1LTJB

Crystal structure of recombinant human fibrinogen fragment d with the peptide ligands gly-pro-arg-pro-amide and gly-his-arg-pro-amide
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
298
structure length
298
Chain Sequence
IPTNLRVLRSILENLRSKIQKLESDVSAQMEYCRTPCTVSCNIPVVSGKECEEIIRKGGETSEMYLIQPDSSVKPYRVYCDMNTENGGWTVIQNRQDGSVDFGRKWDPYKQGFGNVATNTDGKNYCGLPGEYWLGNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGGFTVQNEANKYQISVNKYRGTAGNALMDGASQLMGENRTMTIHNGMFFSTYDRDNDGWLTSDPRKQCSKEDGGGWWYNRCHAANPNGRYYWGGQYTWDMAKHGTDDGVVWMNWKGSWYSMRKMSMKIRPFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 2.8 A Crystal Structures of Recombinant Fibrinogen Fragment D with and without Two Peptide Ligands: GHRP Binding to the "b" Site Disrupts Its Nearby Calcium-binding Site.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
molecule keywords Fibrinogen alpha/alpha-E chain
total genus 91
structure length 298
sequence length 298
chains with identical sequence E
ec nomenclature
pdb deposition date 2002-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1ltjB03
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 1ltjB01
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 1ltjB02
2J5ZA 2D39A 2JHHC 1RF1B 1RE3A 3HUSB 2FFDA 4R9TA 1RF1C 1RE4A 2JHIF 1FZGC 2HPCB 1LT9B 1FZBB 1FZAB 1FZFC 3GHGA 1FIBA 1FZCA 3E1IA 1FZGB 2H43C 1N86B 3E1IC 2J3FA 2HODB 1JY2N 3GHGC 1N86A 1FZGA 2J64A 1RE4C 2Q9IB 2J1GA 1LT9A 2JHKF 1N73B 2J3GA 2FFDB 3FIBA 2OYHA 1Z3SA 2GY7A 2JHLF 2Q9IA 4M7FA 1FIDA 3HUSC 2Z4EA 1JY2P 2OYIA 2HPCC 1LWUC 1FZBC 1LTJA 1FZAC 1FZFB 1FZCB 2HLOC 3GHGB 2HODC 4NYTA 3BVHA 1JY3P 2J3OA 2J2PA 1FZEB 1JY3N 1M1JA 1FZDA 2J61A 2XNXC 3H32C 1M1JB 2XNXA 3H32A 2J3UA 1RF0A 1FZEA 1JY2O 1N73A 2J3FD 4EPUA 2H43B 1W2EA 2A45I 1LWUB 2JHMF 4JYOX 2OYIB 3BVHC 2HODA 2Z4EB 1T3UA 2J0HA 1LWUA 2J0GA 1N73C 2A45G 1FZEC 1JC9A 1RF0C 2OYHB 2Q9IC 2OYHC 1RF0B 4R9JA 2A45H 3H32B 2XNXB 1M1JC 4ZFGA 1FICA 2J61B 1LT9C 2J0YA 1JY3O 1Z3UA 4M7HA 4JZCA 1N86C 3E1IB 2HLOA 1FZAA 1LTJC 1FZBA 2WNPF 2HPCA 2H43A 2OYIC 3BVHB 1RE4B 1FZCC 2HLOB 2Z4EC 1FZFA 3HUSA 1LTJB 1RE3B 2FIBA 2J60A 1RF1A 2FFDC 1RE3C
chains in the Genus database with same CATH superfamily
1NTZJ 3H1JG 4WVZA 1RF1B 5KLIB 5KLVE 2GA1A 2QIWA 3AE2C 1IFMA 3FGAD 1NVOA 1SQQD 4H0LD 1G2CB 1SS1A 4RESB 2ZYGA 1LT9A 2JWAA 2FYUE 2NRGA 4NPDA 1HBWA 1NTMD 2YIUB 1NTZK 2JHLF 1SQBJ 2PRRA 4UB8H 3TSIA 2KIKA 1MFZA 4HYTB 1K9MQ 2ZT9D 3L74D 1M1KQ 4LGDE 2IZ0A 2WSEH 3L75G 2HFED 1KFNA 5CBNA 5B66H 1OFCX 5B5EE 1FE6A 3CWBD 2P7JA 1N73A 3AE1C 2H43B 3A0BE 3SFDC 1NTME 4GKGA 1PGOA 3AEDC 2E74D 3C1LA 3JSVC 3O6QA 2IFMA 4PD4E 3TK1A 3CWBJ 3SFEC 5AVQB 4H0LC 1JO5A 1K73Q 5KKZC 5AVSB 1NHLA 1KB9I 4A7PA 1HF9A 2E5YA 2YXRB 1T2KD 4M7HA 3D71A 1KZUB 3L70J 4LLHA 1J1EB 1FZAA 2H43A 3BVHB 1S1CX 2HLOB 3TDKA 2KK7A 2VRSA 3KQGA 2D39A 5KKZB 1URQB 3CCSP 2JHIF 2HPCB 4Y28J 1J1DB 1FZFC 2P1JA 2H43C 2JO1A 2J3FA 2QRXA 1RHZB 4B86A 2J64A 1RE4C 3H1HD 3PRJA 4D6TG 3CC7P 3V6IA 1N7SC 3H1HG 5TISE 1Y9BA 1ZOYC 1EDLA 3SWYA 1NTMJ 3HE5B 3CMEP 2JEEA 2V7QH 3MP7B 3MZWB 1CZQA 3B5NC 3BVHA 2RKLA 3PP5A 2AXTE 4JQ0D 1Q2NA 2POHA 1QL2A 3CCUP 2IDBA 3BCCE 1BE3G 2Q1KA 2YIUC 1X8YA 3MD0A 2YO2A 1GU4A 2K3RA 3T97A 2A45G 1JC9A 1DD3A 2B89A 4PV1D 2M5AA 1JOCA 2IBZG 3HD7A 3LW5J 4M3LA 3B5ND 1GW3A 1JTHB 1FU1A 2FYUG 1LT9C 1URQD 2H89C 2WPRA 3GLMA 1FOSE 1KB9E 1LTJB 1IFJA 3GW6A 1GK6A 2OQQA 4WY4B 5CBOA 1L0NG 3ABVC 3L74G 1YJNP 3U1CA 2KYVA 2W8ZA 4WBAA 1CW5A 2G3AA 2KZIA 5KLVK 1Q86Q 1AVOA 1LTSC 2R32A 2J1GA 1AJYA 2FY8A 4NPEA 2Y0DA 5KLIC 2C0WA 4O9BA 3VN0A 2Q5UA 1KQFB 1L0ND 1DIPA 1GK4A 2HYNA 1FZFB 1VF5D 4ZNCA 4OGQB 2OTKE 1NU1J 3H1JD 4H13B 2P58A 3VMYA 1EZVG 1NTMK 3RK3D 1NOHA 1OIPA 2P67A 1LP1B 2B87A 