1RE4C

Crystal structure of fragment d of bbetad398a fibrinogen
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
298
structure length
298
Chain Sequence
YEASILTHDSSIRYLQEIYNSNNQKIVNLKEKVAQLEAQCQEPCKDTVQIHDITGKDCQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQSAIPYALRVELEDWNGRTSTADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEGNCAEQDGSGWWMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIPFNRLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title BbetaGlu397 and BbetaAsp398 but not BbetaAsp432 are required for "B:b" interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
molecule keywords Fibrinogen alpha/alpha-E chain
total genus 82
structure length 298
sequence length 298
chains with identical sequence F
ec nomenclature
pdb deposition date 2003-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1re4C01
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 1re4C02
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 1re4C03
2J0HA 1Z3UA 1LWUB 3E1IA 3GHGA 3H32B 1LTJC 1JY3P 2J1GA 1W2EA 2OYIA 1FZAC 1M1JC 2A45H 2JHHC 2J3FD 2J61B 1RE3C 3H32C 1RE3A 1FZEB 2GY7A 4M7HA 1M1JA 1RE4C 2D39A 2J3FA 1LT9C 1RF0A 2J3OA 2J0YA 2HLOB 1FZCA 2J2PA 1N73B 3E1IC 3E1IB 4M7FA 3GHGB 3H32A 2J5ZA 2XNXB 2J3UA 1FZGC 2A45G 1RF1B 2A45I 2FIBA 4NYTA 1FZFC 1FICA 1JY3O 1FZFA 1Z3SA 1JY2P 4JYOX 3FIBA 2HPCA 2Q9IA 3GHGC 2OYHC 1RE3B 2OYHB 1FZEA 1JY3N 1FZCC 1JY2N 1N86B 1N73C 4JZCA 4EPUA 4R9TA 2XNXC 2J64A 3HUSC 3BVHA 3HUSB 2Q9IC 2J60A 2JHKF 1FZAB 4ZFGA 2XNXA 2Z4EB 1T3UA 1RF1A 1FZBA 1FZFB 2H43C 1LTJB 1FZGA 2JHMF 1RE4B 2HPCB 2Q9IB 2OYHA 1FIBA 1LWUC 1FZDA 1LT9A 1RF0C 1N86A 2HLOC 2H43A 2HODA 1JY2O 2FFDA 2J0GA 2JHLF 1JC9A 3BVHB 1LWUA 3HUSA 3BVHC 1FZAA 2Z4EA 1FIDA 4R9JA 1FZBB 1LTJA 1FZBC 2OYIB 1FZGB 2Z4EC 1RF1C 2JHIF 1RE4A 1FZEC 2J3GA 2J61A 2WNPF 2HPCC 1M1JB 1LT9B 2H43B 2OYIC 2HODB 2FFDC 2HODC 2FFDB 1RF0B 1N86C 2HLOA 1FZCB 1N73A
chains in the Genus database with same CATH superfamily
1YQ3C 5AW6B 3CPWO 4XA4A 3Q5RA 2LR2A 2OYIA 5APTA 2K1AA 5KLVJ 1QX8A 4JF7A 3L35A 3AE6C 3PRJA 2E76B 4N3YB 3A0BH 2ZT9B 5TJHA 3ZDMA 4CPGA 3RGUA 4I7ZB 4H0LB 4AUWA 1VQOP 3CWBG 2IBZE 5KLVE 2PFXA 2Q7CA 3FWNA 1M7LA 4IOIH 1SQVK 5AW8B 3RL0g 1K73Q 3JCUE 2R3CA 1LTJB 2FYZA 2W6BA 1EZVG 3D71A 1FBMA 2K9JA 3V5BA 1GU4A 2BCCE 3K5BA 1Q81Q 3P7KA 3C9IA 1JM0A 1SQPJ 3BCCJ 1S3JA 3BRTB 2JHIF 3V4QA 1NAFA 2G8YA 5B66H 3S1KA 2HODC 1L0LG 5APYA 3WUTA 1NHLA 3FXDA 3PP5A 2H7HA 2IZ0A 3USSA 2Q3IA 2E75C 1NU1D 3HE4B 2K9YA 3H1LE 2E75D 2QJKB 3L73J 1L0NE 2FY8A 3RK2B 1SFCC 1OW8A 5AW5B 1M1JA 1UIIA 1SQBE 1H0TB 2W90A 4W7YA 4JYCA 4N78D 2XNXB 2CPBA 1E79H 1L0LJ 1FAVA 3TGUG 1KYOD 2GUSA 4D6TE 5GTHH 3S4RA 1A02F 1JUNA 1FZCC 2H8PD 1HJ0A 3AEFC 1NTZJ 1EZVD 3EWKA 2JP3A 5CBOA 1R8EA 1N8RQ 1PV3A 5AW1B 2XNXA 4GT1A 1RHZB 3TYYA 2YXQB 2WITA 4JQ0D 4PD4D 2XKMA 1GL2B 2V7QJ 1LWUA 1BGYJ 2B9BA 3IFMA 1X79B 1FDMA 5KJ7A 3E1RA 4RESB 4IFMA 1SQQD 3RK2D 2AEMA 2KIKA 1QVGO 1KILB 1L4AD 1VQ8P 1KQGB 1LJ2A 5CCHC 1Z3UA 2KSJA 4WWIA 1DH3A 1M56D 3H32B 2BEZF 1IFJA 3EFGA 3AE3C 2C0WA 2M8RA 3L75J 2JJLA 1Y8AA 1L0NG 1GMJA 1BGYE 2D2CC 3H1KE 4K3AA 2V4HA 1FZCA 1YTZT 1KYOI 5KAIH 2WQYC 3I55P 4HH2A 2N1TB 2R32A 2W6JH 1YJ9P 2FYUG 4PV1D 1XTGB 2WWWA 2HPCA 3L74D 1KORA 1L2PA 5CBNA 1KILC 3L72E 4JZCA 1OVRA 2KS1B 1USEA 3V2RA 3H1HJ 1NKZB 2FYUK 2Q9IC 4I1LA 1VQNP 2QE7H 5CCHD 1PFIA 4GOEA 3L4FA 2FXOA 1RE4B 1PGJA 3I56P 1PGQA 3CWBE 3MP7B 3MZWB 2CPSA 2HLOC 3F89A 3AE4C 4QMAA 2FYUJ 1HGVA 2MKVA 1FC2C 1GW4A 3TK1A 4WB4A 1CI6B 3A2AA 2Y9YA 2ZVNB 2J61A 2XV5A 5KLVG 3Q5PA 1RY3A 2A06D 3Q2YA 3RL0D 1KQLA 2JWDA 3VN0A 2I1KA 2KK7A 5EFWB 3H1HD 3RBXA 1HBWA 1NOHA 4K35A 2KNCB 2A45H 2JHHC 1SQBJ 1E5WA 3HD7B 3CI9A 1FDIA 1S5LX 1KILA 1N73B 1VQ6P 1PGOA 3MTUE 3CX5I 4NYTA 1CW5A 1VQ7P 3W67A 4LC1A 1Y9BA 1VDFA 1FS0E 1X22A 3M9QA 4NPEA 2ZXXA 4UB8H 4PJ0H 1NGMB 1LTIC 1HWTC 3BVHA 4NPFX 2JHKF 2QM7A 1S5LH 3KHUA 1W2BO 2HPCB 1HJBA 4HJGH 1SQQJ 5CCHA 1JNMA 2GA1A 2MJZA 2QJPB 2YKOA 4U3FG 1R5LA 3BVHB 1QVFO 3TNUA 5KTBA 4L74A 1VF5B 1NTMK 3SWFA 1FZGB 2OYIB 1S1CX 1FJKA 4M3LA 1EZVE 1MFZA 5APWA 2N1TD 3L71D 2H43B 2K37A 4EIJA 2BCCJ 1PZQA 3CXHI 3VYIA 5APSA 3HE5B 1PPJE 3MIWA 4Z1MH 1NTZD 2J3FD 3H32C 2IBZG 1ZRTD 2FYNB 3NMDA 4UB6E 1T2KC 3CCVP 3H25A 1DD3A 4UB6H 1L0LD 1AVYA 3EQ2A 3HD7D 3B5ND 4GDOA 1RF1B 2O01H 1FICA 5M1BA 1FE6A 4DZOA 3P8CE 4C7NB 3JC22 1N73C 3L73D 2W8ZA 5H2FH 1KV4A 1EDLA 2IDBA 2G3AA 2QIWA 1FZBA 2OYOA 3WUVA 1ZR2A 3CCJP 2E43A 3GW6A 