1RE4C

Crystal structure of fragment d of bbetad398a fibrinogen
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
298
structure length
298
Chain Sequence
YEASILTHDSSIRYLQEIYNSNNQKIVNLKEKVAQLEAQCQEPCKDTVQIHDITGKDCQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQSAIPYALRVELEDWNGRTSTADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEGNCAEQDGSGWWMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIPFNRLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title BbetaGlu397 and BbetaAsp398 but not BbetaAsp432 are required for "B:b" interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
molecule keywords Fibrinogen alpha/alpha-E chain
total genus 82
structure length 298
sequence length 298
chains with identical sequence F
ec nomenclature
pdb deposition date 2003-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1re4C01
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 1re4C02
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 1re4C03
3E1IC 1FZFB 2J5ZA 1JY3P 2OYIA 1FZCA 2GY7A 2J3UA 2OYIB 1FZEB 1LT9A 1FZGC 2OYIC 1Z3UA 2XNXC 1LWUC 1FZBB 1FICA 1LTJC 1M1JB 1RE4C 1RE3A 3HUSB 3H32B 2Z4EB 3GHGA 1W2EA 1RE4A 1FZAC 2OYHB 2A45I 3GHGB 4R9JA 2H43B 1JY3O 1FZFA 2FFDC 1FZEC 1N86C 1JY2N 1RF0B 2HLOA 1FZEA 1FZFC 1RE3C 1FIDA 3GHGC 1LTJB 1M1JC 4EPUA 2Z4EA 2FIBA 1FZGA 1LT9B 2A45H 3H32A 2FFDB 2D39A 1RE4B 2J0YA 1JY2O 1LWUA 1FIBA 4NYTA 4ZFGA 1LTJA 2HLOC 1JY3N 2J0GA 1RF1B 4M7HA 3FIBA 1FZCC 2JHIF 2JHKF 2J60A 1N73A 2H43A 2OYHA 1RF0C 1N73B 2XNXA 2FFDA 1N73C 2J1GA 4M7FA 1RF0A 1FZDA 3E1IA 2J0HA 2HODB 2JHHC 2J2PA 1FZBA 2HPCB 2HPCC 3BVHB 2J61B 1T3UA 3H32C 2WNPF 2XNXB 1FZAA 1N86B 2HPCA 2JHMF 3BVHA 2J3GA 1JC9A 2J3FD 1JY2P 2J3OA 1RF1C 1Z3SA 2Q9IA 2J3FA 1FZCB 1LWUB 1RF1A 3BVHC 3HUSC 2HODC 2J61A 1M1JA 1FZAB 3HUSA 1RE3B 4JZCA 1FZGB 2JHLF 2J64A 2OYHC 1LT9C 2H43C 2Q9IC 4R9TA 2Z4EC 1N86A 2Q9IB 4JYOX 2A45G 2HLOB 2HODA 3E1IB 1FZBC
chains in the Genus database with same CATH superfamily
1PZQA 3U59A 3KHUA 2OYIB 4PV1D 1LT9A 1XTGB 3B5NA 1G2CB 4RO0A 1PGPA 4OH8B 1M1KQ 1SQPG 3S1KA 4AYCA 5CBNA 2NPSA 1J1EB 2ZYDA 1FIDA 2CPBA 1LNQA 1M90Q 1NU1D 1VQNP 2PP6A 1KN7A 1MUUA 3T97A 5EFWB 2AXTE 1GU5A 2OGUA 1GW4A 3WU2H 2PFXA 3L73D 2LKMA 5CCGD 5B66H 4BRYA 4XA4A 4HJGH 4PD4D 2QM7A 3H32C 4PV1B 1FOSF 4PJ0E 3VOPA 1HGVA 4YTPC 2E5TA 2M3EA 3HRNA 3C9IA 3V2RA 4GIFA 2NRGA 1IO4A 1SQBD 2ZVOB 1QVGO 4XE5B 2C9LY 5M1BA 1IFJA 3L72G 5APUA 1YI2P 1HBWA 3JCUE 1X0TA 1OWAA 2JO1A 3RL0C 2OYIC 2L5GB 5KLVG 4PD4E 3CCLP 3CLQA 1YBKA 1JY3O 2BCCJ 5KJ7A 2MKVA 3L70J 1RF0B 1FZEA 2WSEH 3VN0A 3L72D 5L8RJ 2LR2A 1FZFC 4DCKA 1KQGB 3H1HG 1IC2A 3RK2B 2Z4EA 2K88A 3EQ2A 3M0AA 2KNCA 1FDMA 1HVVA 4GOFA 1CI6B 5AVTB 2KLVA 1SQPJ 1KFMA 2JR8A 1RF1B 4KJMA 1NTME 1VF5C 3Q3DA 4Y99B 2JHKF 1AVOA 1P84E 2WPRA 2P2UA 5TJHA 1A02J 2JHHC 1T2KD 3CC4P 2ZJSE 4RKUJ 3H1IG 1LTGC 1PP9J 1FOSE 2H7HA 1YHQP 3CWBD 1KTMA 5H2FH 4EYYQ 1J1EC 4U7JA 1BDDA 2H88C 1EZVD 3LW5H 1RE3B 1OW7A 2H8PD 3HE4B 1KILC 2OYHC 1LTBC 2GA1A 1VQKP 4IL6X 4LGDE 1FZBC 1GL2C 3E1IC 1SQVJ 2J5ZA 3B8EB 3L74G 1N2DC 2D2CD 2W83C 3AE3C 1FZGC 5K5GB 2W6AA 2WSFH 1HWTC 3U1CA 2Q3EA 1H8AA 1PP9G 2A45I 3RK3C 2WQYC 1PGJA 1WT6A 3H1KG 3VP9A 1KYOI 4DT0A 4GKGA 4C46A 2ZXEB 2B88A 2LXBA 4Z1MH 1KB9E 1JO5A 2D39A 1PGQA 4LLHA 3RK3D 2IYOA 1FIBA 4NYTA 1ZMEC 1H88A 3A3YB 4EIJA 1SQXK 2FYUD 1VQLP 3A0HE 3T97B 1AQ5A 2BCCD 1L2PA 1NTKD 4WY4D 1K8AQ 2J2PA 2L91A 1NTMK 2NPSB 4R4MA 3BRVB 2E74C 2W6BA 3WUUA 3OAKA 1MV8A 2RKLA 1KILA 1EDKA 3AECC 3M0DC 4DZOA 2ZFCA 1DEBA 1MFTA 2KI7B 1U7MA 1AA0A 1ZXGA 1IFMA 1DH3A 3H1HE 1Z3SA 2QIWA 3HE5A 1J1DB 1M1JA 2WPVB 1BCCD 3O8ZA 3H25A 2KYVA 1N7SB 4GT1A 2WVRA 4HB1A 3BCCJ 1IK9A 1URQD 2BCCE 1L0LG 1VF5D 4BWNA 1NGMB 1HF9A 1YJ9P 3PJSK 2K9JA 1SQQG 1L4AC 3QWOC 1KB9H 3FXDA 3TNUA 2OTJP 1U7JA 3P7KA 1OFCX 5APWA 1S3JA 2E42A 2P1JA 1PIXA 4WVZA 3CMAP 1RH5B 2WSCJ 2Y0DA 1LTJA 2J0GA 3H1IE 2WTYA 1S9KD 1NTMG 1E79H 3OW2O 1L0NE 2IX7C 2N1TD 3R2PA 2H43A 4K3AA 3F5HA 4H44D 1SQBG 1S4XA 2J1GA 3A0HH 1AQTA 2HODB 3VP8A 2B9BA 1URQB 3TGUE 1QVFO 2NPSC 3CC2P 3CD6P 5C39A 2JHMF 2J3OA 2LXCB 3H1LE 2E5YA 3TF5A 3M9QA 3HUSC 2HODC 4GDOA 4N3YB 3H1ID 2Q9IC 2P58A 1HH0A 2FYUE 3V5BA 2AEJA 1SFCA 1SQBK 1QLED 1SQVD 3EFGA 4WY4C 1Z3UA 1FICA 1LTJC 2ITAA 5CCGA 3L73J 3HUSB 2OQQA 2XU6A 1EC5A 2W90A 1FZFA 3MUDA 2BEQD 1N7SA 3FGAD 1SQBJ 2JP3A 2E76B 5KLVK 3B5NB 1LT9B 1PV3A 1BGYD 5KAFH 2A45H 1EXJA 1AVYA 3Q2YA 3RBZA 5KAIH 3TGUG 3N4XA 1N8RQ 3FIBA 4DJGA 1J2JB 