1MUUA 3SWKA 1L4AC 1PL5A 3AEAC 3M0AA 3KZIH 2C9NY 1UIXA 1N73C 3CPWO 4JYCA 3VMZA 1WT6A 3L75J 1HJ0A 1URQA 4D6TE 1AQ5A 2CPBA 3CC4P 2RN0A 5AW6B 4JZCA 3P32A 1PPJE 4OVNF 1VQNP 3L74E 1H0TB 3HD7D 2BEZF 5CHXA 3VTPC 3AE6C 3M9HA 2QM8A 4R4MA 3M0DC 4YTPC 2QJPC 1WMKA 1QLED 3CL3D 4HKZH 5TISH 1KMIZ 2KSEA 3CCVP 1YTZI 2JJLA 1FZBB 3CLQA 1NAYA 1AQTA 3K5BA 1D7MA 4L75A 2Q7CA 1N73B 1BGYJ 1LTIC 1VQ7P 4UB6H 1OWAA 1H89A 2MKVA 2OYIA 3MHVA 4IFDK 1PGPA 2BCCE 1FZCB 5E79H 4W7YA 1JY3P 1HUCA 2J2PA 2IFNA 1FDMA 1KILA 3H1KG 4WY4A 1VL2A 2N1TC 5AW1B 3V2NA 5GTIE 2QJYB 2XNXA 3GF3A 3MUDA 1G1IA 2JDIH 2WPVB 3L74J 2RMZA 2E76C 3L36A 4K3AA 1NTZE 1L0LJ 4Z1MH 3H1ID 4RO0A 3A0BH 4I1LA 1NKZB 1EQ7A 5AVWB 3P8CE 3L72D 3H32B 1IZNB 1AFOA 1IFIA 3V4QA 1JY3O 3V2RA 1KB9H 5DJUB 1U7MA 2N1TD 3M9QA 2L91A 3HUSA 5CCGC 2KZJA 2J60A 2IYOA 1RE3C 1GZLA 1SQBE 4OGQD 2J5ZA 4H44B 3MIWA 1PZQA 5APTA 3KPEA 2BCCJ 1H8AA 3GMAA 3JC22 2XZRA 3E1IC 3AEGC 3GHGC 1N86A 1SQQG 2JP3A 1ZW0A 4YXDC 2M5AB 2E74B 3G6EP 1PV3A 2BEQD 2YKPA 1G2CA 1FIDA 1ZRTD 1P84E 2H88C 3H1LE 1N8RQ 1JY2P 1VQ9P 3A2AA 1LWUC 3CX5I 3TGUG 1LJ2A 2IBZI 2JKVA 3RL0D 1PPJG 3RL0B 1FJPA 1LT1A 2ZT9B 1FJKA 3L37A 1J2JB 1K05A 1FZDA 1NH4A 5AVVB 2RH0A 1VQLP 1NYHA 3A0HH 3CX5E 1KB9D 2FXMA 1RF0A 4N6JA 2ZJSE 3EFFK 3V2QA 1GL2A 4D6TD 4ASVA 2Z4EB 1IC2A 2J0GA 1KYOE 1FZEC 4H0LB 2W6BA 3HE5A 2Q9IC 3JCUH 2A45H 2QJYC 1HVVA 2Q6QA 5AW0B 2J61B 3O8ZA 2E42A 5GTHH 2HR3A 2K37A 3I56P 3V4WA 3Q5SA 1FAVA 2WNPF 2HPCA 2WPSA 1FZCC 2Z4EC 3UIAA 1SFCA 2WT7A 2WT7B 4BRYA 1EC5A 3CWBE 3RK2C 5AW9B 3EWKA 1FZCA 4IFFA 5AVUB 1PP9G 1SQPG 4EDFA 3TF5A 1GL2D 4PD4I 2P10A 2NPSC 1SQBK 3LIDA 4Y99B 1NTZD 5KLVG 5CCHD 5B5EH 1JMBA 3TGUJ 1Z3SA 2XNDH 4L73A 3U59A 1PIXA 1SQVK 3L71D 5AW7B 1GL2C 1L0NK 4EYYQ 1L2PA 2KXPB 1K8AQ 2O1JA 1BSHA 2J3UA 4N3YB 2WSFJ 3CX5D 2IBZD 4EPUA 1FDIA 1YJ9P 1SQVG 5GTHE 2HODA 4IL6X 1LWUA 1CSBA 1YQ3C 1JCDA 3VP9A 1N7LA 1UIIA 2H8PD 3SWFA 1X0TA 2LR2A 1MZ9A 4DZOA 2FYZA 1KYOH 1YQ4C 2E75B 1BE3D 1MV8A 1EZVI 3R4YA 3BASA 2C9LY 2FIBA 2FYNC 1FBMA 3TGUE 4I7ZC 1BGYD 1Q7YQ 2K1AA 1PP9E 3QH9A 1NGMB 1EDJA 1BSNA 3RK3E 4PV1C 1JY2N 3IFMA 4C7RA 1DEBA 1BCCJ 3CXHE 2QJKB 2AEJA 3M91A 1T3JA 2FBWC 1PGJA 1SQXK 1USEA 2K9JA 3CXHD 1ZR4A 5APSA 3GHGB 4PD4D 3C8VA 2E5TA 3L75E 1NTKE 2OYOA 1H88A 3MUDC 3NMDA 2ZVNB 1R5SA 1AA0A 1E5WA 1SP4A 1KILB 2N1TA 4AUWA 1FZEA 1KILC 2YKQA 2A45I 2E75D 2QVAA 2JHMF 3L70G 1SQXJ 1AVYA 1EDKA 2WWWA 1RF0C 1OZHA 4NPFX 1SQBG 4R9JA 2QJKC 1ZXGA 2KSJA 3LW5H 1DD4A 2FXPA 2WZ7A 3L75D 4TT3H 2WSCJ 4WY4D 1BDDA 4W7ZA 1SQQE 1LTTC 1VQKP 2NPSB 2JHHC 3KHUA 2YO3A 1BCCD 5KAIE 2WSSH 3M0DA 1NTMG 3G71P 1VQ5P 1L0LG 1NU1D 2QG4A 3CCJP 3D70A 1BDCA 1FZGA 1M8OB 3NTNA 1MFTA 4U3FJ 1ZLLA 1L0NJ 3IAOA 4ZMDA 4C46A 3P8CD 3KYQA 5CCGA 2V7QJ 1S2EA 3GF7A 5CCHA 4RJTA 5KJ7A 1QL1A 3FXEA 2HLOC 2FXOA 3Q2YA 5BU8B 2HG5D 3CI9A 3CX5H 4U7JA 3RL0C 2KOGA 2D2CB 3OW2O 3VYIA 2J3FD 2KP8A 1P84H 3PHLA 2BCCD 2JWDA 2XKMA 4C7NA 1RQVA 1VQ6P 2PGDA 3A0HE 1M7LA 2E76D 3KZIE 3HRNA 3E1IB 2ZXEB 3L73G 1L0NE 3SSUA 4CPGA 5AVXB 1S3JA 1SQPE 1RE3B 1KN7A 2PFXA 4Y99C 3FX0A 1IFNA 2GUSA 1L0LE 2WITA 3BCCG 1LGHB 4KHXA 2QSIA 4R9TA 1RF1C 3Q5RA 5K5GB 2O01N 3F89A 1YYCA 3AEBC 2WSEJ 3RK2B 3I5CA 1L4AB 3AECC 2Q9IB 1OMIA 3H1LD 1NU1K 3HD7C 4QMAA 3PTZA 4PD4H 2OYHA 3AE9C 2QM7A 1L0LD 2O1KA 2B9BA 3H1HJ 3KDPB 3S9OA 1Q81Q 3CD6P 4JF7A 4NYTA 2XV5A 4H44D 1BCCG 1SLQA 1TU3F 4ZKPA 1EXJA 4I7ZB 2Z5IA 1URQC 1N2DC 1JB0J 1Q90D 2E76B 1IJDB 5E79E 1GU5A 3AE4C 3Q5PA 1LWUB 1NAFA 3BVHC 1L4AA 4JBZA 2J0HA 2A06D 2BASA 1K04A 4ASWA 2K88A 1Y8AA 3L73J 3G9RA 5TJHA 1KILE 1KTMA 5APUA 5CMZA 1N7SD 1HJBA 3EQ2A 2D2CD 1FZFA 1EZVE 2FFDC 3I55P 3B71A 5CJ4A 1YJWP 3G3ZA 1SFCD 2FFDA 5KAFE 2N9BA 2W27A 1FZAB 4C7NB 4R4LA 1QVGO 1CI6B 1XTCC 2J5UA 3VOPA 3TNUB 2FFDB 4PJ0H 2ZVOB 4M7FA 