2M0BA 1GK6A 1VQPP 4BXLA 2D2CB 5BVZA 1NU1K 3IAOA 1PIXA 3SWYA 5B5EH 1M57D 4HB1A 5AW7B 1KB9D 3HE4A 3AE7C 2JKVA 2NPSD 2C9LY 2IBZD 5E79E 4ASVA 2JWAA 1YJWP 1YYCA 2J1GA 4N6JA 2J5UA 2KOGA 2LKMA 5KLVK 3E7KA 3SSUA 1AVOA 1JCCA 2M3EA 1G2CB 5H2FE 1VQMP 5AVWB 1NKNA 3WU2H 2J0YA 2QM8A 5C39A 3A0BE 2R5DA 1Q7YQ 2J3UA 1FZGC 2B88A 1FZFC 2JR8A 4L73A 1USDA 3GHGC 2I1JA 1JO5A 5AW4B 1NTKD 1IK7A 1ZXGA 3O6QA 3RK3E 1L4AB 3AECC 4OWFA 2WZ7A 5CMZA 3L75G 2K3RA 5AW3B 3C1LA 5AW0B 3ABVC 3LIEA 2BCCD 3O8ZA 4AYCA 3D70A 3L71J 1NTZK 3G4SP 3B5NA 1LT9A 1LTTC 1L0LE 2WSCJ 1L4AA 1M90Q 1KD1Q 3H1KG 2HR3A 1K05A 2WSFJ 3AEAC 1FOSE 4LLHA 1MZ9A 4WY4A 3RK3B 1FZBB 4U3FD 1FZEC 1IO4A 4U3FJ 1A02J 3VP9A 1GL2C 3B5NB 1SQXJ 1NTMD 1NTKE 1SQVG 2HODB 2E42A 1N86C 5B66E 3CCUP 4LGDE 3CMEP 2QRXA 3L71G 2A06E 1VPCA 1AQTA 2W6AA 2PGDA 4H13D 5CCGC 3MUDC 2QJYC 1AQ5A 1NTZG 1U57A 1CSBA 4OGQB 3CCQP 2L91A 1JTHA 2A45I 3OAKA 3B5NC 4UB8E 1HH0A 1EQ7A 1KQFB 3AE5C 2XNDH 1JY2N 3CCRP 1G1IA 3OA7A 1SQPE 3HUSB 3M06A 2NPSB 4ZFGA 3L72D 2H43C 1NO4A 2UWJE 3TGUE 4WY4C 3A0HH 4H44C 2JEEA 2P7JA 1L0ND 2D2CD 2IFMA 2Z5HA 2OARA 1L0LK 3BVHC 4IL6E 5TISE 1OWAA 3H1HE 2KSEA 1FIDA 3V4WA 3U1CA 2POHA 1OW6A 3RL0B 2Y0EA 3A5TA 2HPCC 1BDCA 1J1EC 1S2EA 1R5SA 3R2PA 3PHLA 1GZLA 2A06G 5GTIH 3GHGA 5AVSB 3TF5A 4WY4B 3H1JJ 1CI6A 1EC5A 4YPCA 2J61B 1RE3A 2FYNC 2GY7A 4WY4D 2J3FA 3CWBD 4YXDC 2BCCG 3H1ID 3AE8C 1J2JB 1OMIA 3H32A 1P84H 1ZRTE 2A45G 3A0HE 4DT0A 2WSSH 1LTBC 2WPQA 1JY2P 1OW7A 2OYHB 3OW2O 1QL1A 3IF4A 3L75D 2Y0CA 5TISH 5KAFH 2V7QH 2J64A 2Z5IA 1BDDA 1VQ4P 3L75E 3SWKA 3L74E 1SQPK 1T3UA 1SQXE 1IC2A 3HRNA 1JCDA 1X9VA 3PLNA 2ZFCA 2WSEJ 3VMAA 4C7RA 1T3JA 2O01J 1BGYD 1PPJG 1LT1A 1N7SC 3GF3A 1U7MA 4R9JA 1FZBC 1RF1C 1ZW0A 1G2CA 3P8CD 3F5HA 4L75A 1RH5B 1H89A 4GKGA 2XZRA 5BU5A 2WSEH 3RK2C 3QH9A 1NTMG 3RK3D 4PD4I 3GMAA 3HTKA 1VQ5P 1FZAC 1H8AA 3GLMA 1UIXA 2IBZI 5K5GB 4O9BA 2D39A 3G6EP 1QL2A 2J2PA 2BEQD 2HYNA 2N9YB 1KB9I 3GHGB 3A7OA 3CXHE 3MGNA 4JYOX 3Q5SA 3HD7C 3FIBA 1VQLP 2B87A 1BE3D 4D6TG 1W5CE 1NTKG 1OFCX 1WT6A 1LTGC 1Q2NA 1IFDA 3M9BA 1NU1J 1EDIA 1QLED 2OQQA 3G3ZA 2C0XA 2J60A 2Z4EB 3KDPB 1ZN5A 2KP8A 2YNYA 1YTZI 1FZDA 1S72P 3M91A 3VMXA 3H1IE 4H13C 4DJGA 4GIFA 3PJSK 2JHLF 1BSHA 2E75B 1KC8Q 2FXPA 4EYYQ 1FOSF 1BCCG 1FZAA 1NU1E 1L0NK 2Z4EA 1LTJA 1GW3A 3G9RA 3FWLA 1SQBK 3RL0C 3SFEC 2PRRA 4EDFA 1IFIA 2OTKE 1H0TA 1ZLLA 4IL6X 2I8DA 1KB9E 3L73G 1HVVA 2FYUD 1L0NJ 3RBZA 3VP8A 1MFTA 2ITAA 1M1JC 3SFDC 3CXHD 4OVNF 4PV1B 1J1DC 1OVVA 1SLQA 3O6QB 3L72J 4OGQD 3JCUH 2IZ1A 4TLFA 2M5AA 2O1JA 3E1IC 4H44B 3CCSP 1NH4A 2WT7B 3AE2C 1SQQK 3VOPA 3L74J 4WBAA 2OYHC 5AVYB 1BGYG 1PPJD 2Y0DA 5KLVD 1N7SA 4EPUA 2ZYGA 4DCKA 2XNXC 4ZKPA 3IR9A 2XU6A 2BASA 3PH0A 1YIJP 3AEGC 3WU2E 4B86A 3CCEP 1T8ZA 2ZT9C 3G71P 1YITP 1LTSC 3M0DC 2ZT9D 4A7PA 1RF0C 2KB7P 4H0LC 1KB9H 2Q3EA 3AE9C 1JY2O 1NTZE 2QJYB 2FXMA 4DOJA 1N7SD 1M8OB 2ZVOB 3TDKA 1IFPA 5KJ7C 1SQXD 3B8EB 1KTMA 4YXWH 5B5EE 4IFFA 1GK4A 2N1TC 3B71A 1J1DB 4JPZB 1DX7A 2SPZA 2NRGA 2E74D 3V2NA 2K9JB 1L4AC 2FFDC 2E74C 1ZR4A 2GM4A 4JBZA 2IYOA 4ZMDA 4C46A 1LWUB 2ZJSE 3VMYA 1LP1A 1VQ9P 4EI2A 3RK3C 3H1KD 4N78E 5CCGD 1WMKA 3CX5H 4IFDK 2W27A 3L70G 4M7HA 2J59M 2P10A 2Q1KA 5KLIC 1LT9C 3AEEC 1BCCJ 4W7ZA 2YKPA 1Q82Q 4M7FA 1NTKJ 5KAIE 3PTZA 3CL3D 2YIUB 4XE5B 1FZEA 1H88A 1Y47A 1VF5D 3FX0A 2R44A 3M0DA 3CCMP 4R9TA 2H88C 2M5AB 2WPSA 3B4SA 3L73E 1NU1G 2E5TA 3KQGA 1NYHA 2N1TA 2IFNA 4ZKUA 1FZFB 5AVRB 1KQSO 1X0TA 3KYQA 1NTKK 4BWNA 1SQXG 1AA0A 2P1JA 2H43A 2RH0A 3FGAD 3CCLP 1ZV8A 2GUVA 2KZJA 1VL2A 2FYUE 3CC2P 2KZIA 1NVOA 4PV1C 4U7JA 2B89A 2WNPF 1KFMA 1KYOH 3BCCD 3L72G 1SQPD 5AVXB 4I7ZC 1Q86Q 3WMM0 1N73A 2IX7C 1K9MQ 3CMAP 3E1IA 1GU5A 1GTWA 2R5BA 4IL6H 3GF7A 4ASWA 2RN0A 4JYBA 3VTPC 4BRYA 1X8YA 1GD2E 3H1JG 2WSFH 2HG5D 3E1IB 4ZNCA 2WSCH 2XDJA 2P67A 3P32A 2Y9ZA 1LP1B 1WRGA 2DW3A 3W68A 2RKLA 3QWOC 2P58A 5AVUB 3ITKA 1FDOA 1S4XA 2QJPC 2AEJA 1GDTA 1NTME 2KLUA 3A3YB 4WVZA 1AV1A 1JOCA 1T6AA 2H89C 2YMKA 2JHMF 1N7LA 3FXEA 1EZVI 3M9HA 1N86A 1SQXK 3IN6A 3KPEA 4H13B 2FFDA 2OTLP 1HUCA 4Y99C 1LGHB 1SQPG 3HE5A 3MD0A 1YJNP 3U1AA 1Z56A 2WPVB 1IZNB 3HTKB 2Z4EC 1PP9E 3VMZA 1KILD 1KZUB 1SP4A 4Y99B 2E74B 3Q3DA 1IJDB 2FFDB 1PP9D 2KI7B 2QEXP 2FKWB 2M3BA 5AW2B 1BCCE 1HGZA 2YXRB 1K04A 1ZOYC 4PD4H 3V6IA 2B87B 4PD4E 1EDKA 5CHXA 3P8MC 4HKZH 2YO2A 5BU8B 3CC4P 3H6PA 1MUUA 3WUUA 3TGUJ 2FIBA 1Z3SA 1NAYA 1P84E 4W80A 1RE3B 1S9KD 3EFFK 1BE3G 4D6TD 3HUSC 1DEBA 3C8VA 1YI2P 3H1HG 4H44D 2N9BA 3I5CA 3NXSA 2Q9IB 5AVTB 