1NU1G 1WRGA 1BE3G 2I1JA 1W2BO 1SS1A 1MZ9A 2FXOA 1RF0C 5CCHC 4GOEA 3B5NC 1EZVG 1GU4A 2XKMA 2E43A 3E1IA 3W68A 1P84I 1SQQJ 2KSEA 3Q5PA 1Z56A 1KYOH 1Q2NA 2C0XA 3TDKA 2O1KA 1SQXE 3L70D 2K9YA 2M3BA 2Q6QA 1LTAC 3KPEA 3RK2D 3S4RA 1M56D 3L71G 4NPEA 1M7LA 3RK3B 3BCCD 5KAIE 2N1TC 1NTKE 1ZRTD 3SWKA 1HGZA 2I1KA 3AEFC 1YJWP 2H43B 2OARA 5APYA 1URQC 1CSBA 1PFIA 1M57D 1PGOA 1RE3C 3H6PA 1ZOYC 4XFJA 2YKQA 3CWBJ 4MN4C 1LT1A 1NTZJ 1IJDB 1IFIA 2OTKE 2KIKA 4LC1A 2QJPB 3SWFA 2WPQA 4U3FG 4N78D 1SVFA 1ZN5A 2KZJA 1YITP 4ZNCA 3RBXA 1OVUA 2YO2A 4L73A 1KC8Q 3L70G 3AE9C 2P67A 3MHVA 2QG4A 3EFFK 3U1AA 2G3AA 4H13C 2R44A 3GF3A 2ZT9D 3L75E 2IBZG 2PAJA 1VQ5P 3CCVP 1L0LD 1SQVG 3G6EP 1YYCA 3CCJP 3MZWB 1DD3A 2J3FA 3L72J 2UWJE 2FYUJ 3L71J 5GTHH 1FZAB 2PGDA 2KNCB 2R32A 2IYPA 3G3ZA 2E75C 2H43C 1L4AD 4R9TA 1JMBA 1G1JA 2H89C 3FX0A 3L73E 1PPJG 3HD7D 1VQOP 4YXDC 1E5WA 1G1IA 1BE3J 2WT7B 5APQA 1LP1B 1NAFA 3LIDA 2Z4EB 1DD4A 4H44B 1N7SD 2IPPA 2HLOA 4GODA 1IFDA 1SQVK 1ZLLA 2IZ1A 1LGHB 4I2LC 3GHGC 3V2NA 1VQPP 3GLMA 2FFDB 1EQ7A 1ZP0C 2KXPB 1R5LA 1VQ6P 1JY3N 5AW4B 4I1LA 3RGUA 2JDIH 2KK7A 2FY8A 2J60A 2AEMA 3PRJA 3JCUH 1L4AB 2Z5HA 2QRXA 1N73C 1ZRTE 1RF0A 1GDTA 3CPWO 4I7ZC 1MFZA 3L74E 3JSVC 2D2CC 5APXA 5CCHD 1GK6A 2WSEJ 3H1JJ 3CMEP 3H1KD 1U57A 3M91A 1IFPA 1L0NK 1X9VA 2YIUB 2RMZA 2M5AB 1JB0J 4JPZB 3CCQP 1NTKJ 5CJ4A 4JYOX 2A45G 4L76A 3IR9A 3VMZA 5CHXA 2KS1A 1P84H 2J3UA 1HUCA 3CI9A 3H32B 4W7YA 2QE7H 3S9OA 3TGUD 3I56P 4H13D 3L75D 4UB8E 3CX5D 4EI2A 3CWBE 3CX5H 3CX5I 3A2AA 3H1HD 3O6QB 1CW5A 1NTMJ 3V2QA 3NXSA 4TLFA 1RE4B 2FXPA 2J0YA 5AW5B 1GD2E 1Y8AA 2HFED 1JY2O 4W7ZA 1K73Q 1LP1A 3CCSP 1SQVE 2QM8A 4BXLA 1S5LX 5KLVE 1NAYA 4UB6H 1KFNA 2B87A 3OJAB 1FU1A 1IZNB 5E79H 2Q5UA 3H1JD 1FZAA 4W80A 3ITKA 4L74A 3VMXA 2HPCA 1L0LJ 2G8YA 1UIIA 5AW7B 3PH0A 1XTCC 1JC9A 1KB9D 4OGQD 1QX8A 1RF1A 3GF7A 1YIJP 3H1JG 2WSSH 5GTIH 4HKZH 1SQPE 2FBWC 2DW3A 4H0LC 2Y0CA 3PHLA 1T8ZA 5AW0B 2E76D 2WPSA 3B5ND 1Q7YQ 1S1CX 4C7RA 3KDPB 5AVRB 2HLOB 1AV1A 5GTIE 4N78E 1J1DC 1FZCA 1FZEB 2WT7A 1FJPA 2YXRB 1T2KC 4Y28J 1JY2N 1NTZG 2D2CB 4IL6E 4B86A 1M1JC 5KKZB 1KILD 3H32A 3H1KJ 2YKPA 4M3LA 2XNDH 4JYBA 1BCCE 2KS1B 4CPGA 3GG2A 1QGKB 3BCCE 3AE4C 3KZIE 2YMYA 5E79E 1FZDA 1LJ2A 1D7MA 4KHXA 1G2CA 2J61B 5AVUB 1VF5B 2V7QH 4IFMA 1M8OB 3PLNA 1WMKA 1OVRA 3AE1C 1AFOA 3BRTB 1BGYE 3AE6C 2ZAEB 5DJUB 4L75A 2GUSA 2A06E 3HD7C 3Q5RA 4HH2A 4JZCA 2KLUA 1R8EA 1GTWA 1LT9C 3H1IJ 2Z4EC 2Y0EA 1HTLC 3E1IB 4C7NA 1H0TB 4R4LA 1DEEG 4D6TD 4A7PA 4DOJA 2WZ7A 3V2PA 3MP7B 2RH0A 2OYHB 3TGUJ 3L74D 3F89A 3C8VA 1SQPK 2R5DA 2FFDC 1VQ8P 5KJ7D 2J58A 1S5LE 1SQQD 3CWBG 1Q86Q 1GMJA 2CPSA 2KB7P 1LTJB 2O3JA 1NHLA 5CBOA 3AE8C 3RL0B 1Q82Q 1OZHA 5TISH 2QJPC 1EZVI 2ZYAA 2CK3H 4H0LD 5AW6B 4QMAA 5KLVJ 3L4FA 1BCCG 3H1LG 4IL6H 4NPDA 2ZYGA 2WITA 4ZMDA 2BCCG 1JCDA 3HD7B 4PV1C 3PTZA 3PP5A 1KORA 1NU1E 1YTZT 2P10A 3BVHC 2FYNC 2WSFJ 3HE5B 3MIWA 1NKZB 2J61A 3A0BE 1BDCA 4IFFA 2YMKA 1ZR2A 1ZW0A 3V4QA 1DIPA 2FKWB 3WUTA 4ZKPA 2HODA 3FWNA 3NTNA 3A0BH 1FZFB 1P84D 1JY3P 1GW3A 2WWWA 5CCHA 1BSHA 3D70A 5AW2B 1NTZK 1CZQA 2JWDA 2M5AA 1GZLA 2XDJA 5AVWB 3GHGB 2Q3IA 1K9MQ 1OW6A 1JNMA 2AXTH 3E7KA 4ASWA 1GL2B 2MJZA 1FZGA 3H1LJ 1RY3A 3H1LD 2OYOA 3SFEC 3II6A 3TNUB 1NOHA 1MKMA 4ASVA 3N7NA 4M7HA 3L73G 3FWLA 4O9BA 1YQ4C 3AEGC 2E75B 2QJYB 5KLIC 1JEKA 2A06G 1ZR4A 2ZXXA 5CJ0A 3BVHB 2R5BA 3KYQA 3RL0g 5APSA 4D6TJ 1LTTC 1SQXJ 2B89A 2J5UA 1GK4A 3VYIA 1H89A 3IAOA 1OVVA 2Q9IA 4H13B 1FZCB 3BASA 2M8RA 2B87B 4KT0J 4JBZA 5KAFE 1S9KE 1NTMD 1FJKA 2HYNA 3A7OA 1LWUB 4RJTA 1KMIZ 5CMZA 1BSNA 3MGNA 4Y99C 1HJ0A 1X79B 2ZVNB 1M1JB 2YXQB 1RE4A 2FYUK 3W67A 1NYHA 1QEXA 4UB8H 2K37A 3HTKA 1Y9BA 2QJKB 3SSUA 5AVXB 1NTZE 3AEDC 2M0BA 2FIBA 1PPJE 3VMYA 1KYOE 2K1AA 3L36A 3RK2C 1TU3F 3L71E 3A5TA 3TSIA 3E1RA 2HR3A 4JF7A 3UIAA 1KB9I 1KILB 2WMMA 3MD0A 1SFCC 2R3SA 1FBMA 5AW1B 3L75J 3BCCG 2FYZA 1USEA 3D6YA 3CXHI 1VDFA 2RN0A 3HE4A 1X22A 3CX5E 2XNXB 3L72E 3USSA 5B66E 4OVNF 2XZRA 1OW8A 1NTKK 3SFDC 2J3GA 2J3FD 4EDFA 1KILE 2YNYA 2HG5D 4AQRD 1URQA 5CCGC 3RK3E 2FXMA 1EXIA 5KJ7C 1KQLA 3MTUE 3Q5SA 1QL2A 2OYIA 3IN6A 1IK7A 3KZIH 1VL2A 4U3FJ 5APVA 1FZBB 1JM0A 5TISE 2XV5A 1PP9E 1Y47A 1FZEC 5KKZC 2BEZF 3GMAA 4YXWH 2JWAA 3HTKB 4N6JA 2IBZE 2ZT9C 5DJTB 4JYCA 2IFMA 3HD7A 3P8CD 1CI6A 3AE5C 1X8YA 1KD1Q 1L4AA 4IFDK 1JUNA 2A06D 1HJBA 4UB6E 1SQQK 3LIEA 1LWUA 4ZFGA 2GUVA 4K35A 2QVAA 2JEEA 5B5EE 3B71A 5AVVB 3L74J 1N7SC 5BVZA 4D6TE 1NKNA 1IFNA 3I5CA 3Q1MA 2N9YB 4M7FA 1NU1K 1ZV8A 1FZBA 