1WRGA 1YTZT 5AW8B 2FYNB 4HB1A 2NPSD 2K9JB 1KQSO 2H7HA 1M1JB 1VQMP 4PJ0E 1ZRTE 5AVYB 2KLVA 1E79H 2O3JA 5BVZA 4JYOX 1NWQA 1VQPP 3L4FA 3G4SP 2CK3H 2KNCA 1ZP0C 2ZT9C 3D6YA 1NU1E 1S5LH 3TNUA 2OYHC 4BXLA 1LTAC 1S72P 5M1BA 2P2UA 1EDIA 5H2FH 2J0YA 3B5NA 3B8EB 5C39A 2OARA 2YKOA 1OXZA 3RBXA 3CCMP 1VQOP 5B66E 1RF1A 4U3FG 1VPCA 1YHQP 4IFMA 1ZN5A 1N7SA 1VF5B 3CCLP 4K35A 2L5GB 5APVA 2K9YA 1RE4A 3CXHI 3U1AA 1OVRA 1EXIA 1KD1Q 3H1JE 1DEEG 1IK9A 4EIJA 2DW3A 3RK3C 5KLVD 1L0LK 3BCCJ 2I1KA 3IR9A 2B87B 5EFWB 2Y9YA 3BRVB 1LP1A 1HTLC 2XU6A 4U3FD 1FC2C 1FZAC 4GDOA 1SQQK 1IK7A 1R8EA 3AE8C 1NTKG 1Y47A 5APYA 2YNYA 2W6AA 4L76A 3H32A 1S9KD 3N7NA 1SQXD 5AW4B 3B5NB 1SQQJ 3O6QB 1T3UA 3F5HA 3QWOC 4PV1B 5KJ7C 2OYHB 5AVTB 3L35A 3V5BA 2XNXB 3H1JJ 1ZMEC 3CCQP 1X9VA 2KLUA 4GIFA 4GOFA 4N78D 1QGKB 1LTGC 5KJ7D 3W67A 5KAFH 1M57D 1JM0A 3RBZA 2ZXXA 4IL6E 1YITP 2J58A 2N1TB 3L73D 1JUNA 3MTUE 1PPJD 1W2BO 3OJAB 4ZKUA 2E75C 4YPCA 5APXA 2QEXP 1LT9B 3PJSK 1FZGB 1GDTA 3H1KE 4KJMA 1USDA 3Q3DA 3RGUA 4TLFA 2AEMA 1SQXG 2IBZE 2E74C 5APQA 1NU1G 1QVFO 3B4SA 1CI6A 1RQUA 1FZBC 1P84D 1IFDA 1SQPK 2IX7C 2OTJP 2LKMA 1JY3N 5KAIH 2CPSA 4EOTA 3CCEP 3IF4A 3OA7A 1VQ4P 2ZFCA 1JY2O 2W90A 3L72E 1SQPJ 4DT0A 2A06G 5DJTB 4UB8E 1SQBD 1KV4A 1JMMA 1RY3A 4DJGA 2Q3EA 1PP9D 4GT1A 1OVUA 4ZFGA 2I1JA 2ITAA 1KQGB 1U7JA 1J1DC 3H1KJ 2WTYA 2Y0EA 2HLOA 1IFPA 2R5BA 3AE3C 1RE4B 2FYUJ 5CCHC 3W68A 2KB7P 1KYOI 4OGQC 2M3EA 1N7SB 1JNMA 1GW4A 1RH5B 2R3SA 3AEFC 2KS1B 3R2PA 4LC1A 1FZGC 2R3CA 1G1JA 2R5DA 2Z5HA 2JR8A 3PLNA 4AYCA 3WU2E 2WMMA 4UB6E 1OW7A 2O01J 1PFIA 2NZ2A 4N78E 3FIBA 4W80A 4GODA 2WVRA 3FWNA 1LNQA 3L72J 5AW5B 3WUVA 1SVFA 1OW8A 1OX3A 2V4HA 4RKUJ 1LTJA 3TYYA 2HODC 1H0TA 2WPQA 2ZYAA 2Y9ZA 1FZEB 3A7OA 1NKNA 2QE7H 3CCRP 1M1JA 1VQ8P 1JCCA 1FS0E 1FDOA 3L70E 3JCUE 3A3YB 2GM4A 3EFGA 3A5TA 3KXDA 3RK2D 3CC2P 2NPSA 1DH3A 2B88A 3BRTB 1NTKD 5AW2B 3BATA 3II6A 2YXQB 2FKWB 4YXWH 1S5LX 5L8RJ 3Q1MA 1OW6A 1GTWA 3H1LJ 1GMJA 5KTBA 5APWA 3L73E 1SFCC 2LXCB 1KYOD 5AVZB 1XTGB 3L72G 1NTZG 1IO4A 4WWIA 1SQVD 1YI2P 1KC8Q 3H1IG 4OWFA 2D2CC 3WUTA 1SQVJ 2Q9IA 1Z56A 5AVRB 1OVVA 1SFCB 3CWBG 4I6MC 2SPZA 1JEKA 3WMM0 3H1KD 1YIJP 3VMXA 2J61A 3L71G 3HD7B 2N9YB 1BE3E 3USSA 3P8MC 4MN4C 2M3BA 1X79B 2FYUD 5H2FE 1GL2B 1KORA 3NFQA 3GG2A 1RF0B 3C9IA 4XA4A 1HGVA 2J59M 3HTKB 3CXHH 5GTIH 1T2KC 1P84I 2Y0CA 3BCCD 4BWNA 3MGNA 1N86C 1NTKK 1DX7A 4IOIH 2O01H 4I2LC 3N4XA 5AW3B 3RK3B 2QA4P 2KS1A 4BRYB 4H13D 1SQVE 1SQXE 1JTHA 1PGQA 3ZDMA 1RE3A 2AXCA 1VF5C 1AV1A 3IN6A 2IZ1A 1FIBA 2WSCH 3H1IE 1NJIQ 1N86B 2HODB 4KT0J 1ZV8A 2BCCG 4OH8B 1BE3J 2JHKF 2J3GA 5CJ0A 2WQYC 1L4AD 3FXDA 3WU2H 2Z4EA 3M06A 2HPCC 2IPPA 2IYPA 4DOJA 3L71J 4H13C 2A06E 2J3OA 4XFJA 1HH0A 1M90Q 3TGUD 3M9BA 1EZVD 1A02J 1GD2E 2XDJA 3VP8A 2XNXC 1KQLA 4WY4C 2LXBA 4HJGH 1NO4A 1R5LA 1ZR2A 4XE5B 2GUVA 2MJZA 3AE5C 2FYUK 2M0BA 1PP9J 1U57A 2KNCB 3HE4B 1M1JC 3OAKA 3H1IJ 1FICA 3FWLA 1Z3UA 3CMAP 2M8RA 2YMYA 1BCCE 1LTJC 2UWJE 3E1RA 2KUBA 1BGYE 2W6JH 2OTLP 1S9KE 3HTKA 3S4RA 3NXSA 4EI2A 3V2PA 3VMAA 3HUSB 3AE7C 1VDFA 3L71E 4D6TJ 3GHGA 3E1IA 1NTKJ 2ZYDA 3H1LG 1SQPD 1HGZA 3L70D 1T6AA 4JYBA 1W5CE 2C0XA 3D6ZA 5CCGD 1S5LE 2QJPB 1M56D 1X22A 1LTBC 1T8ZA 1FOSF 1QX8A 3ITKA 2GY7A 3HUSC 4JPZB 5KLVJ 1QEXA 2YMKA 1KFMA 1A02F 2WSFH 5BU5A 4H44C 4HH2A 2AEFA 3RL0g 4AQRD 3H32C 3HE4A 1MKMA 2ZAEB 3WUUA 4L74A 2I8DA 1W2EA 2PAJA 2OGUA 3H6PA 1HWTC 3H25A 2OYIB 1S4XA 1J1EC 2Q3IA 3H1HE 2E43A 2G8YA 4DCKA 2W83C 1Q82Q 3E7KA 2KI7B 3T97B 3LIEA 3AEEC 1BGYG 4IL6H 4WB4A 2AXTH 4GOEA 4U3FE 1KILD 3P7KA 1FZBA 3PH0A 2OYIC 1YBKA 3S1KA 2PP6A 2R44A
chains in the Genus database with same CATH topology