1SQBD 2ZAEB 2PAJA 2OYHA 1QGKB 2CK3H 2Q6QA 1NJIQ 3N4XA 5CCGA 2QVAA 2JDIH 3CLQA 4OH8B 2O3JA 2YKQA 1OX3A 4GODA 3H1LJ 1SFCA 1KFNA 2OYIC 3H1JE 2HLOA 1BE3E 5CJ4A 2J0HA 3TNUB 1LTJC 3CX5E 2FBWC 2YMYA 5GTHE 2WT7A 1MKMA 1KILE 2K88A 4HYTB 5KKZB 1FZEB 1BE3J 1ZMEC 1AJYA 2J58A 1EXJA 2J3OA 2HLOB 5AVVB 5L8RJ 5KJ7D 3TGUD 2O1KA 4L76A 1IFMA 1GL2D 4XFJA 2LXBA 1SVFA 1JMBA 1DEEG 1SQBG 4YTPC 3U59A 3BATA 1CZQA 3L71E 3L70J 1SQQG 4R4LA 3II6A 3KZIE 1RF1A 3T97B 2YO3A 2AXTE 3R4YA 1YBKA 5APVA 2LXCB 5E79H 1LWUC 4C7NA 2HFED 4AQRD 2HODA 2VRSA 1N7SB 1SQVJ 4I2LC 4GOFA 3UIAA 1JC9A 1DD4A 1FU1A 1IK9A 4OGQC 3MHVA 1DIPA 3L74G 3T97A 2IYPA 2KNCA 1URQC 2ZXEB 1PP9G 1QEXA 3BCCG 2PP6A 4R4MA 4BRYB 1RF0B 2IPPA 3H1IG 1OXZA 1GL2A 1FZCB 3OJAB 2R3SA 2AEFA 4KHXA 4U3FE 2W83C 1SQQE 5CJ0A 1JTHB 1SQVD 3AEBC 1W2EA 3LW5H 5APQA 1P84I 3M0AA 3L70E 3CC7P 1YQ4C 1RE3C 1KN7A 3BASA 5KKZC 3NTNA 1RE4C 5DJUB 3JSVC 1RF0A 3L70D 3V2PA 4RJTA 3MUDA 3KZIH 4EOTA 2NPSA 2J5ZA 2QJKC 2AXTH 1URQB 3H1IJ 1JY3O 1FZFA 3CWBJ 1HTLC 5AW9B 4RKUJ 1VQKP 4PJ0E 1D7MA 5AVQB 1LTAC 2QSIA 3CX5D 3S9OA 1JY3N 1EXIA 2OGUA 1VF5C 1YHQP 3H1JD 2WPRA 4I6MC 3L37A 1S5LE 1KMIZ 3N7NA 1JB0J 1URQA 1SFCD 3AE1C 1KYOE 2KUBA 1NWQA 4RO0A 1FIBA 2KS1A 3Q1MA 3KXDA 3LIDA 5DJTB 5APXA 1RQVA 5KAFE 2KLVA 2JO1A 2Q5UA 3H1LD 1RE4A 1PL5A 2E76D 1Q90D 2OTJP 3NFQA 3HD7A 1LT9B 5KLIB 1HF9A 2E76C 3D6ZA 3BCCE 2WMMA 2QG4A 4NPDA 2NPSC 3L36A 1OVUA 1JMMA 1P84D 1S9KE 1JY3P 2O01N 5GTIE 1IFNA 1N2DC 4MN4C 2E5YA 4H0LD 1XTCC 3AEDC 2WTYA 1K8AQ 4TT3H 1EDJA 1AFOA 1J1EB 1TU3F 4D6TJ 3D6YA 2P2UA 1BCCD 2RMZA 2C9NY 3GG2A 2Q9IA 4Y28J 1JEKA 3H1LG 2YIUC 1SS1A 1N86B 5AVZB 1SQVE 3H1KJ 2ZYAA 1ZP0C 1RQUA 1FZAB 4KT0J 5APUA 1FZGA 2KXPB 1T2KD 1MV8A 1NTMJ 3CXHH 1SFCB 2WVRA 1BSNA 1M1KQ 2NZ2A 2ZYDA 2QA4P 1U7JA 2J0GA 1FJPA 3V2QA 1G1JA 4KJMA 3HUSA 3LW5J 1PP9J 1LNQA 3BRVB 3CD6P 1OIPA 2L5GB 2KYVA 2J3GA 1M1JB 3TSIA 1URQD 1OZHA 2AXCA 1PGPA
chains in the Genus database with same CATH topology
3VYIA 5BU5A 2WSEH 5AW6B 5APSA 3RK2C 3HE5B 2FKWB 2M3BA 5AW2B 3RK3D 4XA4A 1HGZA 2OYIA 3HTKA 1FZAC 3MIWA 1H8AA 5APTA 2J3FD 4JF7A 3H32C 3L35A 3NMDA 1T2KC 5CHXA 4O9BA 3P8MC 2D39A 2YO2A 5BU8B 4N3YB 1QL2A 2J2PA 2HYNA 3H6PA 3EQ2A 3A7OA 3GHGB 1MUUA 3HD7D 3B5ND 1RF1B 2O01H 2FIBA 1FICA 1Z3SA 3MGNA 4JYOX 3HD7C 4W80A 4AUWA 3FIBA 4DZOA 3P8CE 1RE3B 1S9KD 4C7NB 1N73C 1WT6A 1LTGC 1IFDA 3M9BA 2Q7CA 1M7LA 3HUSC 1SQVK 5AW8B 1DEBA 3G3ZA 2C0XA 2J60A 2Z4EB 3KDPB 1ZN5A 2N9BA 2R3CA 1FZBA 2KP8A 1LTJB 2FYZA 2W6BA 3I5CA 3NXSA 1ZR2A 2Q9IB 2YNYA 5AVTB 2E43A 2PAJA 2OYHA 1FBMA 1YTZI 1GK6A 1FZDA 3M91A 3N4XA 3VMXA 3V5BA 1GU4A 5CCGA 5BVZA 1NU1K 4GIFA 2JHLF 3P7KA 3SWYA 3C9IA 1FOSF 1FZAA 3CLQA 1L0NK 2Z4EA 5AW7B 4OH8B 3HE4A 1LTJA 3BRTB 1GW3A 2YKQA 2JHIF 3V4QA 1NAFA 1SQBK 3RL0C 1SFCA 2NPSD 1KFNA 2OYIC 2HODC 1IFIA 2C9LY 5APYA 2HLOA 1NHLA 1ZLLA 5CJ4A 2J0HA 3PP5A 2H7HA 3TNUB 1HVVA 2Q3IA 1YYCA 1LTJC 3VP8A 2YMYA 4N6JA 2J1GA 2WT7A 3HE4B 2KOGA 1M1JC 2LKMA 5KLVK 3RK2B 1JCCA 1SFCC 5AW5B 4HYTB 1G2CB 1J1DC 1FZEB 1M1JA 5AVWB 1SLQA 1NKNA 2J58A 2J3OA 2J0YA 2HLOB 5AVVB 4W7YA 2QM8A 5KJ7D 4JYCA 2O1JA 3E1IC 4N78D 2O1KA 2R5DA 2XNXB 1IFMA 2CPBA 2J3UA 1FZGC 1NH4A 2WT7B 1FZFC 1FAVA 1SQQK 2GUSA 3VOPA 1GL2D 1SVFA 4WBAA 3GHGC 2OYHC 5AVYB 2I1JA 1A02F 1JUNA 1JO5A 1FZCC 5AW4B 2H8PD 1N7SA 1L4AB 4EPUA 3U59A 3BATA 2XNXC 2WZ7A 3IR9A 4ZKPA 2XU6A 1CZQA 2BASA 5AW1B 5CMZA 4B86A 5AW3B 2XNXA 3II6A 5AW0B 1T8ZA 1RF1A 4GT1A 2YO3A 3LIEA 3TYYA 3O8ZA 1LTSC 2WITA 3M0DC 4AYCA 1NTZK 5APVA 1LWUC 4C7NA 2HFED 4AQRD 3B5NA 1LT9A 1RF0C 2KB7P 1LTTC 2HODA 2VRSA 1N7SB 1JY2O 4I2LC 2XKMA 3UIAA 1L4AA 1GL2B 2FXMA 4DOJA 1N7SD 1JC9A 1LWUA 1FU1A 1IK9A 1FOSE 3IFMA 1X79B 4LLHA 1MZ9A 5KJ7C 4WY4A 3RK3B 1FDMA 3T97A 3B8EB 1FZBB 4IFFA 5KJ7A 1GK4A 1URQC 2N1TC 1J1DB 1FZEC 1IO4A 2ZXEB 1DX7A 4RESB 4IFMA 3V2NA 3VP9A 1A02J 1GL2C 2PP6A 3B5NB 1L4AC 2HODB 2FFDC 2E42A 3RK2D 1RF0B 2IPPA 1ZR4A 1OXZA 1GL2A 2GM4A 1N86C 1FZCB 1KILB 1L4AD 3OJAB 5CCHC 1Z3UA 4LGDE 4C46A 1LWUB 2KSJA 1DH3A 4KHXA 5CJ0A 3H32B 3VMYA 1JTHB 1IFJA 3EFGA 1W2EA 1VPCA 2C0WA 3LW5H 5APQA 2W6AA 3M0AA 3RK3C 4N78E 2M8RA 5CCGD 4IFDK 2W27A 2JJLA 1RE3C 3BASA 4M7HA 3NTNA 5CCGC 1RE4C 2J59M 1AQ5A 1LT9C 1RF0A 3V2PA 1FZCA 1CSBA 3MUDA 1YTZT 4W7ZA 2YKPA 4EOTA 4M7FA 2NPSA 4HH2A 1JTHA 2J5ZA 1URQB 2N1TB 2R32A 2A45I 1JY3O 1FZFA 1HTLC 1XTGB 3OAKA 5AW9B 3CL3D 2WWWA 3B5NC 2HPCA 1HH0A 5AVQB 1LTAC 1EQ7A 4XE5B 1FZEA 1H88A 1JY3N 3M0DA 1KILC 1JY2N 1G1IA 4JZCA 4R9TA 3OA7A 3V2RA 2WPRA 4I6MC 1NKZB 