2HPCB 5B5EH 4PD4H 3D71A 1PP9D 3OA7A 3IF4A 2GM4A 1NVOA 3AE2C 1A02F 2IBZD 2K3RA 3C1LA 1RQVA 3BVHA 1RF1C 2O01H 3R4YA 1YTZI 1GL2D 1W5CE 3EWKA 3L71D 1H0TA 3HUSA 3TYYA 1FZGB 4WBAA 1K04A 1EDJA 2YO3A 3JC22 4OGQC 3WU2E 1N86A 2Q9IB 1NWQA 1L0ND 1FDIA 5AVQB 1L0NJ 3BATA 2GY7A 5BU5A 4H0LB 2E76C 1LWUC 2KSJA 1SQXG 2J59M 4D6TG 2Q7CA 2R3CA 1LTSC 3CC7P 1K05A 2QSIA 3H1JE 1FAVA 2OTLP 3M0DA 1UIXA 3M9BA 4EPUA 3FXEA 4ZKUA 2KZIA 3H1HJ 4I6MC 2Z5IA 5AW3B 1EZVE 1JOCA 3D6ZA 3CCUP 2AXCA 3B4SA 4YPCA 2BASA 3QH9A 1NO4A 2QJYC 1KQSO 5BU8B 4U3FD 1QL1A 1NH4A 3AEEC 2POHA 1RHZB 1GL2A 3AEBC 1VQ4P 3SWYA 2W6JH 1N73B 2XNXA 2C9NY 2IZ0A 2HPCC 1Q81Q 1T3UA 4BRYB 2WNPF 2KOGA 4WB4A 4RESB 1USDA 5GTHE 3LW5J 3P8CE 3VMAA 2QEXP 1KZUB 4AUWA 1L0NG 3L37A 4PD4I 4I7ZB 2VRSA 1R5SA 1YQ3C 3VTPC 3AEAC 2J64A 1EDIA 1OIPA 2FYUG 2FYNB 4U3FE 4OGQB 3KQGA 4WWIA 1Q90D 2QJKC 1BE3D 5KLVD 2N1TA 2AEFA 1NJIQ 1LTIC 1W2EA 3NMDA 1FZAC 4R9JA 3GW6A 1N86C 4WY4A 2E75D 2O01J 4NPFX 5AW9B 1VQMP 1AJYA 3H1KE 1L0LE 1SFCD 4JQ0D 3WMM0 1BCCJ 1BGYJ 3V4WA 2JJLA 2O1JA 1SQBE 2QA4P 1RQUA 2O01N 1DX7A 4C7NB 2HLOC 3CXHD 3AE7C 2P7JA 3P8MC 3P32A 5KLIB 1JCCA 5H2FE 3M9HA 1T3JA 1N73A 2IBZI 1FC2C 1T6AA 4IOIH 4PJ0H 3I55P 1FE6A 2C0WA 1L0LK 3WUVA 2KUBA 2J0HA 4OWFA 1SP4A 4TT3H 1SQQE 1NTZD 2N9BA 1FS0E 1PPJD 5AW8B 3CXHH 3CL3D 2PRRA 5AVSB 1SFCB 3CCMP 3RL0D 1PL5A 2NZ2A 3ABVC 5AVYB 4H44C 3CXHE 3CCEP 1JTHB 1VQ9P 2NPSD 2ZT9B 4HYTB 3G9RA 2XNXC 3ZDMA 1S5LH 2Q1KA 1RE4C 1RE3A 3GHGA 2Y9ZA 3CCRP 1S72P 3G4SP 1JTHA 1FDOA 3G71P 3L75G 2SPZA 1BGYG 2Y9YA 2IDBA 1NU1J 2V7QJ 2E74B 1SQXD 3L70E 2K9JB 1SLQA 1VQ7P 3KXDA 1SQPD 1OMIA 4WY4B 3M06A 1FZCC 5AVZB 2JHIF 5APTA 2IFNA 2OYHA 2FFDA 1BE3E 4EOTA 3K5BA 2YIUC 1N7LA 3TK1A 2KP8A 3MUDC 1OXZA 3IFMA 2W27A 1S2EA 1KV4A 1N86B 1JMMA 1OX3A 2W8ZA 1JY2P 1KYOD 3NFQA 3V6IA 5KTBA 3L35A 1EDLA 1VPCA 1NTKG 3O6QA 2N1TB 2I8DA 1YJNP 2JHLF 2E74D 2YKOA 2WSCH 1KQFB 2JKVA 2V4HA
chains in the Genus database with same CATH topology
1SFCA 4N78E 1SQBK 1J1DC 1QL2A 3EFGA 3U59A 2OYIA 1FZCA 4WY4C 2OYIB 1FZEB 1LT9A 1XTGB 3B5NA 5APVA 1Z3UA 1G2CB 1FZBB 1FICA 1LTJC 2WT7A 5CCGA 3HUSB 4OH8B 1FJPA 2XU6A 2XV5A 1T2KC 1FZFA 1FZEC 3MUDA 1JY2N 3HTKB 4N6JA 1N7SA 4JYCA 4AYCA 2IFMA 2NPSA 1J1EB 3HD7A 3P8CD 4B86A 1FIDA 1M1JC 2CPBA 5KLVK 1CI6A 2PP6A 3B5NB 1LT9B 1X8YA 1KILD 1L4AA 4IFDK 2A45H 1JUNA 1MUUA 3H32A 3T97A 1HJBA 2YKPA 1SQQK 3LIEA 4M3LA 1LWUA 1GU5A 4ZFGA 2GUVA 4JYBA 1GW4A 3N4XA 3FIBA 2JEEA 1J2JB 2LKMA 1WRGA 5AVVB 5CCGD 2I1JA 1N7SC 5BVZA 1MZ9A 1NKNA 1IFNA 5CCHC 1RF0C 3I5CA 3B5NC 1GU4A 2XKMA 2YMYA 1NU1K 2E43A 4XA4A 1FZDA 4M7FA 3E1IA 1ZV8A 4KHXA 1FZBA 1G2CA 2HPCB 2J61B 2QM7A 5AVUB 3OA7A 3H32C 1Z56A 1FOSF 2GM4A 1A02F 4IFMA 2C0XA 3VOPA 1HGVA 2O1KA 1AFOA 3BVHA 3BRTB 3HRNA 3C9IA 3V2RA 1RF1C 4GIFA 2O01H 2M3BA 1IO4A 2GUSA 1YTZI 1GL2D 3HD7C 1LTAC 4HH2A 3KPEA 3RK2D 3HUSA 4XE5B 3TYYA 4JZCA 1FZGB 4WBAA 2C9LY 1IFJA 2YO3A 1GTWA 1LT9C 2Z4EC 1N86A 2Q9IB 1HTLC 1M7LA 5APUA 3RK3B 1NWQA 5AVQB 3E1IB 4C7NA 1HBWA 3BATA 2N1TC 1OWAA 3RL0C 2GY7A 5BU5A 2OYIC 2L5GB 1LWUC 2KSJA 4DOJA 1HGZA 2WZ7A 2I1KA 3V2PA 2J59M 2OYHB 2Q7CA 3CLQA 2H43B 1JY3O 2OARA 5APYA 5KJ7A 1URQC 1SQPK 2R5DA 1LTSC 2R3CA 2FFDC 5KJ7D 1CSBA 1RF0B 2J58A 1PFIA 1FZEA 2WSEH 3VN0A 1FAVA 1FZFC 3M0DA 1RE3C 3H6PA 2CPSA 2KB7P 1LTJB 1IC2A 1NHLA 3M9BA 3RK2B 2Z4EA 3EQ2A 4EPUA 3M0AA 1HVVA 4ZKUA 1FDMA 1CI6B 3RL0B 4I6MC 2YKQA 2Z5IA 5AW3B 5AVTB 1JOCA 2KLVA 2BASA 1IJDB 1NO4A 1KFMA 5AW6B 5BU8B 1RF1B 1IFIA 1QL1A 1NH4A 3L4FA 4LC1A 2POHA 4Y99B 3SWFA 2WPQA 1GL2A 4N78D 2JHKF 1SVFA 1ZN5A 3SWYA 2WPRA 2P2UA 1N73B 2XNXA 2C9NY 2YO2A 1A02J 2JHHC 1T2KD 2P67A 2HPCC 2WITA 1T3UA 1JCDA 3U1AA 1LTGC 3HD7B 1FOSE 2WNPF 2H7HA 2KOGA 4WB4A 4RESB 2PAJA 3PP5A 3P8CE 1J1EC 1KZUB 4AUWA 1YTZT 1YYCA 3L37A 2J3FA 3BVHC 3MIWA 3HE5B 2VRSA 1NKZB 3LW5H 2J61A 1FZAB 1RE3B 4IFFA 1ZR2A 2R32A 2H8PD 3HE4B 3VTPC 2J64A 1KILC 3G3ZA 2OYHC 1LTBC 2H43C 1L4AD 4R9TA 3V4QA 3KQGA 1G1JA 2FKWB 4ZKPA 2HODA 4LGDE 3NTNA 1FZBC 1GL2C 3HD7D 3E1IC 1FZFB 2J5ZA 3B8EB 1E5WA 1JY3P 1GW3A 1N2DC 1G1IA 2WWWA 5CCHA 1FZGC 2WT7B 5AW2B 1NTZK 2W6AA 1CZQA 5APQA 2N1TA 2WSFH 1HWTC 1NAFA 1GZLA 3LIDA 2XDJA 3U1CA 2Z4EB 1LTIC 1W2EA 3NMDA 1H8AA 1FZAC 5AVWB 2A45I 3GHGB 4R9JA 3RK3C 1N7SD 2Q3IA 1N86C 4WY4A 2IPPA 1WT6A 2HLOA 3VP9A 1JNMA 1IFDA 5AW9B 4GKGA 1SQVK 1ZLLA 4C46A 1LGHB 1SFCD 2ZXEB 3GHGC 4I2LC 1GL2B 2MJZA 3WMM0 3V2NA 1FZGA 1RY3A 1JO5A 3V4WA 2JJLA 2O1JA 2FFDB 2D39A 1EQ7A 3II6A 3TNUB 1NOHA 4LLHA 3RK3D 1DX7A 4C7NB 1FIBA 