1GZLA 2GUSA 2J5ZA 2WITA 1GW4A 1RF1B 1LGHB 3MIWA 4KHXA 5APTA 3KPEA 3R2PA 1RF1C 4R9TA 1H8AA 4LC1A 1FZGC 1IFMA 2R3CA 1G1JA 2XZRA 1YYCA 3RK2B 3I5CA 2R5DA 2Z5HA 3E1IC 1L4AB 3GHGC 1N86A 4AYCA 1G2CB 2Q9IB 4RESB 1LT9A 1PFIA 1NU1K 3HD7C 4N78E 3FIBA 4W80A 1HBWA 2OYHA 2YKPA 1NTZK 2JHLF 5AW5B 1G2CA 2QM7A 1FIDA 1SVFA 2O1KA 1JY2P 3TSIA 3A2AA 1LWUC 3KDPB 1LTJA 1MFZA 4HYTB 3TYYA 2HODC 4JF7A 4NYTA 2XV5A 2WPQA 1SLQA 1FZEB 4LGDE 3RL0D 4ZKPA 3RL0B 1FJPA 3A7OA 1NKNA 1FJKA 1M1JA 1J2JB 3L37A 1FZDA 2WSEH 1NH4A 2Z5IA 1URQC 5AVVB 1JCCA 2HFED 1KFNA 1N2DC 2FXMA 1RF0A 2P7JA 4N6JA 1N73A 2H43B 1IJDB 4GKGA 3A3YB 3V2QA 1GU5A 1LWUB 1GL2A 1NAFA 2GM4A 3BVHC 1L4AA 3EFGA 2Z4EB 2J0HA 1IC2A 2J0GA 3A5TA 2BASA 1FZEC 2W6BA 3HE5A 2IFMA 3TK1A 2Q9IC 5AVQB 3RK2D 1JO5A 2A45H 5AVSB 1HVVA 1NHLA 2NPSA 5AW0B 2J61B 3O8ZA 2E42A 1DH3A 1T2KD 4M7HA 5APUA 3BRTB 5CMZA 1KZUB 3V4WA 4LLHA 1J1EB 1FZAA 5AW2B 1FAVA 3BATA 2WNPF 2HPCA 1N7SD 1HJBA 2WPSA 2H43A 3BVHB 3EQ2A 3II6A 1FZCC 2HLOB 2Z4EC 3UIAA 1FZFA 1SFCA 2FKWB 2VRSA 2FFDC 2WT7A 5CJ4A 3KQGA 2D39A 2WT7B 1GTWA 1URQB 3G3ZA 1SFCD 2FFDA 5KTBA 2N9BA 2JHIF 5APWA 3RK2C 5AW9B 2HPCB 1J1DB 2W27A 1SFCC 1FZAB 1FZFC 1FZCA 2P1JA 4C7NB 2H43C 5AVZB 4IFFA 2J3FA 4Y99C 1CI6B 1XTGB 5AVUB 4B86A 2J64A 1RE4C 1XTCC 1IO4A 1GL2D 2NPSC 1SQBK 3LIDA 3VOPA 1N7SC 4Y99B 3TNUB 2FFDB 5CCHD 3SWYA 3HE5B 1Z3SA 2JEEA 2Q9IA 1Z56A 4M7FA 3U59A 1SQVK 5AVRB 1WRGA 1YTZT 1SFCB 1CZQA 4I6MC 3B5NC 5AW7B 3BVHA 1GL2C 1L0NK 5AW8B 2NPSD 3PP5A 3WMM0 3VMXA 2H7HA 2J61A 2POHA 2O1JA 3HD7B 1QL2A 1M1JB 3P8MC 2J3UA 4N3YB 2M3BA 5AVYB 1X8YA 2KLVA 3MD0A 4EPUA 2YO2A 1GU4A 5BVZA 1X79B 4JYOX 2HODA 1NWQA 1GL2B 1LWUA 1CSBA 3L4FA 3T97A 2A45G 3NFQA 1JC9A 1JCDA 3VP9A 1N7LA 2H8PD 3TNUA 3SWFA 2OYHC 1RF0B 3C9IA 4XA4A 1MZ9A 1JOCA 1HGVA 2J59M 3HTKB 1LTAC 4DZOA 2FYZA 3HD7A 1T2KC 4M3LA 3B5ND 1GW3A 1JTHB 1FU1A 1LT9C 1MV8A 1URQD 2P2UA 2J0YA 3BASA 3MGNA 1N86C 1NTKK 3B5NA 3B8EB 1DX7A 2O01H 2WPRA 4I2LC 2OARA 3N4XA 5AW3B 3RK3B 1FOSE 2C9LY 2YKOA 1OXZA 1LTJB 2FIBA 1IFJA 1FBMA 1RF1A 1GK6A 1VPCA 1JTHA 4IFMA 4WY4B 1ZN5A 1N7SA 1RE3A 3U1CA 5APVA 2L5GB 1RE4A 3U1AA 2KYVA 1FIBA 2WSCH 4WBAA 1N86B 1CW5A 1IK9A 2HODB 1JY2N 3IFMA 4EIJA 1ZV8A 5KLVK 3RK3C 4C7RA 1DEBA 4OH8B 1LTSC 2R32A 2J1GA 2JHKF 1L0LK 2I1KA 3IR9A 2J3GA 5CJ0A 3BRVB 3M91A 1L4AD 2C0WA 4O9BA 1T3JA 3VN0A 2Q5UA 1SQXK 2Z4EA 3M06A 1HTLC 2XU6A 1GK4A 2HYNA 2HPCC 2IPPA 4DOJA 1FZAC 1FZFB 1ZR4A 5APSA 1SQQK 3GHGB 2J3OA 1HH0A 3M9BA 3VMYA 1H88A 1NTMK 5APYA 3NMDA 2YNYA 1A02J 1GD2E 2XDJA 3VP8A 2W6AA 2XNXC 1E5WA 1SP4A 1NOHA 2P67A 3RK3D 3H32A 1KILB 2N1TA 1S9KD 1KQLA 4WY4C 4AUWA 3N7NA 1FZEA 1KILC 1MUUA 2YKQA 1L4AC 1NO4A 2A45I 5AW4B 3B5NB 4XE5B 1ZR2A 3M0AA 2JHMF 2GUVA 2C9NY 1T3UA 2MJZA 1N73C 2WWWA 4JYCA 5KJ7C 1RF0C 2OYHB 3VMZA 1WT6A 2FYUK 5AVTB 3L35A 3V5BA 1URQA 4R9JA 3HE4B 2XNXB 1M1JC 1AQ5A 2KSJA 2CPBA 3OAKA 3LW5H 1FICA 1X9VA 2WZ7A 5AW6B 4GIFA 1Z3UA 4N78D 4JZCA 3P32A 1LTGC 4WY4D 2M8RA 4W7ZA 2YMYA 1LTJC 5KJ7D 3HD7D 5CHXA 3VTPC 1LTTC 3M9HA 2QM8A 2J58A 2N1TB 1JUNA 3M0DC 3MTUE 2NPSB 2JHHC 1S9KE 2YO3A 3OJAB 4ZKUA 3CL3D 3HTKA 3NXSA 3V2PA 3HUSB 1VDFA 5APXA 3M0DA 1YTZI 1LT9B 2JJLA 1FZBB 3GHGA 3E1IA 3CLQA 1FZGB 1GDTA 1HGZA 1FZGA 3NTNA 1ZLLA 4JYBA 2Q7CA 2C0XA 1N73B 5CCGD 1LTBC 4C46A 1T8ZA 1FOSF 1LTIC 2GY7A 5APQA 3P8CD 3KYQA 5CCGA 3HUSC 1OWAA 5CCHA 5KJ7A 1H89A 1CI6A 2OYIA 4IFDK 1QL1A 1FZBC 1IFDA 1FZCB 2HLOC 1SQPK 2IX7C 4W7YA 1JY3P 1HUCA 2LKMA 2J2PA 1KFMA 5BU8B 1A02F 2WSFH 1JY3N 2HG5D 5BU5A 2IFNA 3CI9A 1FDMA 2CPSA 4EOTA 1KILA 4HH2A 3RL0C 2KOGA 4WY4A 3OA7A 2N1TC 5AW1B 3V2NA 4AQRD 3H32C 2XNXA 3HE4A 3VYIA 3MUDA 1G1IA 1JY2O 2ZFCA 2J3FD 1W2EA 2KP8A 2PAJA 3H6PA 1HWTC 3L36A 2OYIB 1J1EC 2Q3IA 2E43A 2XKMA 4C7NA 4I1LA 1NKZB 1EQ7A 5AVWB 1JMMA 1RY3A 3P8CE 4GT1A 3H32B 1AFOA 4ZFGA 2I1JA 1M7LA 3LIEA 1IFIA 3V4QA 1J1DC 2WTYA 1JY3O 3HRNA 4WB4A 3V2RA 3E1IB 2ZXEB 2HLOA 1KILD 3P7KA 1FZBA 