2WPSA 3L37A 2FYUK 3HUSB 3M06A 4I1LA 3N7NA 2Q9IC 2NPSB 3KQGA 4ZFGA 5CCHD 1URQA 2N1TA 2IFNA 1PFIA 1SFCD 4ZKUA 1FZFB 2H43C 3L4FA 5AVRB 1NO4A 4WY4C 1RE4B 3KYQA 1NTKK 2JEEA 1NWQA 2P1JA 1FIBA 2CPSA 2HLOC 2H43A 2P7JA 1HGVA 1ZV8A 3LIDA 5APXA 2IFMA 2Z5HA 2OARA 1GW4A 1L0LK 2GUVA 3TK1A 3BVHC 1OWAA 4WB4A 1FIDA 1CI6B 2KLVA 3A2AA 3V4WA 3U1CA 2POHA 2Q5UA 1RE4A 2J61A 2XV5A 2WNPF 3NFQA 3RL0B 1KFMA 3HD7A 3A5TA 2HPCC 1LT9B 1RY3A 1J1EC 3RL0D 1KQLA 5AVXB 2NPSC 3R2PA 3WMM0 3L36A 1N73A 2IX7C 3VN0A 1JMMA 2I1KA 1GZLA 3E1IA 1GU5A 3GHGA 5AVSB 1GTWA 1S9KE 1JY3P 4WY4B 2R5BA 1CI6A 1IFNA 1N2DC 1HBWA 1NOHA 2A45H 2JHHC 1E5WA 1XTCC 2J61B 1RE3A 4JYBA 2GY7A 3HD7B 2WTYA 4WY4D 3CI9A 3VTPC 1X8YA 1GD2E 1AFOA 2J3FA 1J1EB 1KILA 1N73B 2WSFH 2HG5D 3E1IB 2WSCH 1J2JB 2XDJA 3H32A 2P67A 3MTUE 3P32A 2A45G 2P2UA 4NYTA 1WRGA 1LTBC 2WPQA 1CW5A 1JY2P 2C9NY 5AVUB 2Q9IA 4LC1A 1VDFA 2OYHB 3M9QA 1QL1A 1N86B 5AVZB 1LTIC 1HWTC 2J64A 3BVHA 1GDTA 2Z5IA 2JHKF 2QM7A 1FZAB 5APUA 1SQPK 1T3UA 3A3YB 1JOCA 1FZGA 2JHMF 1T2KD 2HPCB 1N7LA 1IC2A 1HJBA 1MV8A 3HRNA 5CCHA 3M9HA 1SFCB 1JNMA 1N86A 1SQXK 1JCDA 1X9VA 2MJZA 2ZFCA 3KPEA 2FFDA 2J0GA 4C7RA 2YKOA 1T3JA 1FJPA 1HUCA 4Y99C 3V2QA 1G1JA 1LGHB 3BVHB 3HUSA 3TNUA 3HE5A 3MD0A 5KTBA 3U1AA 3BRVB 1N7SC 1Z56A 4R9JA 1NTMK 3SWFA 1FZGB 1FZBC 2OYIB 3HTKB 2L5GB 3VMZA 2Z4EC 1RF1C 2KYVA 2J3GA 1KILD 1KZUB 1FJKA 1G2CA 4M3LA 1M1JB 1MFZA 5APWA 1URQD 2N1TD 3TSIA 1SP4A 4Y99B 2H43B 3P8CD 4EIJA 1IJDB 2FFDB 1H89A 4GKGA 2XZRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J0H A;  1Z3U A;  1LWU B;  3E1I A;  3GHG A;  3H32 B;  1LTJ C;  1JY3 P;  2J1G A;  1W2E A;  2OYI A;  1FZA C;  1M1J C;  2A45 H;  2JHH C;  2J3F D;  2J61 B;  1RE3 C;  3H32 C;  1RE3 A;  1FZE B;  2GY7 A;  4M7H A;  1M1J A;  1RE4 C;  2D39 A;  2J3F A;  1LT9 C;  1RF0 A;  2J3O A;  2J0Y A;  2HLO B;  1FZC A;  2J2P A;  1N73 B;  3E1I C;  3E1I B;  4M7F A;  3GHG B;  3H32 A;  2J5Z A;  2XNX B;  2J3U A;  1FZG C;  2A45 G;  1RF1 B;  2A45 I;  2FIB A;  4NYT A;  1FZF C;  1FIC A;  1JY3 O;  1FZF A;  1Z3S A;  1JY2 P;  4JYO X;  3FIB A;  2HPC A;  2Q9I A;  3GHG C;  2OYH C;  1RE3 B;  2OYH B;  1FZE A;  1JY3 N;  1FZC C;  1JY2 N;  1N86 B;  1N73 C;  4JZC A;  4EPU A;  4R9T A;  2XNX C;  2J64 A;  3HUS C;  3BVH A;  3HUS B;  2Q9I C;  2J60 A;  2JHK F;  1FZA B;  4ZFG A;  2XNX A;  2Z4E B;  1T3U A;  1RF1 A;  1FZB A;  1FZF B;  2H43 C;  1LTJ B;  1FZG A;  2JHM F;  1RE4 B;  2HPC B;  2Q9I B;  2OYH A;  1FIB A;  1LWU C;  1FZD A;  1LT9 A;  1RF0 C;  1N86 A;  2HLO C;  2H43 A;  2HOD A;  1JY2 O;  2FFD A;  2J0G A;  2JHL F;  1JC9 A;  3BVH B;  1LWU A;  3HUS A;  3BVH C;  1FZA A;  2Z4E A;  1FID A;  4R9J A;  1FZB B;  1LTJ A;  1FZB C;  2OYI B;  1FZG B;  2Z4E C;  1RF1 C;  2JHI F;  1RE4 A;  1FZE C;  2J3G A;  2J61 A;  2WNP F;  2HPC C;  1M1J B;  1LT9 B;  2H43 B;  2OYI C;  2HOD B;  2FFD C;  2HOD C;  2FFD B;  1RF0 B;  1N86 C;  2HLO A;  1FZC B;  1N73 A; 
#chains in the Genus database with same CATH topology
 1YQ3 C;  5AW6 B;  3CPW O;  4XA4 A;  3Q5R A;  2LR2 A;  2OYI A;  5APT A;  2K1A A;  5KLV J;  1QX8 A;  4JF7 A;  3L35 A;  3AE6 C;  3PRJ A;  2E76 B;  4N3Y B;  3A0B H;  2ZT9 B;  5TJH A;  3ZDM A;  4CPG A;  3RGU A;  4I7Z B;  4H0L B;  4AUW A;  1VQO P;  3CWB G;  2IBZ E;  5KLV E;  2PFX A;  2Q7C A;  3FWN A;  1M7L A;  4IOI H;  1SQV K;  5AW8 B;  3RL0 g;  1K73 Q;  3JCU E;  2R3C A;  1LTJ B;  2FYZ A;  2W6B A;  1EZV G;  3D71 A;  1FBM A;  2K9J A;  3V5B A;  1GU4 A;  2BCC E;  3K5B A;  1Q81 Q;  3P7K A;  3C9I A;  1JM0 A;  1SQP J;  3BCC J;  1S3J A;  3BRT B;  2JHI F;  3V4Q A;  1NAF A;  2G8Y A;  5B66 H;  3S1K A;  2HOD C;  1L0L G;  5APY A;  3WUT A;  1NHL A;  3FXD A;  3PP5 A;  2H7H A;  2IZ0 A;  3USS A;  2Q3I A;  2E75 C;  1NU1 D;  3HE4 B;  2K9Y A;  3H1L E;  2E75 D;  2QJK B;  3L73 J;  1L0N E;  2FY8 A;  3RK2 B;  1SFC C;  1OW8 A;  5AW5 B;  1M1J A;  1UII A;  1SQB E;  1H0T B;  2W90 A;  4W7Y A;  4JYC A;  4N78 D;  2XNX B;  2CPB A;  1E79 H;  1L0L J;  1FAV A;  3TGU G;  1KYO D;  2GUS A;  4D6T E;  5GTH H;  3S4R A;  1A02 F;  1JUN A;  1FZC C;  2H8P D;  1HJ0 A;  3AEF C;  1NTZ J;  1EZV D;  3EWK A;  2JP3 A;  5CBO A;  1R8E A;  1N8R Q;  1PV3 A;  5AW1 B;  2XNX A;  4GT1 A;  1RHZ B;  3TYY A;  2YXQ B;  2WIT A;  4JQ0 D;  4PD4 D;  2XKM A;  1GL2 B;  2V7Q J;  1LWU A;  1BGY J;  2B9B A;  3IFM A;  1X79 B;  1FDM A;  5KJ7 A;  3E1R A;  4RES B;  4IFM A;  1SQQ D;  3RK2 D;  2AEM A;  2KIK A;  1QVG O;  1KIL B;  1L4A D;  1VQ8 P;  1KQG