4NYTA 3N7NA 1H88A 1JY3N 2HLOC 3A3YB 5AW4B 4M7HA 4EIJA 4I1LA 2P7JA 1SQXK 3P8MC 3P32A 1JCCA 4O9BA 3M9HA 1T3JA 2J60A 1AQ5A 1N73A 1L4AB 2Z5HA 1N73C 2C0WA 1RF0A 4WY4D 1L0LK 1GDTA 2J0HA 1ZR4A 2J2PA 5CJ0A 1NTMK 3BVHB 2R5BA 1MFZA 1SP4A 2NPSB 3KYQA 5APSA 3BRVB 2W6BA 3OAKA 1LTTC 5APXA 1MV8A 5CCHD 1KILA 1GK6A 3M0DC 2ZFCA 1GK4A 3M91A 4DZOA 1DEBA 3VYIA 1L0NK 1H89A 2N9BA 1IFMA 5AW8B 1DH3A 1X9VA 1Z3SA 2Q9IA 1FZCB 3HE5A 3CL3D 5AVSB 3BASA 2M8RA 1SFCB 1J1DB 1M1JA 3RL0D 3O8ZA 5AVYB 1S9KE 2KYVA 5CJ4A 4JYOX 1FJKA 1JTHB 2A45G 2HYNA 1N7SB 4GT1A 3A7OA 1LWUB 3IR9A 3VMZA 1IK9A 5CMZA 1URQD 5CHXA 2NPSD 3MGNA 4Y99C 4HYTB 2J3UA 1X79B 1HUCA 2XNXC 1M1JB 1RE4C 3CI9A 1RE3A 3H32B 4W7YA 3GHGA 1RE4A 2FYUK 1L4AC 1JTHA 3HTKA 3TNUA 5AVXB 3P7KA 5APWA 3A2AA 2FIBA 3VMYA 2E42A 3L36A 2P1JA 1SLQA 1CW5A 3V2QA 3RK2C 3NXSA 1RE4B 2J0YA 5AW5B 1GD2E 2HFED 1JY2O 3A5TA 3TSIA 4WY4B 1LTJA 4JF7A 2J0GA 2WTYA 3UIAA 1S9KD 3M06A 4W7ZA 1FZCC 1KILB 5AVZB 3MD0A 2JHIF 5APTA 1SFCC 2IX7C 2N1TD 2IFNA 3R2PA 1FBMA 5AW1B 2H43A 2OYHA 2QM8A 2FFDA 2FYZA 2J1GA 4EOTA 2HODB 3VP8A 1URQB 1KFNA 1N7LA 2NPSC 3OJAB 1FU1A 1VDFA 3HE4A 2Q5UA 3TK1A 2KP8A 1OXZA 3IFMA 2W27A 2XNXB 1FZAA 4W80A 1N86B 1JMMA 3VMXA 2HPCA 2XZRA 2JHMF 5AW7B 1NTKK 1XTCC 2J3GA 1JC9A 2J3FD 1JY2P 2J3OA 3NFQA 5KTBA 2YNYA 2HG5D 3L35A 3M9QA 1RF1A 4AQRD 1URQA 1VPCA 3HUSC 2N1TB 2HODC 5CCGC 2FXMA 2JHLF 1T8ZA 2YKOA 5AW0B 4N3YB 2WPSA 3B5ND 2Q9IC 5KJ7C 2WSCH 4C7RA 1KQLA 3KDPB 5AVRB 1HH0A 2HLOB 3V5BA 3MTUE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E1I C;  1FZF B;  2J5Z A;  1JY3 P;  2OYI A;  1FZC A;  2GY7 A;  2J3U A;  2OYI B;  1FZE B;  1LT9 A;  1FZG C;  2OYI C;  1Z3U A;  2XNX C;  1LWU C;  1FZB B;  1FIC A;  1LTJ C;  1M1J B;  1RE4 C;  1RE3 A;  3HUS B;  3H32 B;  2Z4E B;  3GHG A;  1W2E A;  1RE4 A;  1FZA C;  2OYH B;  2A45 I;  3GHG B;  4R9J A;  2H43 B;  1JY3 O;  1FZF A;  2FFD C;  1FZE C;  1N86 C;  1JY2 N;  1RF0 B;  2HLO A;  1FZE A;  1FZF C;  1RE3 C;  1FID A;  3GHG C;  1LTJ B;  1M1J C;  4EPU A;  2Z4E A;  2FIB A;  1FZG A;  1LT9 B;  2A45 H;  3H32 A;  2FFD B;  2D39 A;  1RE4 B;  2J0Y A;  1JY2 O;  1LWU A;  1FIB A;  4NYT A;  4ZFG A;  1LTJ A;  2HLO C;  1JY3 N;  2J0G A;  1RF1 B;  4M7H A;  3FIB A;  1FZC C;  2JHI F;  2JHK F;  2J60 A;  1N73 A;  2H43 A;  2OYH A;  1RF0 C;  1N73 B;  2XNX A;  2FFD A;  1N73 C;  2J1G A;  4M7F A;  1RF0 A;  1FZD A;  3E1I A;  2J0H A;  2HOD B;  2JHH C;  2J2P A;  1FZB A;  2HPC B;  2HPC C;  3BVH B;  2J61 B;  1T3U A;  3H32 C;  2WNP F;  2XNX B;  1FZA A;  1N86 B;  2HPC A;  2JHM F;  3BVH A;  2J3G A;  1JC9 A;  2J3F D;  1JY2 P;  2J3O A;  1RF1 C;  1Z3S A;  2Q9I A;  2J3F A;  1FZC B;  1LWU B;  1RF1 A;  3BVH C;  3HUS C;  2HOD C;  2J61 A;  1M1J A;  1FZA B;  3HUS A;  1RE3 B;  4JZC A;  1FZG B;  2JHL F;  2J64 A;  2OYH C;  1LT9 C;  2H43 C;  2Q9I C;  4R9T A;  2Z4E C;  1N86 A;  2Q9I B;  4JYO X;  2A45 G;  2HLO B;  2HOD A;  3E1I B;  1FZB C; 
#chains in the Genus database with same CATH topology
 1PZQ A;  3U59 A;  3KHU A;  2OYI B;  4PV1 D;  1LT9 A;  1XTG B;  3B5N A;  1G2C B;  4RO0 A;  1PGP A;  4OH8 B;  1M1K Q;  1SQP G;  3S1K A;  4AYC A;  5CBN A;  2NPS A;  1J1E B;  2ZYD A;  1FID A;  2CPB A;  1LNQ A;  1M90 Q;  1NU1 D;  1VQN P;  2PP6 A;  1KN7 A;  1MUU A;  3T97 A;  5EFW B;  2AXT E;  1GU5 A;  2OGU A;  1GW4 A;  3WU2 H;  2PFX A;  3L73 D;  2LKM A;  5CCG D;  5B66 H;  4BRY A;  4XA4 A;  4HJG H;  4PD4 D;  2QM7 A;  3H32 C;  4PV1 B;  1FOS F;  4PJ0 E;  3VOP A;  1HGV A;  4YTP C;  2E5T A;  2M3E A;  3HRN A;  3C9I A;  3V2R A;  4GIF A;  2NRG A;  1IO4 A;  1SQB D;  2ZVO B;  1QVG O;  4XE5 B;  2C9L Y;  5M1B A;  1IFJ A;  3L72 G;  5APU A;  1YI2 P;  1HBW A;  3JCU E;  1X0T A;  1OWA A;  2JO1 A;  3RL0 C;  2OYI C;  2L5G B;  5KLV G;  4PD4 E;  3CCL P;  3CLQ A;  1YBK A;  1JY3 O;  2BCC J;  5KJ7 A;  2MKV A;  3L70 J;  1RF0 B;  1FZE A;  2WSE H;  3VN0 A;  3L72 D;  5L8R J;  2LR2 A;  1FZF C;  4DCK A;  1KQG B;  3H1H G;  1IC2 A;  3RK2 B;  2Z4E A;  2K88 A;  3EQ2 A;  3M0A A;  2KNC A;  1FDM A;  1HVV A;  4GOF A;  1CI6 B;  5AVT B;  2KLV A;  1SQP J;  1KFM A;  2JR8 A;  1RF1 B;  4KJM A;  1NTM E;  1VF5 C;  3Q3D A;  4Y99 B;  2JHK F;  1AVO A;  1P84 E;  2WPR A;  2P2U A;  5TJH A;  1A02 J;  2JHH C;  1T2K D;  3CC4 P;  2ZJS E;  4RKU J;  3H1I G;  1LTG C;  1PP9 J;  1FOS E;  2H7H A;  1YHQ P;  3CWB D;  1KTM A;  5H2F H;  4EYY Q;  1J1E C;  4U7J A;  1BDD A;  2H88 C;  1EZV D;  3LW5 H;  1RE3 B;  1OW7 A;  2H8P D;  3HE4 B;  1KIL