2OYIC 2R5BA 2N1TD 1RE4B 3M9QA 5AVXB 5CCHC 3HUSA 1RE3B 2KB7P 5CCGC 2J60A 2PP6A 1N7SB 1JNMA 1IFNA 1RE3C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J5Z A;  2D39 A;  2JHH C;  1RF1 B;  1RE3 A;  3HUS B;  2FFD A;  4R9T A;  1RF1 C;  1RE4 A;  2JHI F;  1FZG C;  2HPC B;  1LT9 B;  1FZB B;  1FZA B;  1FZF C;  3GHG A;  1FIB A;  1FZC A;  3E1I A;  1FZG B;  2H43 C;  1N86 B;  3E1I C;  2J3F A;  2HOD B;  1JY2 N;  3GHG C;  1N86 A;  1FZG A;  2J64 A;  1RE4 C;  2Q9I B;  2J1G A;  1LT9 A;  2JHK F;  1N73 B;  2J3G A;  2FFD B;  3FIB A;  2OYH A;  1Z3S A;  2GY7 A;  2JHL F;  2Q9I A;  4M7F A;  1FID A;  3HUS C;  2Z4E A;  1JY2 P;  2OYI A;  2HPC C;  1LWU C;  1FZB C;  1LTJ A;  1FZA C;  1FZF B;  1FZC B;  2HLO C;  3GHG B;  2HOD C;  4NYT A;  3BVH A;  1JY3 P;  2J3O A;  2J2P A;  1FZE B;  1JY3 N;  1M1J A;  1FZD A;  2J61 A;  2XNX C;  3H32 C;  1M1J B;  2XNX A;  3H32 A;  2J3U A;  1RF0 A;  1FZE A;  1JY2 O;  1N73 A;  2J3F D;  4EPU A;  2H43 B;  1W2E A;  2A45 I;  1LWU B;  2JHM F;  4JYO X;  2OYI B;  3BVH C;  2HOD A;  2Z4E B;  1T3U A;  2J0H A;  1LWU A;  2J0G A;  1N73 C;  2A45 G;  1FZE C;  1JC9 A;  1RF0 C;  2OYH B;  2Q9I C;  2OYH C;  1RF0 B;  4R9J A;  2A45 H;  3H32 B;  2XNX B;  1M1J C;  4ZFG A;  1FIC A;  2J61 B;  1LT9 C;  2J0Y A;  1JY3 O;  1Z3U A;  4M7H A;  4JZC A;  1N86 C;  3E1I B;  2HLO A;  1FZA A;  1LTJ C;  1FZB A;  2WNP F;  2HPC A;  2H43 A;  2OYI C;  3BVH B;  1RE4 B;  1FZC C;  2HLO B;  2Z4E C;  1FZF A;  3HUS A;  1LTJ B;  1RE3 B;  2FIB A;  2J60 A;  1RF1 A;  2FFD C;  1RE3 C; 
#chains in the Genus database with same CATH topology
 1NTZ J;  3H1J G;  4WVZ A;  1RF1 B;  5KLI B;  5KLV E;  2GA1 A;  2QIW A;  3AE2 C;  1IFM A;  3FGA D;  1NVO A;  1SQQ D;  4H0L D;  1G2C B;  1SS1 A;  4RES B;  2ZYG A;  1LT9 A;  2JWA A;  2FYU E;  2NRG A;  4NPD A;  1HBW A;  1NTM D;  2YIU B;  1NTZ K;  2JHL F;  1SQB J;  2PRR A;  4UB8 H;  3TSI A;  2KIK A;  1MFZ A;  4HYT B;  1K9M Q;  2ZT9 D;  3L74 D;  1M1K Q;  4LGD E;  2IZ0 A;  2WSE H;  3L75 G;  2HFE D;  1KFN A;  5CBN A;  5B66 H;  1OFC X;  5B5E E;  1FE6 A;  3CWB D;  2P7J A;  1N73 A;  3AE1 C;  2H43 B;  3A0B E;  3SFD C;  1NTM E;  4GKG A;  1PGO A;  3AED C;  2E74 D;  3C1L A;  3JSV C;  3O6Q A;  2IFM A;  4PD4 E;  3TK1 A;  3CWB J;  3SFE C;  5AVQ B;  4H0L C;  1JO5 A;  1K73 Q;  5KKZ C;  5AVS B;  1NHL A;  1KB9 I;  4A7P A;  1HF9 A;  2E5Y A;  2YXR B;  1T2K D;  4M7H A;  3D71 A;  1KZU B;  3L70 J;  4LLH A;  1J1E B;  1FZA A;  2H43 A;  3BVH B;  1S1C X;  2HLO B;  3TDK A;  2KK7 A;  2VRS A;  3KQG A;  2D39 A;  5KKZ B;  1URQ B;  3CCS P;  2JHI F;  2HPC B;  4Y28 J;  1J1D B;  1FZF C;  2P1J A;  2H43 C;  2JO1 A;  2J3F A;  2QRX A;  1RHZ B;  4B86 A;  2J64 A;  1RE4 C;  3H1H D;  3PRJ A;  4D6T G;  3CC7 P;  3V6I A;  1N7S C;  3H1H G;  5TIS E;  1Y9B A;  1ZOY C;  1EDL A;  3SWY A;  1NTM J;  3HE5 B;  3CME P;  2JEE A;  2V7Q H;  3MP7 B;  3MZW B;  1CZQ A;  3B5N C;  3BVH A;  2RKL A;  3PP5 A;  2AXT E;  4JQ0 D;  1Q2N A;  2POH A;  1QL2 A;  3CCU P;  2IDB A;  3BCC E;  1BE3 G;  2Q1K A;  2YIU C;  1X8Y A;  3MD0 A;  2YO2 A;  1GU4 A;  2K3R A;  3T97 A;  2A45 G;  1JC9 A;  1DD3 A;  2B89 A;  4PV1 D;  2M5A A;  1JOC A;  2IBZ G;  3HD7 A;  3LW5 J;  4M3L A;  3B5N D;  1GW3 A;  1JTH B;  1FU1 A;  2FYU G;  1LT9 C;  1URQ D;  2H89 C;  2WPR A;  3GLM A;  1FOS E;  1KB9 E;  1LTJ B;  1IFJ A;  3GW6 A;  1GK6 A;  2OQQ A;  4WY4 B;  5CBO A;  1L0N G;  3ABV C;  3L74 G;  1YJN P;  3U1C A;  2KYV A;  2W8Z A;  4WBA A;  1CW5 A;  2G3A A;  2KZI A;  5KLV K;  1Q86 Q;  1AVO A;  1LTS C;  2R32 A;  2J1G A;  1AJY A;  2FY8 A;  4NPE A;  2Y0D A;  5KLI C;  2C0W A;  4O9B A;  3VN0 A;  2Q5U A;  1KQF B;  1L0N D;  1DIP A;  1GK4 A;  2HYN A;  1FZF B;  1VF5 D;  4ZNC A;  4OGQ B;  2OTK E;  1NU1 J;  3H1J D;  