2H43C

Crystal structure of human fragment d complexed with ala-his-arg-pro-amide
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
290
structure length
290
Chain Sequence
HDSSIRYLQEIYNSNNQKIVNLKEKVAQLEAQCQEPCKDTVQIHDITGKDCQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQSAIPYALRVELEDWNGRTSTADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEGNCAEQDGSGWWMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIPFNRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibrinogen alpha chain
publication title Differences in Binding Specificity for the Homologous gamma- and beta-Chain "Holes" on Fibrinogen: Exclusive Binding of Ala-His-Arg-Pro-amide by the beta-Chain Hole.
pubmed doi rcsb
molecule tags Blood clotting
total genus 75
structure length 290
sequence length 290
chains with identical sequence F
ec nomenclature
pdb deposition date 2006-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 2h43C01
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 2h43C02
1N86C 4NYTA 2J1GA 1Z3UA 1FZFC 2J3UA 1FZGC 4JYOX 1FZCB 1RE4B 2JHKF 2JHMF 1FZBC 2J3FD 1FZGB 2J5ZA 1RF1C 3H32B 2Q9IC 4EPUA 4R9JA 1FZAC 1FIBA 2HLOC 2J60A 1RF1B 2JHHC 4M7HA 1Z3SA 2Q9IB 2OYIC 2Z4EB 2J3FA 1FZDA 2OYHB 4M7FA 2GY7A 1N86B 2D39A 2J3OA 1LTJC 1LT9C 2FIBA 1FZFB 1LWUC 2J2PA 1JC9A 1FZBB 2H43C 4JZCA 2J61B 4ZFGA 1FZEC 3E1IC 1FIDA 2HODC 1RE3C 1M1JC 2J3GA 2XNXC 3BVHC 1FZAB 1FZEB 2JHIF 2HLOB 2J0HA 3E1IB 1RF0C 2J0YA 2J64A 3GHGC 1M1JB 2OYIB 1FZCC 1RE4C 2WNPF 1RF0B 1LTJB 1LT9B 2JHLF 1N73C 1LWUB 2J61A 2H43B 3H32C 2J0GA 3HUSC 2FFDC 1FICA 2HPCC 2Z4EC 1N73B 2HODB 1RE3B 3FIBA 4R9TA 3HUSB 2XNXB 2FFDB 3BVHB 2OYHC 2HPCB
chains in the Genus database with same CATH superfamily
1N86C 4NYTA 2J1GA 3GHGB 1Z3UA 1FZFC 2J3UA 1FZGC 4JYOX 1FZCB 1RE4B 2JHKF 2JHMF 1FZBC 2J3FD 1FZGB 2J5ZA 1RF1C 3H32B 2Q9IC 4EPUA 4R9JA 1FZAC 1FIBA 2HLOC 2J60A 1RF1B 2JHHC 4M7HA 1Z3SA 2Q9IB 2OYIC 2Z4EB 2J3FA 1FZDA 2OYHB 4M7FA 2GY7A 1N86B 2D39A 2J3OA 1LTJC 1LT9C 2FIBA 1FZFB 1LWUC 2J2PA 1JC9A 1FZBB 2H43C 4JZCA 2J61B 4ZFGA 1FZEC 3E1IC 1FIDA 2HODC 1RE3C 1M1JC 2J3GA 2XNXC 3BVHC 1FZAB 1FZEB 2JHIF 2HLOB 2J0HA 3E1IB 1RF0C 2J0YA 2J64A 3GHGC 1M1JB 2OYIB 1FZCC 1RE4C 2WNPF 1RF0B 1LTJB 1LT9B 2JHLF 1N73C 1LWUB 2J61A 2H43B 3H32C 2J0GA 3HUSC 2FFDC 1FICA 2HPCC 2Z4EC 1N73B 2HODB 1RE3B 3FIBA 4R9TA 3HUSB 2XNXB 2FFDB 3BVHB 2OYHC 2HPCB
chains in the Genus database with same CATH topology
1N86C 4NYTA 2J1GA 1Z3UA 1FZFC 2J3UA 1FZGC 4JYOX 1FZCB 1RE4B 2JHKF 2JHMF 1FZBC 2J3FD 1FZGB 2J5ZA 1RF1C 3H32B 2Q9IC 4EPUA 4R9JA 1FZAC 1FIBA 2HLOC 2J60A 1RF1B 2JHHC 4M7HA 1Z3SA 2Q9IB 2OYIC 2Z4EB 2J3FA 1FZDA 2OYHB 4M7FA 2GY7A 1N86B 2D39A 2J3OA 1LTJC 1LT9C 2FIBA 1FZFB 1LWUC 2J2PA 1JC9A 1FZBB 2H43C 4JZCA 2J61B 4ZFGA 1FZEC 3E1IC 1FIDA 2HODC 1RE3C 1M1JC 2J3GA 2XNXC 3BVHC 1FZAB 1FZEB 2JHIF 2HLOB 2J0HA 3E1IB 1RF0C 2J0YA 2J64A 3GHGC 1M1JB 2OYIB 1FZCC 1RE4C 2WNPF 1RF0B 1LTJB 1LT9B 2JHLF 1N73C 1LWUB 2J61A 2H43B 3H32C 2J0GA 3HUSC 2FFDC 1FICA 2HPCC 2Z4EC 1N73B 2HODB 1RE3B 3FIBA 4R9TA 3HUSB 2XNXB 2FFDB 3BVHB 2OYHC 