C;  2OYH C;  1LTB C;  2GA1 A;  1VQK P;  4IL6 X;  4LGD E;  1FZB C;  1GL2 C;  3E1I C;  1SQV J;  2J5Z A;  3B8E B;  3L74 G;  1N2D C;  2D2C D;  2W83 C;  3AE3 C;  1FZG C;  5K5G B;  2W6A A;  2WSF H;  1HWT C;  3U1C A;  2Q3E A;  1H8A A;  1PP9 G;  2A45 I;  3RK3 C;  2WQY C;  1PGJ A;  1WT6 A;  3H1K G;  3VP9 A;  1KYO I;  4DT0 A;  4GKG A;  4C46 A;  2ZXE B;  2B88 A;  2LXB A;  4Z1M H;  1KB9 E;  1JO5 A;  2D39 A;  1PGQ A;  4LLH A;  3RK3 D;  2IYO A;  1FIB A;  4NYT A;  1ZME C;  1H88 A;  3A3Y B;  4EIJ A;  1SQX K;  2FYU D;  1VQL P;  3A0H E;  3T97 B;  1AQ5 A;  2BCC D;  1L2P A;  1NTK D;  4WY4 D;  1K8A Q;  2J2P A;  2L91 A;  1NTM K;  2NPS B;  4R4M A;  3BRV B;  2E74 C;  2W6B A;  3WUU A;  3OAK A;  1MV8 A;  2RKL A;  1KIL A;  1EDK A;  3AEC C;  3M0D C;  4DZO A;  2ZFC A;  1DEB A;  1MFT A;  2KI7 B;  1U7M A;  1AA0 A;  1ZXG A;  1IFM A;  1DH3 A;  3H1H E;  1Z3S A;  2QIW A;  3HE5 A;  1J1D B;  1M1J A;  2WPV B;  1BCC D;  3O8Z A;  3H25 A;  2KYV A;  1N7S B;  4GT1 A;  2WVR A;  4HB1 A;  3BCC J;  1IK9 A;  1URQ D;  2BCC E;  1L0L G;  1VF5 D;  4BWN A;  1NGM B;  1HF9 A;  1YJ9 P;  3PJS K;  2K9J A;  1SQQ G;  1L4A C;  3QWO C;  1KB9 H;  3FXD A;  3TNU A;  2OTJ P;  1U7J A;  3P7K A;  1OFC X;  5APW A;  1S3J A;  2E42 A;  2P1J A;  1PIX A;  4WVZ A;  3CMA P;  1RH5 B;  2WSC J;  2Y0D A;  1LTJ A;  2J0G A;  3H1I E;  2WTY A;  1S9K D;  1NTM G;  1E79 H;  3OW2 O;  1L0N E;  2IX7 C;  2N1T D;  3R2P A;  2H43 A;  4K3A A;  3F5H A;  4H44 D;  1SQB G;  1S4X A;  2J1G A;  3A0H H;  1AQT A;  2HOD B;  3VP8 A;  2B9B A;  1URQ B;  3TGU E;  1QVF O;  2NPS C;  3CC2 P;  3CD6 P;  5C39 A;  2JHM F;  2J3O A;  2LXC B;  3H1L E;  2E5Y A;  3TF5 A;  3M9Q A;  3HUS C;  2HOD C;  4GDO A;  4N3Y B;  3H1I D;  2Q9I C;  2P58 A;  1HH0 A;  2FYU E;  3V5B A;  2AEJ A;  1SFC A;  1SQB K;  1QLE D;  1SQV D;  3EFG A;  4WY4 C;  1Z3U A;  1FIC A;  1LTJ C;  2ITA A;  5CCG A;  3L73 J;  3HUS B;  2OQQ A;  2XU6 A;  1EC5 A;  2W90 A;  1FZF A;  3MUD A;  2BEQ D;  1N7S A;  3FGA D;  1SQB J;  2JP3 A;  2E76 B;  5KLV K;  3B5N B;  1LT9 B;  1PV3 A;  1BGY D;  5KAF H;  2A45 H;  1EXJ A;  1AVY A;  3Q2Y A;  3RBZ A;  5KAI H;  3TGU G;  3N4X A;  1N8R Q;  3FIB A;  4DJG A;  1J2J B;  1NU1 G;  1WRG A;  1BE3 G;  2I1J A;  1W2B O;  1SS1 A;  1MZ9 A;  2FXO A;  1RF0 C;  5CCH C;  4GOE A;  3B5N C;  1EZV G;  1GU4 A;  2XKM A;  2E43 A;  3E1I A;  3W68 A;  1P84 I;  1SQQ J;  2KSE A;  3Q5P A;  1Z56 A;  1KYO H;  1Q2N A;  2C0X A;  3TDK A;  2O1K A;  1SQX E;  3L70 D;  2K9Y A;  2M3B A;  2Q6Q A;  1LTA C;  3KPE A;  3RK2 D;  3S4R A;  1M56 D;  3L71 G;  4NPE A;  1M7L A;  3RK3 B;  3BCC D;  5KAI E;  2N1T C;  1NTK E;  1ZRT D;  3SWK A;  1HGZ A;  2I1K A;  3AEF C;  1YJW P;  2H43 B;  2OAR A;  5APY A;  1URQ C;  1CSB A;  1PFI A;  1M57 D;  1PGO A;  1RE3 C;  3H6P A;  1ZOY C;  4XFJ A;  2YKQ A;  3CWB J;  4MN4 C;  1LT1 A;  1NTZ J;  1IJD B;  1IFI A;  2OTK E;  2KIK A;  4LC1 A;  2QJP B;  3SWF A;  2WPQ A;  4U3F G;  4N78 D;  1SVF A;  1ZN5 A;  2KZJ A;  1YIT P;  4ZNC A;  3RBX A;  1OVU A;  2YO2 A;  4L73 A;  1KC8 Q;  3L70 G;  3AE9 C;  2P67 A;  3MHV A;  2QG4 A;  3EFF K;  3U1A A;  2G3A A;  4H13 C;  2R44 A;  3GF3 A;  2ZT9 D;  3L75 E;  2IBZ G;  2PAJ A;  1VQ5 P;  3CCV P;  1L0L D;  1SQV G;  3G6E P;  1YYC A;  3CCJ P;  3MZW B;  1DD3 A;  2J3F A;  3L72 J;  2UWJ E;  2FYU J;  3L71 J;  5GTH H;  1FZA B;  2PGD A;  2KNC B;  2R32 A;  2IYP A;  3G3Z A;  2E75 C;  2H43 C;  1L4A D;  4R9T A;  1JMB A;  1G1J A;  2H89 C;  3FX0 A;  3L73 E;  1PPJ G;  3HD7 D;  1VQO P;  4YXD C;  1E5W A;  1G1I A;  1BE3 J;  2WT7 B;  5APQ A;  1LP1 B;  1NAF A;  3LID A;  2Z4E B;  1DD4 A;  4H44 B;  1N7S D;  2IPP A;  2HLO A;  4GOD A;  1IFD A;  1SQV K;  1ZLL A;  2IZ1 A;  1LGH B;  4I2L C;  3GHG C;  3V2N A;  1VQP P;  3GLM A;  2FFD B;  1EQ7 A;  1ZP0 C;  2KXP B;  1R5L A;  1VQ6 P;  1JY3 N;  5AW4 B;  4I1L A;  3RGU A;  2JDI H;  2KK7 A;  2FY8 A;  2J60 A;  2AEM A;  3PRJ A;  3JCU H;  1L4A B;  2Z5H A;  2QRX A;  1N73 C;  1ZRT E;  1RF0 A;  1GDT A;  3CPW O;  4I7Z C;  1MFZ A;  3L74 E;  3JSV C;  2D2C C;  5APX A;  5CCH D;  1GK6 A;  2WSE J;  3H1J J;  3CME P;  3H1K D;  1U57 A;  3M91 A;  1IFP A;  1L0N K;  1X9V A;  2YIU B;  2RMZ A;  2M5A B;  1JB0 J;  4JPZ B;  3CCQ P;  1NTK J;  5CJ4 A;  4JYO X;  2A45 G;  4L76 A;  3IR9 A;  3VMZ A;  5CHX A;  2KS1 A;  1P84 H;  2J3U A;  1HUC A;  3CI9 A;  3H32 B;  4W7Y A;  2QE7 H;  3S9O A;  3TGU D;  3I56 P;  4H13 D;  3L75 D;  4UB8 E;  3CX5 D;  4EI2 A;  3CWB E;  3CX5 H;  3CX5 