4H13 B;  2P58 A;  3VMY A;  1EZV G;  1NTM K;  3RK3 D;  1NOH A;  1OIP A;  2P67 A;  1LP1 B;  2B87 A;  1MUU A;  3SWK A;  1L4A C;  1PL5 A;  3AEA C;  3M0A A;  3KZI H;  2C9N Y;  1UIX A;  1N73 C;  3CPW O;  4JYC A;  3VMZ A;  1WT6 A;  3L75 J;  1HJ0 A;  1URQ A;  4D6T E;  1AQ5 A;  2CPB A;  3CC4 P;  2RN0 A;  5AW6 B;  4JZC A;  3P32 A;  1PPJ E;  4OVN F;  1VQN P;  3L74 E;  1H0T B;  3HD7 D;  2BEZ F;  5CHX A;  3VTP C;  3AE6 C;  3M9H A;  2QM8 A;  4R4M A;  3M0D C;  4YTP C;  2QJP C;  1WMK A;  1QLE D;  3CL3 D;  4HKZ H;  5TIS H;  1KMI Z;  2KSE A;  3CCV P;  1YTZ I;  2JJL A;  1FZB B;  3CLQ A;  1NAY A;  1AQT A;  3K5B A;  1D7M A;  4L75 A;  2Q7C A;  1N73 B;  1BGY J;  1LTI C;  1VQ7 P;  4UB6 H;  1OWA A;  1H89 A;  2MKV A;  2OYI A;  3MHV A;  4IFD K;  1PGP A;  2BCC E;  1FZC B;  5E79 H;  4W7Y A;  1JY3 P;  1HUC A;  2J2P A;  2IFN A;  1FDM A;  1KIL A;  3H1K G;  4WY4 A;  1VL2 A;  2N1T C;  5AW1 B;  3V2N A;  5GTI E;  2QJY B;  2XNX A;  3GF3 A;  3MUD A;  1G1I A;  2JDI H;  2WPV B;  3L74 J;  2RMZ A;  2E76 C;  3L36 A;  4K3A A;  1NTZ E;  1L0L J;  4Z1M H;  3H1I D;  4RO0 A;  3A0B H;  4I1L A;  1NKZ B;  1EQ7 A;  5AVW B;  3P8C E;  3L72 D;  3H32 B;  1IZN B;  1AFO A;  1IFI A;  3V4Q A;  1JY3 O;  3V2R A;  1KB9 H;  5DJU B;  1U7M A;  2N1T D;  3M9Q A;  2L91 A;  3HUS A;  5CCG C;  2KZJ A;  2J60 A;  2IYO A;  1RE3 C;  1GZL A;  1SQB E;  4OGQ D;  2J5Z A;  4H44 B;  3MIW A;  1PZQ A;  5APT A;  3KPE A;  2BCC J;  1H8A A;  3GMA A;  3JC2 2;  2XZR A;  3E1I C;  3AEG C;  3GHG C;  1N86 A;  1SQQ G;  2JP3 A;  1ZW0 A;  4YXD C;  2M5A B;  2E74 B;  3G6E P;  1PV3 A;  2BEQ D;  2YKP A;  1G2C A;  1FID A;  1ZRT D;  1P84 E;  2H88 C;  3H1L E;  1N8R Q;  1JY2 P;  1VQ9 P;  3A2A A;  1LWU C;  3CX5 I;  3TGU G;  1LJ2 A;  2IBZ I;  2JKV A;  3RL0 D;  1PPJ G;  3RL0 B;  1FJP A;  1LT1 A;  2ZT9 B;  1FJK A;  3L37 A;  1J2J B;  1K05 A;  1FZD A;  1NH4 A;  5AVV B;  2RH0 A;  1VQL P;  1NYH A;  3A0H H;  3CX5 E;  1KB9 D;  2FXM A;  1RF0 A;  4N6J A;  2ZJS E;  3EFF K;  3V2Q A;  1GL2 A;  4D6T D;  4ASV A;  2Z4E B;  1IC2 A;  2J0G A;  1KYO E;  1FZE C;  4H0L B;  2W6B A;  3HE5 A;  2Q9I C;  3JCU H;  2A45 H;  2QJY C;  1HVV A;  2Q6Q A;  5AW0 B;  2J61 B;  3O8Z A;  2E42 A;  5GTH H;  2HR3 A;  2K37 A;  3I56 P;  3V4W A;  3Q5S A;  1FAV A;  2WNP F;  2HPC A;  2WPS A;  1FZC C;  2Z4E C;  3UIA A;  1SFC A;  2WT7 A;  2WT7 B;  4BRY A;  1EC5 A;  3CWB E;  3RK2 C;  5AW9 B;  3EWK A;  1FZC A;  4IFF A;  5AVU B;  1PP9 G;  1SQP G;  4EDF A;  3TF5 A;  1GL2 D;  4PD4 I;  2P10 A;  2NPS C;  1SQB K;  3LID A;  4Y99 B;  1NTZ D;  5KLV G;  5CCH D;  5B5E H;  1JMB A;  3TGU J;  1Z3S A;  2XND H;  4L73 A;  3U59 A;  1PIX A;  1SQV K;  3L71 D;  5AW7 B;  1GL2 C;  1L0N K;  4EYY Q;  1L2P A;  2KXP B;  1K8A Q;  2O1J A;  1BSH A;  2J3U A;  4N3Y B;  2WSF J;  3CX5 D;  2IBZ D;  4EPU A;  1FDI A;  1YJ9 P;  1SQV G;  5GTH E;  2HOD A;  4IL6 X;  1LWU A;  1CSB A;  1YQ3 C;  1JCD A;  3VP9 A;  1N7L A;  1UII A;  2H8P D;  3SWF A;  1X0T A;  2LR2 A;  1MZ9 A;  4DZO A;  2FYZ A;  1KYO H;  1YQ4 C;  2E75 B;  1BE3 D;  1MV8 A;  1EZV I;  3R4Y A;  3BAS A;  2C9L Y;  2FIB A;  2FYN C;  1FBM A;  3TGU E;  4I7Z C;  1BGY D;  1Q7Y Q;  2K1A A;  1PP9 E;  3QH9 A;  1NGM B;  1EDJ A;  1BSN A;  3RK3 E;  4PV1 C;  1JY2 N;  3IFM A;  4C7R A;  1DEB A;  1BCC J;  3CXH E;  2QJK B;  2AEJ A;  3M91 A;  1T3J A;  2FBW C;  1PGJ A;  1SQX K;  1USE A;  2K9J A;  3CXH D;  1ZR4 A;  5APS A;  3GHG B;  4PD4 D;  3C8V A;  2E5T A;  3L75 E;  1NTK E;  2OYO A;  1H88 A;  3MUD C;  3NMD A;  2ZVN B;  1R5S A;  1AA0 A;  1E5W A;  1SP4 A;  1KIL B;  2N1T A;  4AUW A;  1FZE A;  1KIL C;  2YKQ A;  2A45 I;  2E75 D;  2QVA A;  2JHM F;  3L70 G;  1SQX J;  1AVY A;  1EDK A;  2WWW A;  1RF0 C;  1OZH A;  4NPF X;  1SQB G;  4R9J A;  