2J5ZA

H-ficolin complexed to galactose
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
214
structure length
214
Chain Sequence
CQEGPRNCRELLSQGATLSGWYHLCLPEGRALPVFCDMDTEGGGWLVFQRRQDGSVDFFRSWSSYRAGFGNQESEFWLGNENLHQLTLQGNWELRVELEDFNGNRTFAHYATFRLLGEVDHYQLALGKFSEGTAGDSLSLHSGRPFTTYDADHDSSNSNCAVIVHGAWWYASCYRSNLNGRYAVSEAAAHKYGIDWASGRGVGHPYRRVRMMLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lectin
molecule keywords FICOLIN-3
publication title Structural Insights Into the Innate Immune Recognition Specificities of L- and H-Ficolins.
pubmed doi rcsb
source organism Homo sapiens
total genus 70
structure length 214
sequence length 214
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2006-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 2j5zA01
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 2j5zA02
2OYHB 2H43B 2HODB 1LTJB 1N86B 3HUSB 2J3FD 1RE3B 2HLOB 1FZCB 3FIBA 1LWUB 2JHLF 2J3GA 4M7FA 4ZFGA 2WNPF 2FFDC 2JHMF 2J61B 1LT9B 3H32C 1FZBC 1FIDA 3GHGC 2JHKF 2JHHC 3BVHB 1FZFC 2Q9IC 4JZCA 1FZAB 2J61A 2HPCC 2J3UA 1FZGC 2Z4EB 4NYTA 2J5ZA 1RF0C 1RF1C 1N73C 2J0HA 2OYHC 1RE4B 1M1JC 4EPUA 2H43C 2HODC 1LTJC 1N86C 2J3FA 2J2PA 1FIBA 3E1IB 1RE3C 2HLOC 1FZCC 2J60A 2GY7A 1FICA 2FFDB 2XNXB 1LWUC 2J64A 2J3OA 4M7HA 2J1GA 2D39A 4R9TA 1FZEC 1FZFB 2OYIC 2HPCB 4JYOX 1JC9A 3BVHC 2JHIF 1FZAC 3HUSC 1M1JB 2Z4EC 3H32B 1FZBB 2FIBA 2J0GA 4R9JA 1Z3SA 1Z3UA 1RE4C 1LT9C 1FZDA 2Q9IB 3E1IC 2J0YA 2XNXC 1FZEB 1FZGB 1RF0B 2OYIB 1RF1B 1N73B
chains in the Genus database with same CATH superfamily
2OYHB 2H43B 2HODB 1LTJB 1N86B 3HUSB 2J3FD 1RE3B 2HLOB 1FZCB 3FIBA 1LWUB 2JHLF 2J3GA 4M7FA 4ZFGA 2WNPF 2FFDC 2JHMF 2J61B 1LT9B 3H32C 1FZBC 1FIDA 3GHGC 2JHKF 2JHHC 3BVHB 1FZFC 2Q9IC 4JZCA 1FZAB 2J61A 2HPCC 2J3UA 1FZGC 2Z4EB 4NYTA 2J5ZA 1RF0C 1RF1C 1N73C 2J0HA 2OYHC 1RE4B 1M1JC 4EPUA 2H43C 2HODC 1LTJC 1N86C 2J3FA 2J2PA 1FIBA 3E1IB 1RE3C 2HLOC 1FZCC 2J60A 2GY7A 1FICA 2FFDB 2XNXB 1LWUC 2J64A 2J3OA 4M7HA 2J1GA 3GHGB 2D39A 4R9TA 1FZEC 1FZFB 2OYIC 2HPCB 4JYOX 1JC9A 3BVHC 2JHIF 1FZAC 3HUSC 1M1JB 2Z4EC 3H32B 1FZBB 2FIBA 2J0GA 4R9JA 1Z3SA 1Z3UA 1RE4C 1LT9C 1FZDA 2Q9IB 3E1IC 2J0YA 2XNXC 1FZEB 1FZGB 1RF0B 2OYIB 1RF1B 1N73B
chains in the Genus database with same CATH topology
2OYHB 2H43B 2HODB 1LTJB 1N86B 3HUSB 2J3FD 1RE3B 2HLOB 1FZCB 3FIBA 1LWUB 2JHLF 2J3GA 4M7FA 4ZFGA 2WNPF 2FFDC 2JHMF 2J61B 1LT9B 3H32C 1FZBC 1FIDA 3GHGC 2JHKF 2JHHC 3BVHB 1FZFC 2Q9IC 4JZCA 1FZAB 2J61A 2HPCC 2J3UA 1FZGC 2Z4EB 4NYTA 2J5ZA 1RF0C 1RF1C 1N73C 2J0HA 2OYHC 1RE4B 1M1JC 4EPUA 2H43C 2HODC 1LTJC 1N86C 2J3FA 2J2PA 1FIBA 3E1IB 1RE3C 2HLOC 1FZCC 2J60A 2GY7A 1FICA 2FFDB 2XNXB 1LWUC 2J64A 2J3OA 4M7HA 2J1GA 2D39A 4R9TA 1FZEC 1FZFB 2OYIC 2HPCB 4JYOX 1JC9A 3BVHC 2JHIF 1FZAC 3HUSC 1M1JB 2Z4EC 3H32B 1FZBB 2FIBA 2J0GA 4R9JA 1Z3SA 1Z3UA 1RE4C 1LT9C 1FZDA 2Q9IB 3E1IC 2J0YA 2XNXC 1FZEB 1FZGB 1RF0B 2OYIB 1RF1B 1N73B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OYH B;  2H43 B;  2HOD B;  1LTJ B;  1N86 B;  3HUS