B;  1LJ2 A;  5CCH C;  1Z3U A;  2KSJ A;  4WWI A;  1DH3 A;  1M56 D;  3H32 B;  2BEZ F;  1IFJ A;  3EFG A;  3AE3 C;  2C0W A;  2M8R A;  3L75 J;  2JJL A;  1Y8A A;  1L0N G;  1GMJ A;  1BGY E;  2D2C C;  3H1K E;  4K3A A;  2V4H A;  1FZC A;  1YTZ T;  1KYO I;  5KAI H;  2WQY C;  3I55 P;  4HH2 A;  2N1T B;  2R32 A;  2W6J H;  1YJ9 P;  2FYU G;  4PV1 D;  1XTG B;  2WWW A;  2HPC A;  3L74 D;  1KOR A;  1L2P A;  5CBN A;  1KIL C;  3L72 E;  4JZC A;  1OVR A;  2KS1 B;  1USE A;  3V2R A;  3H1H J;  1NKZ B;  2FYU K;  2Q9I C;  4I1L A;  1VQN P;  2QE7 H;  5CCH D;  1PFI A;  4GOE A;  3L4F A;  2FXO A;  1RE4 B;  1PGJ A;  3I56 P;  1PGQ A;  3CWB E;  3MP7 B;  3MZW B;  2CPS A;  2HLO C;  3F89 A;  3AE4 C;  4QMA A;  2FYU J;  1HGV A;  2MKV A;  1FC2 C;  1GW4 A;  3TK1 A;  4WB4 A;  1CI6 B;  3A2A A;  2Y9Y A;  2ZVN B;  2J61 A;  2XV5 A;  5KLV G;  3Q5P A;  1RY3 A;  2A06 D;  3Q2Y A;  3RL0 D;  1KQL A;  2JWD A;  3VN0 A;  2I1K A;  2KK7 A;  5EFW B;  3H1H D;  3RBX A;  1HBW A;  1NOH A;  4K35 A;  2KNC B;  2A45 H;  2JHH C;  1SQB J;  1E5W A;  3HD7 B;  3CI9 A;  1FDI A;  1S5L X;  1KIL A;  1N73 B;  1VQ6 P;  1PGO A;  3MTU E;  3CX5 I;  4NYT A;  1CW5 A;  1VQ7 P;  3W67 A;  4LC1 A;  1Y9B A;  1VDF A;  1FS0 E;  1X22 A;  3M9Q A;  4NPE A;  2ZXX A;  4UB8 H;  4PJ0 H;  1NGM B;  1LTI C;  1HWT C;  3BVH A;  4NPF X;  2JHK F;  2QM7 A;  1S5L H;  3KHU A;  1W2B O;  2HPC B;  1HJB A;  4HJG H;  1SQQ J;  5CCH A;  1JNM A;  2GA1 A;  2MJZ A;  2QJP B;  2YKO A;  4U3F G;  1R5L A;  3BVH B;  1QVF O;  3TNU A;  5KTB A;  4L74 A;  1VF5 B;  1NTM K;  3SWF A;  1FZG B;  2OYI B;  1S1C X;  1FJK A;  4M3L A;  1EZV E;  1MFZ A;  5APW A;  2N1T D;  3L71 D;  2H43 B;  2K37 A;  4EIJ A;  2BCC J;  1PZQ A;  3CXH I;  3VYI A;  5APS A;  3HE5 B;  1PPJ E;  3MIW A;  4Z1M H;  1NTZ D;  2J3F D;  3H32 C;  2IBZ G;  1ZRT D;  2FYN B;  3NMD A;  4UB6 E;  1T2K C;  3CCV P;  3H25 A;  1DD3 A;  4UB6 H;  1L0L D;  1AVY A;  3EQ2 A;  3HD7 D;  3B5N D;  4GDO A;  1RF1 B;  2O01 H;  1FIC A;  5M1B A;  1FE6 A;  4DZO A;  3P8C E;  4C7N B;  3JC2 2;  1N73 C;  3L73 D;  2W8Z A;  5H2F H;  1KV4 A;  1EDL A;  2IDB A;  2G3A A;  2QIW A;  1FZB A;  2OYO A;  3WUV A;  1ZR2 A;  3CCJ P;  2E43 A;  3GW6 A;  2M0B A;  1GK6 A;  1VQP P;  4BXL A;  2D2C B;  5BVZ A;  1NU1 K;  3IAO A;  1PIX A;  3SWY A;  5B5E H;  1M57 D;  4HB1 A;  5AW7 B;  1KB9 D;  3HE4 A;  3AE7 C;  2JKV A;  2NPS D;  2C9L Y;  2IBZ D;  5E79 E;  4ASV A;  2JWA A;  1YJW P;  1YYC A;  2J1G A;  4N6J A;  2J5U A;  2KOG A;  2LKM A;  5KLV K;  3E7K A;  3SSU A;  1AVO A;  1JCC A;  2M3E A;  1G2C B;  5H2F E;  1VQM P;  5AVW B;  1NKN A;  3WU2 H;  2J0Y A;  2QM8 A;  5C39 A;  3A0B E;  2R5D A;  1Q7Y Q;  2J3U A;  1FZG C;  2B88 A;  1FZF C;  2JR8 A;  4L73 A;  1USD A;  3GHG C;  2I1J A;  1JO5 A;  5AW4 B;  1NTK D;  1IK7 A;  1ZXG A;  3O6Q A;  3RK3 E;  1L4A B;  3AEC C;  4OWF A;  2WZ7 A;  5CMZ A;  3L75 G;  2K3R A;  5AW3 B;  3C1L A;  5AW0 B;  3ABV C;  3LIE A;  2BCC D;  3O8Z A;  4AYC A;  3D70 A;  3L71 J;  1NTZ K;  3G4S P;  3B5N A;  1LT9 A;  1LTT C;  1L0L E;  2WSC J;  1L4A A;  1M90 Q;  1KD1 Q;  3H1K G;  2HR3 A;  1K05 A;  2WSF J;  3AEA C;  1FOS E;  4LLH A;  1MZ9 A;  4WY4 A;  3RK3 B;  1FZB B;  4U3F D;  1FZE C;  1IO4 A;  4U3F J;  1A02 J;  3VP9 A;  1GL2 C;  3B5N B;  1SQX J;  1NTM D;  1NTK E;  1SQV G;  2HOD B;  2E42 A;  1N86 C;  5B66 E;  3CCU P;  4LGD E;  3CME P;  2QRX A;  3L71 G;  2A06 E;  1VPC A;  1AQT A;  2W6A A;  2PGD A;  4H13 D;  5CCG C;  3MUD C;  2QJY C;  1AQ5 A;  1NTZ G;  1U57 A;  1CSB A;  4OGQ B;  3CCQ P;  2L91 A;  1JTH A;  2A45 I;  3OAK A;  3B5N C;  4UB8 E;  1HH0 A;  1EQ7 A;  1KQF B;  3AE5 C;  2XND H;  1JY2 N;  3CCR P;  1G1I A;  3OA7 A;  1SQP E;  3HUS B;  3M06 A;  2NPS B;  4ZFG A;  3L72 D;  2H43 C;  1NO4 A;  2UWJ E;  3TGU E;  4WY4 C;  3A0H H;  4H44 C;  2JEE A;  2P7J A;  1L0N D;  2D2C D;  2IFM A;  2Z5H A;  2OAR A;  1L0L K;  3BVH C;  4IL6 E;  5TIS E;  1OWA A;  3H1H E;  2KSE A;  1FID A;  3V4W A;  3U1C A;  2POH A;  1OW6 A;  3RL0 B;  2Y0E A;  3A5T A;  2HPC C;  1BDC A;  1J1E C;  1S2E A;  1R5S A;  3R2P A;  3PHL A;  1GZL A;  2A06 G;  5GTI H;  3GHG A;  5AVS B;  3TF5 A;  4WY4 B;  3H1J J;  1CI6 A;  1EC5 A;  4YPC A;  2J61 B;  1RE3 A;  2FYN C;  2GY7 A;  4WY4 D;  2J3F A;  3CWB D;  4YXD C;  2BCC G;  3H1I D;  3AE8 C;  1J2J B;  1OMI A;  3H32 A;  1P84 H;  1ZRT E;  2A45 G;  3A0H E;  4DT0 A;  2WSS H;  1LTB C;  2WPQ A;  1JY2 P;  1OW7 A;  2OYH B;  3OW2 O;  1QL1 A;  3IF4 A;  3L75 D;  2Y0C A;  