 P;  1T8Z A;  3A7O A;  2C0X A;  1RY3 A;  1LT9 A;  1SQV K;  3RK3 C;  1KIL A;  1JY3 N;  5KJ7 D;  1N2D C;  3RL0 B;  1DX7 A;  2Q3I A;  3GHG A;  4JYC A;  4NYT A;  1RE4 B;  1JY2 O;  1LWU C;  4KHX A;  1X9V A;  3SWF A;  1CW5 A;  5AW6 B;  2YKQ A;  1FZB B;  4C7N B;  1JY2 N;  2J0Y A;  2H43 B;  3KDP B;  2J3F D;  2J59 M;  3KPE A;  1L4A D;  2J64 A;  3BVH B;  3MIW A;  2JHL F;  4LLH A;  1JUN A;  1XTC C;  4I1L A;  3RK2 C;  3H6P A;  2WT7 A;  2N1T D;  2XNX C;  4WY4 D;  2O1K A;  2VRS A;  1VPC A;  3B5N B;  1T2K D;  1OXZ A;  1JY2 P;  5AW9 B;  2FFD C;  1LT9 C;  4OH8 B;  1AQ5 A;  1KIL C;  1RE4 A;  1DH3 A;  3HUS C;  1X79 B;  1HGV A;  4IFD K;  1HH0 A;  2Z4E B;  1FZB A;  3MUD A;  2CPB A;  1GW3 A;  3RK3 D;  2IPP A;  4C7N A;  2H43 A;  1FZF A;  1FZA C;  2WPQ A;  1L4A B;  3BVH A;  1GK6 A;  1HJB A;  1JCD A;  3P8M C;  3TYY A;  1J1D B;  1J1E C;  1S9K D;  2N1T B;  4WY4 B;  4DZO A;  2ZXE B;  3M9B A;  2KSJ A;  3VYI A;  2J3G A;  3B5N A;  2CPS A;  1NKZ B;  2KP8 A;  3RK2 D;  1A02 F;  2JJL A;  2FKW B;  1LTA C;  2HPC C;  3M0D A;  5APW A;  3V2P A;  3L35 A;  2D39 A;  2WIT A;  2N9B A;  1WT6 A;  1M1J C;  3VN0 A;  2PP6 A;  3IR9 A;  1JTH B;  4W7Z A;  3RK3 B;  1ZR4 A;  1GTW A;  1FIB A;  2WZ7 A;  1L4A A;  1KIL D;  1FZF C;  1LWU B;  3HD7 C;  3BAT A;  1NU1 K;  3HRN A;  3O8Z A;  5AVV B;  1SQB K;  3A5T A;  2N1T A;  4WY4 A;  1SLQ A;  1HWT C;  1HBW A;  3OJA B;  2POH A;  2Q9I C;  4GKG A;  3NFQ A;  1FAV A;  3RK2 B;  4C7R A;  3U59 A;  2XNX B;  1KQL A;  1Z3U A;  1CSB A;  3FIB A;  3P32 A;  3MGN A;  2P2U A;  1JTH A;  3P8C D;  3M9H A;  1N7S A;  2FFD B;  1LT9 B;  1NKN A;  2OYI C;  1FZE C;  3VMX A;  4JF7 A;  1LWU A;  3HUS B;  2FXM A;  1FZD A;  2YO3 A;  1NAF A;  1LTB C;  2GY7 A;  2YKO A;  5AVT B;  1FZA B;  2WSE H;  3OA7 A;  1YTZ I;  1IFI A;  3HD7 D;  4W7Y A;  2HYN A;  2YNY A;  3V2R A;  3HTK B;  2XNX A;  1J1E B;  2C9L Y;  2HLO C;  1OWA A;  3TNU A;  3CLQ A;  4I6M C;  2XV5 A;  2WWW A;  2WT7 B;  1JY3 O;  2FIB A;  5CCG A;  1MV8 A;  1HUC A;  1FZC C;  3H32 A;  4EPU A;  2FFD A;  1JCC A;  2HPC B;  3B5N D;  3HUS A;  1FDM A;  2W6A A;  5AW5 B;  2JHH C;  3LW5 H;  1N7S C;  1M1J B;  1NH4 A;  2YO2 A;  3T97 A;  1G1I A;  2IX7 C;  1FZA A;  1IFJ A;  3NXS A;  5APV A;  1JNM A;  1CI6 A;  3V4W A;  3CI9 A;  1FZF B;  3HD7 B;  1L0N K;  1FID A;  1N86 C;  2Z5I A;  3HTK A;  3I5C A;  1SQX K;  1NHL A;  2J58 A;  3TSI A;  1JY3 P;  1GU4 A;  2XKM A;  1ZN5 A;  3U1C A;  1GU5 A;  2Q9I B;  3CL3 D;  3R2P A;  3V2Q A;  5CCG C;  3IFM A;  5CMZ A;  1MZ9 A;  2HPC A;  3H32 C;  3VMY A;  1M1J A;  2FYZ A;  1HGZ A;  1HTL C;  3KYQ A;  5BVZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...