I;  3A2A A;  3H1H D;  3O6Q B;  1CW5 A;  1NTM J;  3V2Q A;  3NXS A;  4TLF A;  1RE4 B;  2FXP A;  2J0Y A;  5AW5 B;  1GD2 E;  1Y8A A;  2HFE D;  1JY2 O;  4W7Z A;  1K73 Q;  1LP1 A;  3CCS P;  1SQV E;  2QM8 A;  4BXL A;  1S5L X;  5KLV E;  1NAY A;  4UB6 H;  1KFN A;  2B87 A;  3OJA B;  1FU1 A;  1IZN B;  5E79 H;  2Q5U A;  3H1J D;  1FZA A;  4W80 A;  3ITK A;  4L74 A;  3VMX A;  2HPC A;  1L0L J;  2G8Y A;  1UII A;  5AW7 B;  3PH0 A;  1XTC C;  1JC9 A;  1KB9 D;  4OGQ D;  1QX8 A;  1RF1 A;  3GF7 A;  1YIJ P;  3H1J G;  2WSS H;  5GTI H;  4HKZ H;  1SQP E;  2FBW C;  2DW3 A;  4H0L C;  2Y0C A;  3PHL A;  1T8Z A;  5AW0 B;  2E76 D;  2WPS A;  3B5N D;  1Q7Y Q;  1S1C X;  4C7R A;  3KDP B;  5AVR B;  2HLO B;  1AV1 A;  5GTI E;  4N78 E;  1J1D C;  1FZC A;  1FZE B;  2WT7 A;  1FJP A;  2YXR B;  1T2K C;  4Y28 J;  1JY2 N;  1NTZ G;  2D2C B;  4IL6 E;  4B86 A;  1M1J C;  5KKZ B;  1KIL D;  3H32 A;  3H1K J;  2YKP A;  4M3L A;  2XND H;  4JYB A;  1BCC E;  2KS1 B;  4CPG A;  3GG2 A;  1QGK B;  3BCC E;  3AE4 C;  3KZI E;  2YMY A;  5E79 E;  1FZD A;  1LJ2 A;  1D7M A;  4KHX A;  1G2C A;  2J61 B;  5AVU B;  1VF5 B;  2V7Q H;  4IFM A;  1M8O B;  3PLN A;  1WMK A;  1OVR A;  3AE1 C;  1AFO A;  3BRT B;  1BGY E;  3AE6 C;  2ZAE B;  5DJU B;  4L75 A;  2GUS A;  2A06 E;  3HD7 C;  3Q5R A;  4HH2 A;  4JZC A;  2KLU A;  1R8E A;  1GTW A;  1LT9 C;  3H1I J;  2Z4E C;  2Y0E A;  1HTL C;  3E1I B;  4C7N A;  1H0T B;  4R4L A;  1DEE G;  4D6T D;  4A7P A;  4DOJ A;  2WZ7 A;  3V2P A;  3MP7 B;  2RH0 A;  2OYH B;  3TGU J;  3L74 D;  3F89 A;  3C8V A;  1SQP K;  2R5D A;  2FFD C;  1VQ8 P;  5KJ7 D;  2J58 A;  1S5L E;  1SQQ D;  3CWB G;  1Q86 Q;  1GMJ A;  2CPS A;  2KB7 P;  1LTJ B;  2O3J A;  1NHL A;  5CBO A;  3AE8 C;  3RL0 B;  1Q82 Q;  1OZH A;  5TIS H;  2QJP C;  1EZV I;  2ZYA A;  2CK3 H;  4H0L D;  5AW6 B;  4QMA A;  5KLV J;  3L4F A;  1BCC G;  3H1L G;  4IL6 H;  4NPD A;  2ZYG A;  2WIT A;  4ZMD A;  2BCC G;  1JCD A;  3HD7 B;  4PV1 C;  3PTZ A;  3PP5 A;  1KOR A;  1NU1 E;  1YTZ T;  2P10 A;  3BVH C;  2FYN C;  2WSF J;  3HE5 B;  3MIW A;  1NKZ B;  2J61 A;  3A0B E;  1BDC A;  4IFF A;  2YMK A;  1ZR2 A;  1ZW0 A;  3V4Q A;  1DIP A;  2FKW B;  3WUT A;  4ZKP A;  2HOD A;  3FWN A;  3NTN A;  3A0B H;  1FZF B;  1P84 D;  1JY3 P;  1GW3 A;  2WWW A;  5CCH A;  1BSH A;  3D70 A;  5AW2 B;  1NTZ K;  1CZQ A;  2JWD A;  2M5A A;  1GZL A;  2XDJ A;  5AVW B;  3GHG B;  2Q3I A;  1K9M Q;  1OW6 A;  1JNM A;  2AXT H;  3E7K A;  4ASW A;  1GL2 B;  2MJZ A;  1FZG A;  3H1L J;  1RY3 A;  3H1L D;  2OYO A;  3SFE C;  3II6 A;  3TNU B;  1NOH A;  1MKM A;  4ASV A;  3N7N A;  4M7H A;  3L73 G;  3FWL A;  4O9B A;  1YQ4 C;  3AEG C;  2E75 B;  2QJY B;  5KLI C;  1JEK A;  2A06 G;  1ZR4 A;  2ZXX A;  5CJ0 A;  3BVH B;  2R5B A;  3KYQ A;  3RL0 g;  5APS A;  4D6T J;  1LTT C;  1SQX J;  2B89 A;  2J5U A;  1GK4 A;  3VYI A;  1H89 A;  3IAO A;  1OVV A;  2Q9I A;  4H13 B;  1FZC B;  3BAS A;  2M8R A;  2B87 B;  4KT0 J;  4JBZ A;  5KAF E;  1S9K E;  1NTM D;  1FJK A;  2HYN A;  3A7O A;  1LWU B;  4RJT A;  1KMI Z;  5CMZ A;  1BSN A;  3MGN A;  4Y99 C;  1HJ0 A;  1X79 B;  2ZVN B;  1M1J B;  2YXQ B;  1RE4 A;  2FYU K;  3W67 A;  1NYH A;  1QEX A;  4UB8 H;  2K37 A;  3HTK A;  1Y9B A;  2QJK B;  3SSU A;  5AVX B;  1NTZ E;  3AED C;  2M0B A;  2FIB A;  1PPJ E;  3VMY A;  1KYO E;  2K1A A;  3L36 A;  3RK2 C;  1TU3 F;  3L71 E;  3A5T A;  3TSI A;  3E1R A;  2HR3 A;  4JF7 A;  3UIA A;  1KB9 I;  1KIL B;  2WMM A;  3MD0 A;  1SFC C;  2R3S A;  1FBM A;  5AW1 B;  3L75 J;  3BCC G;  2FYZ A;  1USE A;  3D6Y A;  3CXH I;  1VDF A;  2RN0 A;  3HE4 A;  1X22 A;  3CX5 E;  2XNX B;  3L72 E;  3USS A;  5B66 E;  4OVN F;  2XZR A;  1OW8 A;  1NTK K;  3SFD C;  2J3G A;  2J3F D;  4EDF A;  1KIL E;  2YNY A;  2HG5 D;  4AQR D;  1URQ A;  5CCG C;  3RK3 E;  2FXM A;  1EXI A;  5KJ7 C;  1KQL A;  3MTU E;  3Q5S A;  1QL2 A;  2OYI A;  3IN6 A;  1IK7 A;  3KZI H;  1VL2 A;  4U3F J;  5APV A;  1FZB B;  1JM0 A;  5TIS E;  2XV5 A;  1PP9 E;  1Y47 A;  1FZE C;  5KKZ C;  2BEZ F;  3GMA A;  4YXW H;  2JWA A;  3HTK B;  4N6J A;  2IBZ E;  2ZT9 C;  5DJT B;  4JYC A;  2IFM A;  3HD7 A;  3P8C D;  1CI6 A;  3AE5 C;  1X8Y A;  1KD1 Q;  1L4A A;  4IFD K;  1JUN A;  2A06 D;  1HJB A;  4UB6 E;  1SQQ K;  3LIE A;  1LWU A;  4ZFG A;  2GUV A;  4K35 A;  2QVA A;  2JEE A;  5B5E E;  3B71 A;  5AVV B;  3L74 J;  1N7S C;  5BVZ A;  4D6T E;  1NKN A;  1IFN A;  3I5C A;  3Q1M A;  2N9Y B;  4M7F A;  1NU1 K;  1ZV8 A;  1FZB A;  2HPC B;  5B5E H;  4PD4 H;  3D71 A;  