5TIS H;  5KAF H;  2V7Q H;  2J64 A;  2Z5I A;  1BDD A;  1VQ4 P;  3L75 E;  3SWK A;  3L74 E;  1SQP K;  1T3U A;  1SQX E;  1IC2 A;  3HRN A;  1JCD A;  1X9V A;  3PLN A;  2ZFC A;  2WSE J;  3VMA A;  4C7R A;  1T3J A;  2O01 J;  1BGY D;  1PPJ G;  1LT1 A;  1N7S C;  3GF3 A;  1U7M A;  4R9J A;  1FZB C;  1RF1 C;  1ZW0 A;  1G2C A;  3P8C D;  3F5H A;  4L75 A;  1RH5 B;  1H89 A;  4GKG A;  2XZR A;  5BU5 A;  2WSE H;  3RK2 C;  3QH9 A;  1NTM G;  3RK3 D;  4PD4 I;  3GMA A;  3HTK A;  1VQ5 P;  1FZA C;  1H8A A;  3GLM A;  1UIX A;  2IBZ I;  5K5G B;  4O9B A;  2D39 A;  3G6E P;  1QL2 A;  2J2P A;  2BEQ D;  2HYN A;  2N9Y B;  1KB9 I;  3GHG B;  3A7O A;  3CXH E;  3MGN A;  4JYO X;  3Q5S A;  3HD7 C;  3FIB A;  1VQL P;  2B87 A;  1BE3 D;  4D6T G;  1W5C E;  1NTK G;  1OFC X;  1WT6 A;  1LTG C;  1Q2N A;  1IFD A;  3M9B A;  1NU1 J;  1EDI A;  1QLE D;  2OQQ A;  3G3Z A;  2C0X A;  2J60 A;  2Z4E B;  3KDP B;  1ZN5 A;  2KP8 A;  2YNY A;  1YTZ I;  1FZD A;  1S72 P;  3M91 A;  3VMX A;  3H1I E;  4H13 C;  4DJG A;  4GIF A;  3PJS K;  2JHL F;  1BSH A;  2E75 B;  1KC8 Q;  2FXP A;  4EYY Q;  1FOS F;  1BCC G;  1FZA A;  1NU1 E;  1L0N K;  2Z4E A;  1LTJ A;  1GW3 A;  3G9R A;  3FWL A;  1SQB K;  3RL0 C;  3SFE C;  2PRR A;  4EDF A;  1IFI A;  2OTK E;  1H0T A;  1ZLL A;  4IL6 X;  2I8D A;  1KB9 E;  3L73 G;  1HVV A;  2FYU D;  1L0N J;  3RBZ A;  3VP8 A;  1MFT A;  2ITA A;  1M1J C;  3SFD C;  3CXH D;  4OVN F;  4PV1 B;  1J1D C;  1OVV A;  1SLQ A;  3O6Q B;  3L72 J;  4OGQ D;  3JCU H;  2IZ1 A;  4TLF A;  2M5A A;  2O1J A;  3E1I C;  4H44 B;  3CCS P;  1NH4 A;  2WT7 B;  3AE2 C;  1SQQ K;  3VOP A;  3L74 J;  4WBA A;  2OYH C;  5AVY B;  1BGY G;  1PPJ D;  2Y0D A;  5KLV D;  1N7S A;  4EPU A;  2ZYG A;  4DCK A;  2XNX C;  4ZKP A;  3IR9 A;  2XU6 A;  2BAS A;  3PH0 A;  1YIJ P;  3AEG C;  3WU2 E;  4B86 A;  3CCE P;  1T8Z A;  2ZT9 C;  3G71 P;  1YIT P;  1LTS C;  3M0D C;  2ZT9 D;  4A7P A;  1RF0 C;  2KB7 P;  4H0L C;  1KB9 H;  2Q3E A;  3AE9 C;  1JY2 O;  1NTZ E;  2QJY B;  2FXM A;  4DOJ A;  1N7S D;  1M8O B;  2ZVO B;  3TDK A;  1IFP A;  5KJ7 C;  1SQX D;  3B8E B;  1KTM A;  4YXW H;  5B5E E;  4IFF A;  1GK4 A;  2N1T C;  3B71 A;  1J1D B;  4JPZ B;  1DX7 A;  2SPZ A;  2NRG A;  2E74 D;  3V2N A;  2K9J B;  1L4A C;  2FFD C;  2E74 C;  1ZR4 A;  2GM4 A;  4JBZ A;  2IYO A;  4ZMD A;  4C46 A;  1LWU B;  2ZJS E;  3VMY A;  1LP1 A;  1VQ9 P;  4EI2 A;  3RK3 C;  3H1K D;  4N78 E;  5CCG D;  1WMK A;  3CX5 H;  4IFD K;  2W27 A;  3L70 G;  4M7H A;  2J59 M;  2P10 A;  2Q1K A;  5KLI C;  1LT9 C;  3AEE C;  1BCC J;  4W7Z A;  2YKP A;  1Q82 Q;  4M7F A;  1NTK J;  5KAI E;  3PTZ A;  3CL3 D;  2YIU B;  4XE5 B;  1FZE A;  1H88 A;  1Y47 A;  1VF5 D;  3FX0 A;  2R44 A;  3M0D A;  3CCM P;  4R9T A;  2H88 C;  2M5A B;  2WPS A;  3B4S A;  3L73 E;  1NU1 G;  2E5T A;  3KQG A;  1NYH A;  2N1T A;  2IFN A;  4ZKU A;  1FZF B;  5AVR B;  1KQS O;  1X0T A;  3KYQ A;  1NTK K;  4BWN A;  1SQX G;  1AA0 A;  2P1J A;  2H43 A;  2RH0 A;  3FGA D;  3CCL P;  1ZV8 A;  2GUV A;  2KZJ A;  1VL2 A;  2FYU E;  3CC2 P;  2KZI A;  1NVO A;  4PV1 C;  4U7J A;  2B89 A;  2WNP F;  1KFM A;  1KYO H;  3BCC D;  3L72 G;  1SQP D;  5AVX B;  4I7Z C;  1Q86 Q;  3WMM 0;  1N73 A;  2IX7 C;  1K9M Q;  3CMA P;  3E1I A;  1GU5 A;  1GTW A;  2R5B A;  4IL6 H;  3GF7 A;  4ASW A;  2RN0 A;  4JYB A;  3VTP C;  4BRY A;  1X8Y A;  1GD2 E;  3H1J G;  2WSF H;  2HG5 D;  3E1I B;  4ZNC A;  2WSC H;  2XDJ A;  2P67 A;  3P32 A;  2Y9Z A;  1LP1 B;  1WRG A;  2DW3 A;  3W68 A;  2RKL A;  3QWO C;  2P58 A;  5AVU B;  3ITK A;  1FDO A;  1S4X A;  2QJP C;  2AEJ A;  1GDT A;  1NTM E;  2KLU A;  3A3Y B;  4WVZ A;  1AV1 A;  1JOC A;  1T6A A;  2H89 C;  2YMK A;  2JHM F;  1N7L A;  3FXE A;  1EZV I;  3M9H A;  1N86 A;  1SQX K;  3IN6 A;  3KPE A;  4H13 B;  2FFD A;  2OTL P;  1HUC A;  4Y99 C;  1LGH B;  1SQP G;  3HE5 A;  3MD0 A;  1YJN P;  3U1A A;  1Z56 A;  2WPV B;  1IZN B;  3HTK B;  2Z4E C;  1PP9 E;  3VMZ A;  1KIL D;  1KZU B;  1SP4 A;  4Y99 B;  2E74 B;  3Q3D A;  1IJD B;  2FFD B;  1PP9 D;  2KI7 B;  2QEX P;  2FKW B;  2M3B A;  5AW2 B;  1BCC E;  1HGZ A;  2YXR B;  1K04 A;  1ZOY C;  4PD4 H;  3V6I A;  2B87 B;  4PD4 E;  1EDK A;  5CHX A;  3P8M C;  4HKZ H;  2YO2 A;  5BU8 B;  3CC4 P;  3H6P A;  1MUU A;  3WUU A;  3TGU J;  2FIB A;  1Z3S A;  1NAY A;  1P84 E;  4W80 A;  1RE3 B;  1S9K D;  3EFF K;  1BE3 G;  4D6T D;  3HUS C;  1DEB A;  3C8V A;  1YI2 P;  3H1H G;  4H44 D;  2N9B A;  3I5C A;  3NXS A;  2Q9I B;  5AVT B;  1SQB D;  2ZAE B;  2PAJ A;  2OYH