2HPCB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N86 C;  4NYT A;  2J1G A;  1Z3U A;  1FZF C;  2J3U A;  1FZG C;  4JYO X;  1FZC B;  1RE4 B;  2JHK F;  2JHM F;  1FZB C;  2J3F D;  1FZG B;  2J5Z A;  1RF1 C;  3H32 B;  2Q9I C;  4EPU A;  4R9J A;  1FZA C;  1FIB A;  2HLO C;  2J60 A;  1RF1 B;  2JHH C;  4M7H A;  1Z3S A;  2Q9I B;  2OYI C;  2Z4E B;  2J3F A;  1FZD A;  2OYH B;  4M7F A;  2GY7 A;  1N86 B;  2D39 A;  2J3O A;  1LTJ C;  1LT9 C;  2FIB A;  1FZF B;  1LWU C;  2J2P A;  1JC9 A;  1FZB B;  2H43 C;  4JZC A;  2J61 B;  4ZFG A;  1FZE C;  3E1I C;  1FID A;  2HOD C;  1RE3 C;  1M1J C;  2J3G A;  2XNX C;  3BVH C;  1FZA B;  1FZE B;  2JHI F;  2HLO B;  2J0H A;  3E1I B;  1RF0 C;  2J0Y A;  2J64 A;  3GHG C;  1M1J B;  2OYI B;  1FZC C;  1RE4 C;  2WNP F;  1RF0 B;  1LTJ B;  1LT9 B;  2JHL F;  1N73 C;  1LWU B;  2J61 A;  2H43 B;  3H32 C;  2J0G A;  3HUS C;  2FFD C;  1FIC A;  2HPC C;  2Z4E C;  1N73 B;  2HOD B;  1RE3 B;  3FIB A;  4R9T A;  3HUS B;  2XNX B;  2FFD B;  3BVH B;  2OYH C;  2HPC B; 
#chains in the Genus database with same CATH topology
 1N86 C;  4NYT A;  2J1G A;  3GHG B;  1Z3U A;  1FZF C;  2J3U A;  1FZG C;  4JYO X;  1FZC B;  1RE4 B;  2JHK F;  2JHM F;  1FZB C;  2J3F D;  1FZG B;  2J5Z A;  1RF1 C;  3H32 B;  2Q9I C;  4EPU A;  4R9J A;  1FZA C;  1FIB A;  2HLO C;  2J60 A;  1RF1 B;  2JHH C;  4M7H A;  1Z3S A;  2Q9I B;  2OYI C;  2Z4E B;  2J3F A;  1FZD A;  2OYH B;  4M7F A;  2GY7 A;  1N86 B;  2D39 A;  2J3O A;  1LTJ C;  1LT9 C;  2FIB A;  1FZF B;  1LWU C;  2J2P A;  1JC9 A;  1FZB B;  2H43 C;  4JZC A;  2J61 B;  4ZFG A;  1FZE C;  3E1I C;  1FID A;  2HOD C;  1RE3 C;  1M1J C;  2J3G A;  2XNX C;  3BVH C;  1FZA B;  1FZE B;  2JHI F;  2HLO B;  2J0H A;  3E1I B;  1RF0 C;  2J0Y A;  2J64 A;  3GHG C;  1M1J B;  2OYI B;  1FZC C;  1RE4 C;  2WNP F;  1RF0 B;  1LTJ B;  1LT9 B;  2JHL F;  1N73 C;  1LWU B;  2J61 A;  2H43 B;  3H32 C;  2J0G A;  3HUS C;  2FFD C;  1FIC A;  2HPC C;  2Z4E C;  1N73 B;  2HOD B;  1RE3 B;  3FIB A;  4R9T A;  3HUS B;  2XNX B;  2FFD B;  3BVH B;  2OYH C;  2HPC B; 
#chains in the Genus database with same CATH homology
 1N86 C;  4NYT A;  2J1G A;  1Z3U A;  1FZF C;  2J3U A;  1FZG C;  4JYO X;  1FZC B;  1RE4 B;  2JHK F;  2JHM F;  1FZB C;  2J3F D;  1FZG B;  2J5Z A;  1RF1 C;  3H32 B;  2Q9I C;  4EPU A;  4R9J A;  1FZA C;  1FIB A;  2HLO C;  2J60 A;  1RF1 B;  2JHH C;  4M7H A;  1Z3S A;  2Q9I B;  2OYI C;  2Z4E B;  2J3F A;  1FZD A;  2OYH B;  4M7F A;  2GY7 A;  1N86 B;  2D39 A;  2J3O A;  1LTJ C;  1LT9 C;  2FIB A;  1FZF B;  1LWU C;  2J2P A;  1JC9 A;  1FZB B;  2H43 C;  4JZC A;  2J61 B;  4ZFG A;  1FZE C;  3E1I C;  1FID A;  2HOD C;  1RE3 C;  1M1J C;  2J3G A;  2XNX C;  3BVH C;  1FZA B;  1FZE B;  2JHI F;  2HLO B;  2J0H A;  3E1I B;  1RF0 C;  2J0Y A;  2J64 A;  3GHG C;  1M1J B;  2OYI B;  1FZC C;  1RE4 C;  2WNP F;  1RF0 B;  1LTJ B;  1LT9 B;  2JHL F;  1N73 C;  1LWU B;  2J61 A;  2H43 B;  3H32 C;  2J0G A;  3HUS C;  2FFD C;  1FIC A;  2HPC C;  2Z4E C;  1N73 B;  2HOD B;  1RE3 B;  3FIB A;  4R9T A;  3HUS B;  2XNX B;  2FFD B;  3BVH B;  2OYH C;  2HPC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...