2QJK C;  1ZXG A;  2KSJ A;  3LW5 H;  1DD4 A;  2FXP A;  2WZ7 A;  3L75 D;  4TT3 H;  2WSC J;  4WY4 D;  1BDD A;  4W7Z A;  1SQQ E;  1LTT C;  1VQK P;  2NPS B;  2JHH C;  3KHU A;  2YO3 A;  1BCC D;  5KAI E;  2WSS H;  3M0D A;  1NTM G;  3G71 P;  1VQ5 P;  1L0L G;  1NU1 D;  2QG4 A;  3CCJ P;  3D70 A;  1BDC A;  1FZG A;  1M8O B;  3NTN A;  1MFT A;  4U3F J;  1ZLL A;  1L0N J;  3IAO A;  4ZMD A;  4C46 A;  3P8C D;  3KYQ A;  5CCG A;  2V7Q J;  1S2E A;  3GF7 A;  5CCH A;  4RJT A;  5KJ7 A;  1QL1 A;  3FXE A;  2HLO C;  2FXO A;  3Q2Y A;  5BU8 B;  2HG5 D;  3CI9 A;  3CX5 H;  4U7J A;  3RL0 C;  2KOG A;  2D2C B;  3OW2 O;  3VYI A;  2J3F D;  2KP8 A;  1P84 H;  3PHL A;  2BCC D;  2JWD A;  2XKM A;  4C7N A;  1RQV A;  1VQ6 P;  2PGD A;  3A0H E;  1M7L A;  2E76 D;  3KZI E;  3HRN A;  3E1I B;  2ZXE B;  3L73 G;  1L0N E;  3SSU A;  4CPG A;  5AVX B;  1S3J A;  1SQP E;  1RE3 B;  1KN7 A;  2PFX A;  4Y99 C;  3FX0 A;  1IFN A;  2GUS A;  1L0L E;  2WIT A;  3BCC G;  1LGH B;  4KHX A;  2QSI A;  4R9T A;  1RF1 C;  3Q5R A;  5K5G B;  2O01 N;  3F89 A;  1YYC A;  3AEB C;  2WSE J;  3RK2 B;  3I5C A;  1L4A B;  3AEC C;  2Q9I B;  1OMI A;  3H1L D;  1NU1 K;  3HD7 C;  4QMA A;  3PTZ A;  4PD4 H;  2OYH A;  3AE9 C;  2QM7 A;  1L0L D;  2O1K A;  2B9B A;  3H1H J;  3KDP B;  3S9O A;  1Q81 Q;  3CD6 P;  4JF7 A;  4NYT A;  2XV5 A;  4H44 D;  1BCC G;  1SLQ A;  1TU3 F;  4ZKP A;  1EXJ A;  4I7Z B;  2Z5I A;  1URQ C;  1N2D C;  1JB0 J;  1Q90 D;  2E76 B;  1IJD B;  5E79 E;  1GU5 A;  3AE4 C;  3Q5P A;  1LWU B;  1NAF A;  3BVH C;  1L4A A;  4JBZ A;  2J0H A;  2A06 D;  2BAS A;  1K04 A;  4ASW A;  2K88 A;  1Y8A A;  3L73 J;  3G9R A;  5TJH A;  1KIL E;  1KTM A;  5APU A;  5CMZ A;  1N7S D;  1HJB A;  3EQ2 A;  2D2C D;  1FZF A;  1EZV E;  2FFD C;  3I55 P;  3B71 A;  5CJ4 A;  1YJW P;  3G3Z A;  1SFC D;  2FFD A;  5KAF E;  2N9B A;  2W27 A;  1FZA B;  4C7N B;  4R4L A;  1QVG O;  1CI6 B;  1XTC C;  2J5U A;  3VOP A;  3TNU B;  2FFD B;  4PJ0 H;  2ZVO B;  4M7F A;  1WRG A;  1YTZ T;  5AW8 B;  2FYN B;  4HB1 A;  2NPS D;  2K9J B;  1KQS O;  2H7H A;  1M1J B;  1VQM P;  4PJ0 E;  1ZRT E;  5AVY B;  2KLV A;  1E79 H;  2O3J A;  5BVZ A;  4JYO X;  1NWQ A;  1VQP P;  3L4F A;  3G4S P;  2CK3 H;  2KNC A;  1ZP0 C;  2ZT9 C;  3D6Y A;  1NU1 E;  1S5L H;  3TNU A;  2OYH C;  4BXL A;  1LTA C;  1S72 P;  5M1B A;  2P2U A;  1EDI A;  5H2F H;  2J0Y A;  3B5N A;  3B8E B;  5C39 A;  2OAR A;  2YKO A;  1OXZ A;  3RBX A;  3CCM P;  1VQO P;  5B66 E;  1RF1 A;  4U3F G;  1VPC A;  1YHQ P;  4IFM A;  1ZN5 A;  1N7S A;  1VF5 B;  3CCL P;  4K35 A;  2L5G B;  5APV A;  2K9Y A;  1RE4 A;  3CXH I;  3U1A A;  1OVR A;  1EXI A;  1KD1 Q;  3H1J E;  1DEE G;  1IK9 A;  4EIJ A;  2DW3 A;  3RK3 C;  5KLV D;  1L0L K;  3BCC J;  2I1K A;  3IR9 A;  2B87 B;  5EFW B;  2Y9Y A;  3BRV B;  1LP1 A;  1HTL C;  2XU6 A;  4U3F D;  1FC2 C;  1FZA C;  4GDO A;  1SQQ K;  1IK7 A;  1R8E A;  3AE8 C;  1NTK G;  1Y47 A;  5APY A;  2YNY A;  2W6A A;  4L76 A;  3H32 A;  1S9K D;  3N7N A;  1SQX D;  5AW4 B;  3B5N B;  1SQQ J;  3O6Q B;  1T3U A;  3F5H A;  3QWO C;  4PV1 B;  5KJ7 C;  2OYH B;  5AVT B;  3L35 A;  3V5B A;  2XNX B;  3H1J J;  1ZME C;  3CCQ P;  1X9V A;  2KLU A;  4GIF A;  4GOF A;  4N78 D;  1QGK B;  1LTG C;  5KJ7 D;  3W67 A;  5KAF H;  1M57 D;  1JM0 A;  3RBZ A;  2ZXX A;  4IL6 E;  1YIT P;  2J58 A;  2N1T B;  3L73 D;  1JUN A;  3MTU E;  1PPJ D;  1W2B O;  3OJA B;  4ZKU A;  2E75 C;  4YPC A;  5APX A;  2QEX P;  1LT9 B;  3PJS K;  1FZG B;  1GDT A;  3H1K E;  4KJM A;  1USD A;  3Q3D A;  3RGU A;  4TLF A;  2AEM A;  1SQX G;  2IBZ E;  2E74 C;  5APQ A;  1NU1 G;  1QVF O;  3B4S A;  1CI6 A;  1RQU A;  1FZB C;  1P84 D;  1IFD A;  1SQP K;  2IX7 C;  2OTJ P;  2LKM A;  1JY3 N;  5KAI H;  2CPS A;  4EOT A;  3CCE P;  3IF4 A;  3OA7 A;  1VQ4 P;  