A;  1QGK B;  2CK3 H;  2Q6Q A;  1NJI Q;  3N4X A;  5CCG A;  2QVA A;  2JDI H;  3CLQ A;  4OH8 B;  2O3J A;  2YKQ A;  1OX3 A;  4GOD A;  3H1L J;  1SFC A;  1KFN A;  2OYI C;  3H1J E;  2HLO A;  1BE3 E;  5CJ4 A;  2J0H A;  3TNU B;  1LTJ C;  3CX5 E;  2FBW C;  2YMY A;  5GTH E;  2WT7 A;  1MKM A;  1KIL E;  2K88 A;  4HYT B;  5KKZ B;  1FZE B;  1BE3 J;  1ZME C;  1AJY A;  2J58 A;  1EXJ A;  2J3O A;  2HLO B;  5AVV B;  5L8R J;  5KJ7 D;  3TGU D;  2O1K A;  4L76 A;  1IFM A;  1GL2 D;  4XFJ A;  2LXB A;  1SVF A;  1JMB A;  1DEE G;  1SQB G;  4YTP C;  3U59 A;  3BAT A;  1CZQ A;  3L71 E;  3L70 J;  1SQQ G;  4R4L A;  3II6 A;  3KZI E;  1RF1 A;  3T97 B;  2YO3 A;  2AXT E;  3R4Y A;  1YBK A;  5APV A;  2LXC B;  5E79 H;  1LWU C;  4C7N A;  2HFE D;  4AQR D;  2HOD A;  2VRS A;  1N7S B;  1SQV J;  4I2L C;  4GOF A;  3UIA A;  1JC9 A;  1DD4 A;  1FU1 A;  1IK9 A;  4OGQ C;  3MHV A;  1DIP A;  3L74 G;  3T97 A;  2IYP A;  2KNC A;  1URQ C;  2ZXE B;  1PP9 G;  1QEX A;  3BCC G;  2PP6 A;  4R4M A;  4BRY B;  1RF0 B;  2IPP A;  3H1I G;  1OXZ A;  1GL2 A;  1FZC B;  3OJA B;  2R3S A;  2AEF A;  4KHX A;  4U3F E;  2W83 C;  1SQQ E;  5CJ0 A;  1JTH B;  1SQV D;  3AEB C;  1W2E A;  3LW5 H;  5APQ A;  1P84 I;  3M0A A;  3L70 E;  3CC7 P;  1YQ4 C;  1RE3 C;  1KN7 A;  3BAS A;  5KKZ C;  3NTN A;  1RE4 C;  5DJU B;  3JSV C;  1RF0 A;  3L70 D;  3V2P A;  4RJT A;  3MUD A;  3KZI H;  4EOT A;  2NPS A;  2J5Z A;  2QJK C;  2AXT H;  1URQ B;  3H1I J;  1JY3 O;  1FZF A;  3CWB J;  1HTL C;  5AW9 B;  4RKU J;  1VQK P;  4PJ0 E;  1D7M A;  5AVQ B;  1LTA C;  2QSI A;  3CX5 D;  3S9O A;  1JY3 N;  1EXI A;  2OGU A;  1VF5 C;  1YHQ P;  3H1J D;  2WPR A;  4I6M C;  3L37 A;  1S5L E;  1KMI Z;  3N7N A;  1JB0 J;  1URQ A;  1SFC D;  3AE1 C;  1KYO E;  2KUB A;  1NWQ A;  4RO0 A;  1FIB A;  2KS1 A;  3Q1M A;  3KXD A;  3LID A;  5DJT B;  5APX A;  1RQV A;  5KAF E;  2KLV A;  2JO1 A;  2Q5U A;  3H1L D;  1RE4 A;  1PL5 A;  2E76 D;  1Q90 D;  2OTJ P;  3NFQ A;  3HD7 A;  1LT9 B;  5KLI B;  1HF9 A;  2E76 C;  3D6Z A;  3BCC E;  2WMM A;  2QG4 A;  4NPD A;  2NPS C;  3L36 A;  1OVU A;  1JMM A;  1P84 D;  1S9K E;  1JY3 P;  2O01 N;  5GTI E;  1IFN A;  1N2D C;  4MN4 C;  2E5Y A;  4H0L D;  1XTC C;  3AED C;  2WTY A;  1K8A Q;  4TT3 H;  1EDJ A;  1AFO A;  1J1E B;  1TU3 F;  4D6T J;  3D6Y A;  2P2U A;  1BCC D;  2RMZ A;  2C9N Y;  3GG2 A;  2Q9I A;  4Y28 J;  1JEK A;  3H1L G;  2YIU C;  1SS1 A;  1N86 B;  5AVZ B;  1SQV E;  3H1K J;  2ZYA A;  1ZP0 C;  1RQU A;  1FZA B;  4KT0 J;  5APU A;  1FZG A;  2KXP B;  1T2K D;  1MV8 A;  1NTM J;  3CXH H;  1SFC B;  2WVR A;  1BSN A;  1M1K Q;  2NZ2 A;  2ZYD A;  2QA4 P;  1U7J A;  2J0G A;  1FJP A;  3V2Q A;  1G1J A;  4KJM A;  3HUS A;  3LW5 J;  1PP9 J;  1LNQ A;  3BRV B;  3CD6 P;  1OIP A;  2L5G B;  2KYV A;  2J3G A;  1M1J B;  3TSI A;  1URQ D;  1OZH A;  2AXC A;  1PGP A; 
#chains in the Genus database with same CATH homology
 3VYI A;  5BU5 A;  2WSE H;  5AW6 B;  5APS A;  3RK2 C;  3HE5 B;  2FKW B;  2M3B A;  5AW2 B;  3RK3 D;  4XA4 A;  1HGZ A;  2OYI A;  3HTK A;  1FZA C;  3MIW A;  1H8A A;  5APT A;  2J3F D;  4JF7 A;  3H32 C;  3L35 A;  3NMD A;  1T2K C;  5CHX A;  4O9B A;  3P8M C;  2D39 A;  2YO2 A;  5BU8 B;  4N3Y B;  1QL2 A;  2J2P A;  2HYN A;  3H6P A;  3EQ2 A;  3A7O A;  3GHG B;  1MUU A;  3HD7 D;  3B5N D;  1RF1 B;  2O01 H;  2FIB A;  1FIC A;  1Z3S A;  3MGN A;  4JYO X;  3HD7 C;  4W80 A;  4AUW A;  3FIB A;  4DZO A;  3P8C E;  1RE3 B;  1S9K D;  4C7N B;  1N73 C;  1WT6 A;  1LTG C;  1IFD A;  3M9B A;  2Q7C A;  1M7L A;  3HUS C;  1SQV K;  5AW8 B;  1DEB A;  3G3Z A;  2C0X A;  2J60 A;  2Z4E B;  3KDP B;  1ZN5 A;  2N9B A;  2R3C A;  1FZB A;  2KP8 A;  1LTJ B;  2FYZ A;  2W6B A;  3I5C A;  3NXS A;  1ZR2 A;  2Q9I B;  2YNY A;  5AVT B;  2E43 A;  2PAJ A;  2OYH A;  1FBM A;  1YTZ I;  1GK6 A;  1FZD A;  3M91 A;  3N4X A;  3VMX A;  3V5B A;  1GU4 A;  5CCG A;  5BVZ A;  1NU1 K;  4GIF A;  2JHL F;  3P7K A;  3SWY A;  3C9I A;  1FOS F;  1FZA A;  3CLQ A;  1L0N K;  2Z4E A;  5AW7 B;  4OH8 B;  3HE4 A;  1LTJ A;  3BRT B;  1GW3 A;  2YKQ A;  2JHI F;  3V4Q A;  1NAF A;  1SQB K;  3RL0 C;  1SFC A;  2NPS D;  1KFN A;  2OYI C;  2HOD C;  1IFI A;  2C9L Y;  5APY A;  2HLO A;  1NHL A;  1ZLL A;  5CJ4 A;  2J0H A;  3PP5 A;  2H7H A;  3TNU B;  1HVV A;  2Q3I A;  1YYC A;  1LTJ C;  3VP8 A;  2YMY A;  4N6J A;  2J1G A;  2WT7 A;  3HE4 B;  2KOG A;  1M1J C;  2LKM A;  5KLV K;  3RK2 B;  1JCC A;  1SFC C;  5AW5 B;  4HYT B;  1G2C B;  1J1D C;  1FZE B;  1M1J A;  5AVW B;  