B;  2J3F D;  1RE3 B;  2HLO B;  1FZC B;  3FIB A;  1LWU B;  2JHL F;  2J3G A;  4M7F A;  4ZFG A;  2WNP F;  2FFD C;  2JHM F;  2J61 B;  1LT9 B;  3H32 C;  1FZB C;  1FID A;  3GHG C;  2JHK F;  2JHH C;  3BVH B;  1FZF C;  2Q9I C;  4JZC A;  1FZA B;  2J61 A;  2HPC C;  2J3U A;  1FZG C;  2Z4E B;  4NYT A;  2J5Z A;  1RF0 C;  1RF1 C;  1N73 C;  2J0H A;  2OYH C;  1RE4 B;  1M1J C;  4EPU A;  2H43 C;  2HOD C;  1LTJ C;  1N86 C;  2J3F A;  2J2P A;  1FIB A;  3E1I B;  1RE3 C;  2HLO C;  1FZC C;  2J60 A;  2GY7 A;  1FIC A;  2FFD B;  2XNX B;  1LWU C;  2J64 A;  2J3O A;  4M7H A;  2J1G A;  2D39 A;  4R9T A;  1FZE C;  1FZF B;  2OYI C;  2HPC B;  4JYO X;  1JC9 A;  3BVH C;  2JHI F;  1FZA C;  3HUS C;  1M1J B;  2Z4E C;  3H32 B;  1FZB B;  2FIB A;  2J0G A;  4R9J A;  1Z3S A;  1Z3U A;  1RE4 C;  1LT9 C;  1FZD A;  2Q9I B;  3E1I C;  2J0Y A;  2XNX C;  1FZE B;  1FZG B;  1RF0 B;  2OYI B;  1RF1 B;  1N73 B; 
#chains in the Genus database with same CATH topology
 2OYH B;  2H43 B;  2HOD B;  1LTJ B;  1N86 B;  3HUS B;  2J3F D;  1RE3 B;  2HLO B;  1FZC B;  3FIB A;  1LWU B;  2JHL F;  2J3G A;  4M7F A;  4ZFG A;  2WNP F;  2FFD C;  2JHM F;  2J61 B;  1LT9 B;  3H32 C;  1FZB C;  1FID A;  3GHG C;  2JHK F;  2JHH C;  3BVH B;  1FZF C;  2Q9I C;  4JZC A;  1FZA B;  2J61 A;  2HPC C;  2J3U A;  1FZG C;  2Z4E B;  4NYT A;  2J5Z A;  1RF0 C;  1RF1 C;  1N73 C;  2J0H A;  2OYH C;  1RE4 B;  1M1J C;  4EPU A;  2H43 C;  2HOD C;  1LTJ C;  1N86 C;  2J3F A;  2J2P A;  1FIB A;  3E1I B;  1RE3 C;  2HLO C;  1FZC C;  2J60 A;  2GY7 A;  1FIC A;  2FFD B;  2XNX B;  1LWU C;  2J64 A;  2J3O A;  4M7H A;  2J1G A;  3GHG B;  2D39 A;  4R9T A;  1FZE C;  1FZF B;  2OYI C;  2HPC B;  4JYO X;  1JC9 A;  3BVH C;  2JHI F;  1FZA C;  3HUS C;  1M1J B;  2Z4E C;  3H32 B;  1FZB B;  2FIB A;  2J0G A;  4R9J A;  1Z3S A;  1Z3U A;  1RE4 C;  1LT9 C;  1FZD A;  2Q9I B;  3E1I C;  2J0Y A;  2XNX C;  1FZE B;  1FZG B;  1RF0 B;  2OYI B;  1RF1 B;  1N73 B; 
#chains in the Genus database with same CATH homology
 2OYH B;  2H43 B;  2HOD B;  1LTJ B;  1N86 B;  3HUS B;  2J3F D;  1RE3 B;  2HLO B;  1FZC B;  3FIB A;  1LWU B;  2JHL F;  2J3G A;  4M7F A;  4ZFG A;  2WNP F;  2FFD C;  2JHM F;  2J61 B;  1LT9 B;  3H32 C;  1FZB C;  1FID A;  3GHG C;  2JHK F;  2JHH C;  3BVH B;  1FZF C;  2Q9I C;  4JZC A;  1FZA B;  2J61 A;  2HPC C;  2J3U A;  1FZG C;  2Z4E B;  4NYT A;  2J5Z A;  1RF0 C;  1RF1 C;  1N73 C;  2J0H A;  2OYH C;  1RE4 B;  1M1J C;  4EPU A;  2H43 C;  2HOD C;  1LTJ C;  1N86 C;  2J3F A;  2J2P A;  1FIB A;  3E1I B;  1RE3 C;  2HLO C;  1FZC C;  2J60 A;  2GY7 A;  1FIC A;  2FFD B;  2XNX B;  1LWU C;  2J64 A;  2J3O A;  4M7H A;  2J1G A;  2D39 A;  4R9T A;  1FZE C;  1FZF B;  2OYI C;  2HPC B;  4JYO X;  1JC9 A;  3BVH C;  2JHI F;  1FZA C;  3HUS C;  1M1J B;  2Z4E C;  3H32 B;  1FZB B;  2FIB A;  2J0G A;  4R9J A;  1Z3S A;  1Z3U A;  1RE4 C;  1LT9 C;  1FZD A;  2Q9I B;  3E1I C;  2J0Y A;  2XNX C;  1FZE B;  1FZG B;  1RF0 B;  2OYI B;  1RF1 B;  1N73 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...