4R9TA

L-ficolin complexed to sulphates
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
217
structure length
217
Chain Sequence
PCLTGPRTCKDLLDRGHFLSGWHTIYLPDCRPLTVLCDMDTDGGGWTVFQRRVDGSVDFYRDWATYKQGFGSRLGEFWLGNDNIHALTAQGTSELRVDLVDFEDNYQFAKYRSFKVADEAEKYNLVLGAFVEGSAGDSLTFHNNQSFSTKDQDNDLNTGNCAVMFQGAWWYKNCHVSNLNGRYLRGTHGSFANGINWKSGKGYNYSYKVSEMKVRPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ficolin-2
publication title Human ficolin-2 recognition versatility extended: An update on the binding of ficolin-2 to sulfated/phosphated carbohydrates.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Sugar binding protein
total genus 72
structure length 217
sequence length 217
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 4r9tA01
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 4r9tA02
1FZEC 2J3FA 1LT9B 2H43B 1N73C 2FFDB 1Z3SA 2JHKF 1FZFC 2HODB 2JHHC 4ZFGA 2J0YA 2HLOC 1RE4C 3GHGC 2XNXC 1RE3B 2J2PA 2JHLF 1FIBA 3H32B 4EPUA 3FIBA 1M1JC 1RF0C 3BVHC 2HPCC 2JHMF 2J0HA 1FZEB 1LTJB 2OYHC 2GY7A 1FZBB 2J3UA 2OYIC 4NYTA 1N86B 1FICA 1FZAC 2J3OA 1LT9C 3E1IC 2J61B 2H43C 1JC9A 1FZFB 2Q9IC 3HUSC 4JZCA 1FZGB 4M7FA 2FFDC 2J3GA 1RE4B 2D39A 2HODC 1RF1B 2Z4EC 4R9JA 1LWUC 1FZDA 2J5ZA 1RE3C 2FIBA 2J0GA 2JHIF 1FZCC 1Z3UA 4JYOX 3BVHB 4M7HA 1FIDA 2J61A 1N73B 2J3FD 2OYIB 1LTJC 1FZBC 4R9TA 2J1GA 1FZAB 2HLOB 1N86C 3E1IB 2XNXB 2WNPF 2Q9IB 3HUSB 2J60A 2Z4EB 1FZGC 1M1JB 1RF0B 1LWUB 1RF1C 3H32C 2J64A 2HPCB 2OYHB 1FZCB
chains in the Genus database with same CATH superfamily
1FZEC 2J3FA 1LT9B 2H43B 1N73C 2FFDB 1Z3SA 2JHKF 1FZFC 2HODB 2JHHC 4ZFGA 2J0YA 2HLOC 1RE4C 3GHGC 2XNXC 1RE3B 2J2PA 2JHLF 1FIBA 3H32B 4EPUA 3FIBA 1M1JC 1RF0C 3BVHC 2HPCC 2JHMF 2J0HA 1FZEB 1LTJB 2OYHC 2GY7A 1FZBB 2J3UA 2OYIC 4NYTA 1N86B 1FICA 1FZAC 2J3OA 1LT9C 3E1IC 2J61B 2H43C 1JC9A 1FZFB 2Q9IC 3HUSC 4JZCA 1FZGB 4M7FA 2FFDC 2J3GA 1RE4B 2D39A 2HODC 1RF1B 2Z4EC 3GHGB 4R9JA 1LWUC 1FZDA 2J5ZA 1RE3C 2FIBA 2J0GA 2JHIF 1FZCC 1Z3UA 4JYOX 3BVHB 4M7HA 1FIDA 2J61A 1N73B 2J3FD 2OYIB 1LTJC 1FZBC 4R9TA 2J1GA 1FZAB 2HLOB 1N86C 3E1IB 2XNXB 2WNPF 2Q9IB 3HUSB 2J60A 2Z4EB 1FZGC 1M1JB 1RF0B 1LWUB 1RF1C 3H32C 2J64A 2HPCB 2OYHB 1FZCB
chains in the Genus database with same CATH topology
1FZEC 2J3FA 1LT9B 2H43B 1N73C 2FFDB 1Z3SA 2JHKF 1FZFC 2HODB 2JHHC 4ZFGA 2J0YA 2HLOC 1RE4C 3GHGC 2XNXC 1RE3B 2J2PA 2JHLF 1FIBA 3H32B 4EPUA 3FIBA 1M1JC 1RF0C 3BVHC 2HPCC 2JHMF 2J0HA 1FZEB 1LTJB 2OYHC 2GY7A 1FZBB 2J3UA 2OYIC 4NYTA 1N86B 1FICA 1FZAC 2J3OA 1LT9C 3E1IC 2J61B 2H43C 1JC9A 1FZFB 2Q9IC 3HUSC 4JZCA 1FZGB 4M7FA 2FFDC 2J3GA 1RE4B 2D39A 2HODC 1RF1B 2Z4EC 4R9JA 1LWUC 1FZDA 2J5ZA 1RE3C 2FIBA 2J0GA 2JHIF 1FZCC 1Z3UA 4JYOX 3BVHB 4M7HA 1FIDA 2J61A 1N73B 2J3FD 2OYIB 1LTJC 1FZBC 4R9TA 2J1GA 1FZAB 2HLOB 1N86C 3E1IB 2XNXB 2WNPF 2Q9IB 3HUSB 2J60A 2Z4EB 1FZGC 1M1JB 1RF0B 1LWUB 1RF1C 3H32C 2J64A 2HPCB 2OYHB 1FZCB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FZE C;  2J3F A;  1LT9 B;  2H43 B;  1N73 C;  2FFD B;  