1PP9 D;  3OA7 A;  3IF4 A;  2GM4 A;  1NVO A;  3AE2 C;  1A02 F;  2IBZ D;  2K3R A;  3C1L A;  1RQV A;  3BVH A;  1RF1 C;  2O01 H;  3R4Y A;  1YTZ I;  1GL2 D;  1W5C E;  3EWK A;  3L71 D;  1H0T A;  3HUS A;  3TYY A;  1FZG B;  4WBA A;  1K04 A;  1EDJ A;  2YO3 A;  3JC2 2;  4OGQ C;  3WU2 E;  1N86 A;  2Q9I B;  1NWQ A;  1L0N D;  1FDI A;  5AVQ B;  1L0N J;  3BAT A;  2GY7 A;  5BU5 A;  4H0L B;  2E76 C;  1LWU C;  2KSJ A;  1SQX G;  2J59 M;  4D6T G;  2Q7C A;  2R3C A;  1LTS C;  3CC7 P;  1K05 A;  2QSI A;  3H1J E;  1FAV A;  2OTL P;  3M0D A;  1UIX A;  3M9B A;  4EPU A;  3FXE A;  4ZKU A;  2KZI A;  3H1H J;  4I6M C;  2Z5I A;  5AW3 B;  1EZV E;  1JOC A;  3D6Z A;  3CCU P;  2AXC A;  3B4S A;  4YPC A;  2BAS A;  3QH9 A;  1NO4 A;  2QJY C;  1KQS O;  5BU8 B;  4U3F D;  1QL1 A;  1NH4 A;  3AEE C;  2POH A;  1RHZ B;  1GL2 A;  3AEB C;  1VQ4 P;  3SWY A;  2W6J H;  1N73 B;  2XNX A;  2C9N Y;  2IZ0 A;  2HPC C;  1Q81 Q;  1T3U A;  4BRY B;  2WNP F;  2KOG A;  4WB4 A;  4RES B;  1USD A;  5GTH E;  3LW5 J;  3P8C E;  3VMA A;  2QEX P;  1KZU B;  4AUW A;  1L0N G;  3L37 A;  4PD4 I;  4I7Z B;  2VRS A;  1R5S A;  1YQ3 C;  3VTP C;  3AEA C;  2J64 A;  1EDI A;  1OIP A;  2FYU G;  2FYN B;  4U3F E;  4OGQ B;  3KQG A;  4WWI A;  1Q90 D;  2QJK C;  1BE3 D;  5KLV D;  2N1T A;  2AEF A;  1NJI Q;  1LTI C;  1W2E A;  3NMD A;  1FZA C;  4R9J A;  3GW6 A;  1N86 C;  4WY4 A;  2E75 D;  2O01 J;  4NPF X;  5AW9 B;  1VQM P;  1AJY A;  3H1K E;  1L0L E;  1SFC D;  4JQ0 D;  3WMM 0;  1BCC J;  1BGY J;  3V4W A;  2JJL A;  2O1J A;  1SQB E;  2QA4 P;  1RQU A;  2O01 N;  1DX7 A;  4C7N B;  2HLO C;  3CXH D;  3AE7 C;  2P7J A;  3P8M C;  3P32 A;  5KLI B;  1JCC A;  5H2F E;  3M9H A;  1T3J A;  1N73 A;  2IBZ I;  1FC2 C;  1T6A A;  4IOI H;  4PJ0 H;  3I55 P;  1FE6 A;  2C0W A;  1L0L K;  3WUV A;  2KUB A;  2J0H A;  4OWF A;  1SP4 A;  4TT3 H;  1SQQ E;  1NTZ D;  2N9B A;  1FS0 E;  1PPJ D;  5AW8 B;  3CXH H;  3CL3 D;  2PRR A;  5AVS B;  1SFC B;  3CCM P;  3RL0 D;  1PL5 A;  2NZ2 A;  3ABV C;  5AVY B;  4H44 C;  3CXH E;  3CCE P;  1JTH B;  1VQ9 P;  2NPS D;  2ZT9 B;  4HYT B;  3G9R A;  2XNX C;  3ZDM A;  1S5L H;  2Q1K A;  1RE4 C;  1RE3 A;  3GHG A;  2Y9Z A;  3CCR P;  1S72 P;  3G4S P;  1JTH A;  1FDO A;  3G71 P;  3L75 G;  2SPZ A;  1BGY G;  2Y9Y A;  2IDB A;  1NU1 J;  2V7Q J;  2E74 B;  1SQX D;  3L70 E;  2K9J B;  1SLQ A;  1VQ7 P;  3KXD A;  1SQP D;  1OMI A;  4WY4 B;  3M06 A;  1FZC C;  5AVZ B;  2JHI F;  5APT A;  2IFN A;  2OYH A;  2FFD A;  1BE3 E;  4EOT A;  3K5B A;  2YIU C;  1N7L A;  3TK1 A;  2KP8 A;  3MUD C;  1OXZ A;  3IFM A;  2W27 A;  1S2E A;  1KV4 A;  1N86 B;  1JMM A;  1OX3 A;  2W8Z A;  1JY2 P;  1KYO D;  3NFQ A;  3V6I A;  5KTB A;  3L35 A;  1EDL A;  1VPC A;  1NTK G;  3O6Q A;  2N1T B;  2I8D A;  1YJN P;  2JHL F;  2E74 D;  2YKO A;  2WSC H;  1KQF B;  2JKV A;  2V4H A; 
#chains in the Genus database with same CATH homology
 1SFC A;  4N78 E;  1SQB K;  1J1D C;  1QL2 A;  3EFG A;  3U59 A;  2OYI A;  1FZC A;  4WY4 C;  2OYI B;  1FZE B;  1LT9 A;  1XTG B;  3B5N A;  5APV A;  1Z3U A;  1G2C B;  1FZB B;  1FIC A;  1LTJ C;  2WT7 A;  5CCG A;  3HUS B;  4OH8 B;  1FJP A;  2XU6 A;  2XV5 A;  1T2K C;  1FZF A;  1FZE C;  3MUD A;  1JY2 N;  3HTK B;  4N6J A;  1N7S A;  4JYC A;  4AYC A;  2IFM A;  2NPS A;  1J1E B;  3HD7 A;  3P8C D;  4B86 A;  1FID A;  1M1J C;  2CPB A;  5KLV K;  1CI6 A;  2PP6 A;  3B5N B;  1LT9 B;  1X8Y A;  1KIL D;  1L4A A;  4IFD K;  2A45 H;  1JUN A;  1MUU A;  3H32 A;  3T97 A;  1HJB A;  2YKP A;  1SQQ K;  3LIE A;  4M3L A;  1LWU A;  1GU5 A;  4ZFG A;  2GUV A;  4JYB A;  1GW4 A;  3N4X A;  3FIB A;  2JEE A;  1J2J B;  2LKM A;  1WRG A;  5AVV B;  5CCG D;  2I1J A;  1N7S C;  5BVZ A;  1MZ9 A;  1NKN A;  1IFN A;  5CCH C;  1RF0 C;  3I5C A;  3B5N C;  1GU4 A;  2XKM A;  2YMY A;  1NU1 K;  2E43 A;  4XA4 A;  1FZD A;  4M7F A;  3E1I A;  1ZV8 A;  4KHX A;  1FZB A;  1G2C A;  2HPC B;  2J61 B;  2QM7 A;  5AVU B;  3OA7 A;  3H32 C;  1Z56 A;  1FOS F;  2GM4 A;  1A02 F;  4IFM A;  2C0X A;  3VOP A;  1HGV A;  2O1K A;  1AFO A;  3BVH A;  3BRT B;  3HRN A;  3C9I A;  3V2R A;  1RF1 C;  4GIF A;  2O01 H;  2M3B A;  1IO4 A;  2GUS A;  1YTZ I;  1GL2 D;  3HD7 C;  1LTA C;  4HH2 A;  3KPE A;  3RK2 D;  3HUS A;  4XE5 B;  3TYY A;  4JZC A;  1FZG B;  4WBA A;  2C9L Y;  1IFJ A;  2YO3 A;  1GTW A;  1LT9 C;  2Z4E C;  1N86 A;  2Q9I B;  1HTL C;  1M7L A;  5APU A;  3RK3 B;  1NWQ A;  5AVQ B;  3E1I B;  4C7N A;  1HBW A;  3BAT A;  2N1T C;  1OWA A;  3RL0 C;  2GY7 A;  5BU5 