1SLQ A;  1NKN A;  2J58 A;  2J3O A;  2J0Y A;  2HLO B;  5AVV B;  4W7Y A;  2QM8 A;  5KJ7 D;  4JYC A;  2O1J A;  3E1I C;  4N78 D;  2O1K A;  2R5D A;  2XNX B;  1IFM A;  2CPB A;  2J3U A;  1FZG C;  1NH4 A;  2WT7 B;  1FZF C;  1FAV A;  1SQQ K;  2GUS A;  3VOP A;  1GL2 D;  1SVF A;  4WBA A;  3GHG C;  2OYH C;  5AVY B;  2I1J A;  1A02 F;  1JUN A;  1JO5 A;  1FZC C;  5AW4 B;  2H8P D;  1N7S A;  1L4A B;  4EPU A;  3U59 A;  3BAT A;  2XNX C;  2WZ7 A;  3IR9 A;  4ZKP A;  2XU6 A;  1CZQ A;  2BAS A;  5AW1 B;  5CMZ A;  4B86 A;  5AW3 B;  2XNX A;  3II6 A;  5AW0 B;  1T8Z A;  1RF1 A;  4GT1 A;  2YO3 A;  3LIE A;  3TYY A;  3O8Z A;  1LTS C;  2WIT A;  3M0D C;  4AYC A;  1NTZ K;  5APV A;  1LWU C;  4C7N A;  2HFE D;  4AQR D;  3B5N A;  1LT9 A;  1RF0 C;  2KB7 P;  1LTT C;  2HOD A;  2VRS A;  1N7S B;  1JY2 O;  4I2L C;  2XKM A;  3UIA A;  1L4A A;  1GL2 B;  2FXM A;  4DOJ A;  1N7S D;  1JC9 A;  1LWU A;  1FU1 A;  1IK9 A;  1FOS E;  3IFM A;  1X79 B;  4LLH A;  1MZ9 A;  5KJ7 C;  4WY4 A;  3RK3 B;  1FDM A;  3T97 A;  3B8E B;  1FZB B;  4IFF A;  5KJ7 A;  1GK4 A;  1URQ C;  2N1T C;  1J1D B;  1FZE C;  1IO4 A;  2ZXE B;  1DX7 A;  4RES B;  4IFM A;  3V2N A;  3VP9 A;  1A02 J;  1GL2 C;  2PP6 A;  3B5N B;  1L4A C;  2HOD B;  2FFD C;  2E42 A;  3RK2 D;  1RF0 B;  2IPP A;  1ZR4 A;  1OXZ A;  1GL2 A;  2GM4 A;  1N86 C;  1FZC B;  1KIL B;  1L4A D;  3OJA B;  5CCH C;  1Z3U A;  4LGD E;  4C46 A;  1LWU B;  2KSJ A;  1DH3 A;  4KHX A;  5CJ0 A;  3H32 B;  3VMY A;  1JTH B;  1IFJ A;  3EFG A;  1W2E A;  1VPC A;  2C0W A;  3LW5 H;  5APQ A;  2W6A A;  3M0A A;  3RK3 C;  4N78 E;  2M8R A;  5CCG D;  4IFD K;  2W27 A;  2JJL A;  1RE3 C;  3BAS A;  4M7H A;  3NTN A;  5CCG C;  1RE4 C;  2J59 M;  1AQ5 A;  1LT9 C;  1RF0 A;  3V2P A;  1FZC A;  1CSB A;  3MUD A;  1YTZ T;  4W7Z A;  2YKP A;  4EOT A;  4M7F A;  2NPS A;  4HH2 A;  1JTH A;  2J5Z A;  1URQ B;  2N1T B;  2R32 A;  2A45 I;  1JY3 O;  1FZF A;  1HTL C;  1XTG B;  3OAK A;  5AW9 B;  3CL3 D;  2WWW A;  3B5N C;  2HPC A;  1HH0 A;  5AVQ B;  1LTA C;  1EQ7 A;  4XE5 B;  1FZE A;  1H88 A;  1JY3 N;  3M0D A;  1KIL C;  1JY2 N;  1G1I A;  4JZC A;  4R9T A;  3OA7 A;  3V2R A;  2WPR A;  4I6M C;  1NKZ B;  2WPS A;  3L37 A;  2FYU K;  3HUS B;  3M06 A;  4I1L A;  3N7N A;  2Q9I C;  2NPS B;  3KQG A;  4ZFG A;  5CCH D;  1URQ A;  2N1T A;  2IFN A;  1PFI A;  1SFC D;  4ZKU A;  1FZF B;  2H43 C;  3L4F A;  5AVR B;  1NO4 A;  4WY4 C;  1RE4 B;  3KYQ A;  1NTK K;  2JEE A;  1NWQ A;  2P1J A;  1FIB A;  2CPS A;  2HLO C;  2H43 A;  2P7J A;  1HGV A;  1ZV8 A;  3LID A;  5APX A;  2IFM A;  2Z5H A;  2OAR A;  1GW4 A;  1L0L K;  2GUV A;  3TK1 A;  3BVH C;  1OWA A;  4WB4 A;  1FID A;  1CI6 B;  2KLV A;  3A2A A;  3V4W A;  3U1C A;  2POH A;  2Q5U A;  1RE4 A;  2J61 A;  2XV5 A;  2WNP F;  3NFQ A;  3RL0 B;  1KFM A;  3HD7 A;  3A5T A;  2HPC C;  1LT9 B;  1RY3 A;  1J1E C;  3RL0 D;  1KQL A;  5AVX B;  2NPS C;  3R2P A;  3WMM 0;  3L36 A;  1N73 A;  2IX7 C;  3VN0 A;  1JMM A;  2I1K A;  1GZL A;  3E1I A;  1GU5 A;  3GHG A;  5AVS B;  1GTW A;  1S9K E;  1JY3 P;  4WY4 B;  2R5B A;  1CI6 A;  1IFN A;  1N2D C;  1HBW A;  1NOH A;  2A45 H;  2JHH C;  1E5W A;  1XTC C;  2J61 B;  1RE3 A;  4JYB A;  2GY7 A;  3HD7 B;  2WTY A;  4WY4 D;  3CI9 A;  3VTP C;  1X8Y A;  1GD2 E;  1AFO A;  2J3F A;  1J1E B;  1KIL A;  1N73 B;  2WSF H;  2HG5 D;  3E1I B;  2WSC H;  1J2J B;  2XDJ A;  3H32 A;  2P67 A;  3MTU E;  3P32 A;  2A45 G;  2P2U A;  4NYT A;  1WRG A;  1LTB C;  2WPQ A;  1CW5 A;  1JY2 P;  2C9N Y;  5AVU B;  2Q9I A;  4LC1 A;  1VDF A;  2OYH B;  3M9Q A;  1QL1 A;  1N86 B;  5AVZ B;  1LTI C;  1HWT C;  2J64 A;  3BVH A;  1GDT A;  2Z5I A;  2JHK F;  2QM7 A;  1FZA B;  5APU A;  1SQP K;  1T3U A;  3A3Y B;  1JOC A;  1FZG A;  2JHM F;  1T2K D;  2HPC B;  1N7L A;  1IC2 A;  1HJB A;  1MV8 A;  3HRN A;  5CCH A;  3M9H A;  1SFC B;  1JNM A;  1N86 A;  1SQX K;  1JCD A;  1X9V A;  2MJZ A;  2ZFC A;  3KPE A;  2FFD A;  2J0G A;  4C7R A;  2YKO A;  1T3J A;  1FJP A;  1HUC A;  4Y99 C;  3V2Q A;  1G1J A;  1LGH B;  3BVH B;  3HUS A;  3TNU A;  3HE5 A;  3MD0 A;  5KTB A;  3U1A A;  3BRV B;  1N7S C;  1Z56 A;  4R9J A;  1NTM K;  3SWF A;  1FZG B;  1FZB C;  2OYI B;  3HTK B;  2L5G B;  3VMZ A;  2Z4E C;  1RF1 C;  2KYV A;  2J3G A;  1KIL D;  1KZU B;  1FJK A;  1G2C A;  4M3L A;  1M1J B;  1MFZ A;  5APW A;  1URQ D;  2N1T D;  3TSI A;  1SP4 A;  4Y99 B;  2H43 B;  3P8C D;  4EIJ A;  1IJD B;  2FFD B;  1H89 A;  4GKG A;  2XZR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...