1Z3S A;  2JHK F;  1FZF C;  2HOD B;  2JHH C;  4ZFG A;  2J0Y A;  2HLO C;  1RE4 C;  3GHG C;  2XNX C;  1RE3 B;  2J2P A;  2JHL F;  1FIB A;  3H32 B;  4EPU A;  3FIB A;  1M1J C;  1RF0 C;  3BVH C;  2HPC C;  2JHM F;  2J0H A;  1FZE B;  1LTJ B;  2OYH C;  2GY7 A;  1FZB B;  2J3U A;  2OYI C;  4NYT A;  1N86 B;  1FIC A;  1FZA C;  2J3O A;  1LT9 C;  3E1I C;  2J61 B;  2H43 C;  1JC9 A;  1FZF B;  2Q9I C;  3HUS C;  4JZC A;  1FZG B;  4M7F A;  2FFD C;  2J3G A;  1RE4 B;  2D39 A;  2HOD C;  1RF1 B;  2Z4E C;  4R9J A;  1LWU C;  1FZD A;  2J5Z A;  1RE3 C;  2FIB A;  2J0G A;  2JHI F;  1FZC C;  1Z3U A;  4JYO X;  3BVH B;  4M7H A;  1FID A;  2J61 A;  1N73 B;  2J3F D;  2OYI B;  1LTJ C;  1FZB C;  4R9T A;  2J1G A;  1FZA B;  2HLO B;  1N86 C;  3E1I B;  2XNX B;  2WNP F;  2Q9I B;  3HUS B;  2J60 A;  2Z4E B;  1FZG C;  1M1J B;  1RF0 B;  1LWU B;  1RF1 C;  3H32 C;  2J64 A;  2HPC B;  2OYH B;  1FZC B; 
#chains in the Genus database with same CATH topology
 1FZE C;  2J3F A;  1LT9 B;  2H43 B;  1N73 C;  2FFD B;  1Z3S A;  2JHK F;  1FZF C;  2HOD B;  2JHH C;  4ZFG A;  2J0Y A;  2HLO C;  1RE4 C;  3GHG C;  2XNX C;  1RE3 B;  2J2P A;  2JHL F;  1FIB A;  3H32 B;  4EPU A;  3FIB A;  1M1J C;  1RF0 C;  3BVH C;  2HPC C;  2JHM F;  2J0H A;  1FZE B;  1LTJ B;  2OYH C;  2GY7 A;  1FZB B;  2J3U A;  2OYI C;  4NYT A;  1N86 B;  1FIC A;  1FZA C;  2J3O A;  1LT9 C;  3E1I C;  2J61 B;  2H43 C;  1JC9 A;  1FZF B;  2Q9I C;  3HUS C;  4JZC A;  1FZG B;  4M7F A;  2FFD C;  2J3G A;  1RE4 B;  2D39 A;  2HOD C;  1RF1 B;  2Z4E C;  3GHG B;  4R9J A;  1LWU C;  1FZD A;  2J5Z A;  1RE3 C;  2FIB A;  2J0G A;  2JHI F;  1FZC C;  1Z3U A;  4JYO X;  3BVH B;  4M7H A;  1FID A;  2J61 A;  1N73 B;  2J3F D;  2OYI B;  1LTJ C;  1FZB C;  4R9T A;  2J1G A;  1FZA B;  2HLO B;  1N86 C;  3E1I B;  2XNX B;  2WNP F;  2Q9I B;  3HUS B;  2J60 A;  2Z4E B;  1FZG C;  1M1J B;  1RF0 B;  1LWU B;  1RF1 C;  3H32 C;  2J64 A;  2HPC B;  2OYH B;  1FZC B; 
#chains in the Genus database with same CATH homology
 1FZE C;  2J3F A;  1LT9 B;  2H43 B;  1N73 C;  2FFD B;  1Z3S A;  2JHK F;  1FZF C;  2HOD B;  2JHH C;  4ZFG A;  2J0Y A;  2HLO C;  1RE4 C;  3GHG C;  2XNX C;  1RE3 B;  2J2P A;  2JHL F;  1FIB A;  3H32 B;  4EPU A;  3FIB A;  1M1J C;  1RF0 C;  3BVH C;  2HPC C;  2JHM F;  2J0H A;  1FZE B;  1LTJ B;  2OYH C;  2GY7 A;  1FZB B;  2J3U A;  2OYI C;  4NYT A;  1N86 B;  1FIC A;  1FZA C;  2J3O A;  1LT9 C;  3E1I C;  2J61 B;  2H43 C;  1JC9 A;  1FZF B;  2Q9I C;  3HUS C;  4JZC A;  1FZG B;  4M7F A;  2FFD C;  2J3G A;  1RE4 B;  2D39 A;  2HOD C;  1RF1 B;  2Z4E C;  4R9J A;  1LWU C;  1FZD A;  2J5Z A;  1RE3 C;  2FIB A;  2J0G A;  2JHI F;  1FZC C;  1Z3U A;  4JYO X;  3BVH B;  4M7H A;  1FID A;  2J61 A;  1N73 B;  2J3F D;  2OYI B;  1LTJ C;  1FZB C;  4R9T A;  2J1G A;  1FZA B;  2HLO B;  1N86 C;  3E1I B;  2XNX B;  2WNP F;  2Q9I B;  3HUS B;  2J60 A;  2Z4E B;  1FZG C;  1M1J B;  1RF0 B;  1LWU B;  1RF1 C;  3H32 C;  2J64 A;  2HPC B;  2OYH B;  1FZC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...