A;  2OYI C;  2L5G B;  1LWU C;  2KSJ A;  4DOJ A;  1HGZ A;  2WZ7 A;  2I1K A;  3V2P A;  2J59 M;  2OYH B;  2Q7C A;  3CLQ A;  2H43 B;  1JY3 O;  2OAR A;  5APY A;  5KJ7 A;  1URQ C;  1SQP K;  2R5D A;  1LTS C;  2R3C A;  2FFD C;  5KJ7 D;  1CSB A;  1RF0 B;  2J58 A;  1PFI A;  1FZE A;  2WSE H;  3VN0 A;  1FAV A;  1FZF C;  3M0D A;  1RE3 C;  3H6P A;  2CPS A;  2KB7 P;  1LTJ B;  1IC2 A;  1NHL A;  3M9B A;  3RK2 B;  2Z4E A;  3EQ2 A;  4EPU A;  3M0A A;  1HVV A;  4ZKU A;  1FDM A;  1CI6 B;  3RL0 B;  4I6M C;  2YKQ A;  2Z5I A;  5AW3 B;  5AVT B;  1JOC A;  2KLV A;  2BAS A;  1IJD B;  1NO4 A;  1KFM A;  5AW6 B;  5BU8 B;  1RF1 B;  1IFI A;  1QL1 A;  1NH4 A;  3L4F A;  4LC1 A;  2POH A;  4Y99 B;  3SWF A;  2WPQ A;  1GL2 A;  4N78 D;  2JHK F;  1SVF A;  1ZN5 A;  3SWY A;  2WPR A;  2P2U A;  1N73 B;  2XNX A;  2C9N Y;  2YO2 A;  1A02 J;  2JHH C;  1T2K D;  2P67 A;  2HPC C;  2WIT A;  1T3U A;  1JCD A;  3U1A A;  1LTG C;  3HD7 B;  1FOS E;  2WNP F;  2H7H A;  2KOG A;  4WB4 A;  4RES B;  2PAJ A;  3PP5 A;  3P8C E;  1J1E C;  1KZU B;  4AUW A;  1YTZ T;  1YYC A;  3L37 A;  2J3F A;  3BVH C;  3MIW A;  3HE5 B;  2VRS A;  1NKZ B;  3LW5 H;  2J61 A;  1FZA B;  1RE3 B;  4IFF A;  1ZR2 A;  2R32 A;  2H8P D;  3HE4 B;  3VTP C;  2J64 A;  1KIL C;  3G3Z A;  2OYH C;  1LTB C;  2H43 C;  1L4A D;  4R9T A;  3V4Q A;  3KQG A;  1G1J A;  2FKW B;  4ZKP A;  2HOD A;  4LGD E;  3NTN A;  1FZB C;  1GL2 C;  3HD7 D;  3E1I C;  1FZF B;  2J5Z A;  3B8E B;  1E5W A;  1JY3 P;  1GW3 A;  1N2D C;  1G1I A;  2WWW A;  5CCH A;  1FZG C;  2WT7 B;  5AW2 B;  1NTZ K;  2W6A A;  1CZQ A;  5APQ A;  2N1T A;  2WSF H;  1HWT C;  1NAF A;  1GZL A;  3LID A;  2XDJ A;  3U1C A;  2Z4E B;  1LTI C;  1W2E A;  3NMD A;  1H8A A;  1FZA C;  5AVW B;  2A45 I;  3GHG B;  4R9J A;  3RK3 C;  1N7S D;  2Q3I A;  1N86 C;  4WY4 A;  2IPP A;  1WT6 A;  2HLO A;  3VP9 A;  1JNM A;  1IFD A;  5AW9 B;  4GKG A;  1SQV K;  1ZLL A;  4C46 A;  1LGH B;  1SFC D;  2ZXE B;  3GHG C;  4I2L C;  1GL2 B;  2MJZ A;  3WMM 0;  3V2N A;  1FZG A;  1RY3 A;  1JO5 A;  3V4W A;  2JJL A;  2O1J A;  2FFD B;  2D39 A;  1EQ7 A;  3II6 A;  3TNU B;  1NOH A;  4LLH A;  3RK3 D;  1DX7 A;  4C7N B;  1FIB A;  4NYT A;  3N7N A;  1H88 A;  1JY3 N;  2HLO C;  3A3Y B;  5AW4 B;  4M7H A;  4EIJ A;  4I1L A;  2P7J A;  1SQX K;  3P8M C;  3P32 A;  1JCC A;  4O9B A;  3M9H A;  1T3J A;  2J60 A;  1AQ5 A;  1N73 A;  1L4A B;  2Z5H A;  1N73 C;  2C0W A;  1RF0 A;  4WY4 D;  1L0L K;  1GDT A;  2J0H A;  1ZR4 A;  2J2P A;  5CJ0 A;  1NTM K;  3BVH B;  2R5B A;  1MFZ A;  1SP4 A;  2NPS B;  3KYQ A;  5APS A;  3BRV B;  2W6B A;  3OAK A;  1LTT C;  5APX A;  1MV8 A;  5CCH D;  1KIL A;  1GK6 A;  3M0D C;  2ZFC A;  1GK4 A;  3M91 A;  4DZO A;  1DEB A;  3VYI A;  1L0N K;  1H89 A;  2N9B A;  1IFM A;  5AW8 B;  1DH3 A;  1X9V A;  1Z3S A;  2Q9I A;  1FZC B;  3HE5 A;  3CL3 D;  5AVS B;  3BAS A;  2M8R A;  1SFC B;  1J1D B;  1M1J A;  3RL0 D;  3O8Z A;  5AVY B;  1S9K E;  2KYV A;  5CJ4 A;  4JYO X;  1FJK A;  1JTH B;  2A45 G;  2HYN A;  1N7S B;  4GT1 A;  3A7O A;  1LWU B;  3IR9 A;  3VMZ A;  1IK9 A;  5CMZ A;  1URQ D;  5CHX A;  2NPS D;  3MGN A;  4Y99 C;  4HYT B;  2J3U A;  1X79 B;  1HUC A;  2XNX C;  1M1J B;  1RE4 C;  3CI9 A;  1RE3 A;  3H32 B;  4W7Y A;  3GHG A;  1RE4 A;  2FYU K;  1L4A C;  1JTH A;  3HTK A;  3TNU A;  5AVX B;  3P7K A;  5APW A;  3A2A A;  2FIB A;  3VMY A;  2E42 A;  3L36 A;  2P1J A;  1SLQ A;  1CW5 A;  3V2Q A;  3RK2 C;  3NXS A;  1RE4 B;  2J0Y A;  5AW5 B;  1GD2 E;  2HFE D;  1JY2 O;  3A5T A;  3TSI A;  4WY4 B;  1LTJ A;  4JF7 A;  2J0G A;  2WTY A;  3UIA A;  1S9K D;  3M06 A;  4W7Z A;  1FZC C;  1KIL B;  5AVZ B;  3MD0 A;  2JHI F;  5APT A;  1SFC C;  2IX7 C;  2N1T D;  2IFN A;  3R2P A;  1FBM A;  5AW1 B;  2H43 A;  2OYH A;  2QM8 A;  2FFD A;  2FYZ A;  2J1G A;  4EOT A;  2HOD B;  3VP8 A;  1URQ B;  1KFN A;  1N7L A;  2NPS C;  3OJA B;  1FU1 A;  1VDF A;  3HE4 A;  2Q5U A;  3TK1 A;  2KP8 A;  1OXZ A;  3IFM A;  2W27 A;  2XNX B;  1FZA A;  4W80 A;  1N86 B;  1JMM A;  3VMX A;  2HPC A;  2XZR A;  2JHM F;  5AW7 B;  1NTK K;  1XTC C;  2J3G A;  1JC9 A;  2J3F D;  1JY2 P;  2J3O A;  3NFQ A;  5KTB A;  2YNY A;  2HG5 D;  3L35 A;  3M9Q A;  1RF1 A;  4AQR D;  1URQ A;  1VPC A;  3HUS C;  2N1T B;  2HOD C;  5CCG C;  2FXM A;  2JHL F;  1T8Z A;  2YKO A;  5AW0 B;  4N3Y B;  2WPS A;  3B5N D;  2Q9I C;  5KJ7 C;  2WSC H;  4C7R A;  1KQL A;  3KDP B;  5AVR B;  1HH0 A;  2HLO B;  3V5B A;  3MTU E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...