2ZFC A;  1JY2 O;  2W90 A;  3L72 E;  1SQP J;  4DT0 A;  2A06 G;  5DJT B;  4UB8 E;  1SQB D;  1KV4 A;  1JMM A;  1RY3 A;  4DJG A;  2Q3E A;  1PP9 D;  4GT1 A;  1OVU A;  4ZFG A;  2I1J A;  2ITA A;  1KQG B;  1U7J A;  1J1D C;  3H1K J;  2WTY A;  2Y0E A;  2HLO A;  1IFP A;  2R5B A;  3AE3 C;  1RE4 B;  2FYU J;  5CCH C;  3W68 A;  2KB7 P;  1KYO I;  4OGQ C;  2M3E A;  1N7S B;  1JNM A;  1GW4 A;  1RH5 B;  2R3S A;  3AEF C;  2KS1 B;  3R2P A;  4LC1 A;  1FZG C;  2R3C A;  1G1J A;  2R5D A;  2Z5H A;  2JR8 A;  3PLN A;  4AYC A;  3WU2 E;  2WMM A;  4UB6 E;  1OW7 A;  2O01 J;  1PFI A;  2NZ2 A;  4N78 E;  3FIB A;  4W80 A;  4GOD A;  2WVR A;  3FWN A;  1LNQ A;  3L72 J;  5AW5 B;  3WUV A;  1SVF A;  1OW8 A;  1OX3 A;  2V4H A;  4RKU J;  1LTJ A;  3TYY A;  2HOD C;  1H0T A;  2WPQ A;  2ZYA A;  2Y9Z A;  1FZE B;  3A7O A;  1NKN A;  2QE7 H;  3CCR P;  1M1J A;  1VQ8 P;  1JCC A;  1FS0 E;  1FDO A;  3L70 E;  3JCU E;  3A3Y B;  2GM4 A;  3EFG A;  3A5T A;  3KXD A;  3RK2 D;  3CC2 P;  2NPS A;  1DH3 A;  2B88 A;  3BRT B;  1NTK D;  5AW2 B;  3BAT A;  3II6 A;  2YXQ B;  2FKW B;  4YXW H;  1S5L X;  5L8R J;  3Q1M A;  1OW6 A;  1GTW A;  3H1L J;  1GMJ A;  5KTB A;  5APW A;  3L73 E;  1SFC C;  2LXC B;  1KYO D;  5AVZ B;  1XTG B;  3L72 G;  1NTZ G;  1IO4 A;  4WWI A;  1SQV D;  1YI2 P;  1KC8 Q;  3H1I G;  4OWF A;  2D2C C;  3WUT A;  1SQV J;  2Q9I A;  1Z56 A;  5AVR B;  1OVV A;  1SFC B;  3CWB G;  4I6M C;  2SPZ A;  1JEK A;  3WMM 0;  3H1K D;  1YIJ P;  3VMX A;  2J61 A;  3L71 G;  3HD7 B;  2N9Y B;  1BE3 E;  3USS A;  3P8M C;  4MN4 C;  2M3B A;  1X79 B;  2FYU D;  5H2F E;  1GL2 B;  1KOR A;  3NFQ A;  3GG2 A;  1RF0 B;  3C9I A;  4XA4 A;  1HGV A;  2J59 M;  3HTK B;  3CXH H;  5GTI H;  1T2K C;  1P84 I;  2Y0C A;  3BCC D;  4BWN A;  3MGN A;  1N86 C;  1NTK K;  1DX7 A;  4IOI H;  2O01 H;  4I2L C;  3N4X A;  5AW3 B;  3RK3 B;  2QA4 P;  2KS1 A;  4BRY B;  4H13 D;  1SQV E;  1SQX E;  1JTH A;  1PGQ A;  3ZDM A;  1RE3 A;  2AXC A;  1VF5 C;  1AV1 A;  3IN6 A;  2IZ1 A;  1FIB A;  2WSC H;  3H1I E;  1NJI Q;  1N86 B;  2HOD B;  4KT0 J;  1ZV8 A;  2BCC G;  4OH8 B;  1BE3 J;  2JHK F;  2J3G A;  5CJ0 A;  2WQY C;  1L4A D;  3FXD A;  3WU2 H;  2Z4E A;  3M06 A;  2HPC C;  2IPP A;  2IYP A;  4DOJ A;  3L71 J;  4H13 C;  2A06 E;  2J3O A;  4XFJ A;  1HH0 A;  1M90 Q;  3TGU D;  3M9B A;  1EZV D;  1A02 J;  1GD2 E;  2XDJ A;  3VP8 A;  2XNX C;  1KQL A;  4WY4 C;  2LXB A;  4HJG H;  1NO4 A;  1R5L A;  1ZR2 A;  4XE5 B;  2GUV A;  2MJZ A;  3AE5 C;  2FYU K;  2M0B A;  1PP9 J;  1U57 A;  2KNC B;  3HE4 B;  1M1J C;  3OAK A;  3H1I J;  1FIC A;  3FWL A;  1Z3U A;  3CMA P;  2M8R A;  2YMY A;  1BCC E;  1LTJ C;  2UWJ E;  3E1R A;  2KUB A;  1BGY E;  2W6J H;  2OTL P;  1S9K E;  3HTK A;  3S4R A;  3NXS A;  4EI2 A;  3V2P A;  3VMA A;  3HUS B;  3AE7 C;  1VDF A;  3L71 E;  4D6T J;  3GHG A;  3E1I A;  1NTK J;  2ZYD A;  3H1L G;  1SQP D;  1HGZ A;  3L70 D;  1T6A A;  4JYB A;  1W5C E;  2C0X A;  3D6Z A;  5CCG D;  1S5L E;  2QJP B;  1M56 D;  1X22 A;  1LTB C;  1T8Z A;  1FOS F;  1QX8 A;  3ITK A;  2GY7 A;  3HUS C;  4JPZ B;  5KLV J;  1QEX A;  2YMK A;  1KFM A;  1A02 F;  2WSF H;  5BU5 A;  4H44 C;  4HH2 A;  2AEF A;  3RL0 g;  4AQR D;  3H32 C;  3HE4 A;  1MKM A;  2ZAE B;  3WUU A;  4L74 A;  2I8D A;  1W2E A;  2PAJ A;  2OGU A;  3H6P A;  1HWT C;  3H25 A;  2OYI B;  1S4X A;  1J1E C;  2Q3I A;  3H1H E;  2E43 A;  2G8Y A;  4DCK A;  2W83 C;  1Q82 Q;  3E7K A;  2KI7 B;  3T97 B;  3LIE A;  3AEE C;  1BGY G;  4IL6 H;  4WB4 A;  2AXT H;  4GOE A;  4U3F E;  1KIL D;  3P7K A;  1FZB A;  3PH0 A;  2OYI C;  1YBK A;  3S1K A;  2PP6 A;  2R44 A; 
#chains in the Genus database with same CATH homology
 1GZL A;  2GUS A;  2J5Z A;  2WIT A;  1GW4 A;  1RF1 B;  1LGH B;  3MIW A;  4KHX A;  5APT A;  3KPE A;  3R2P A;  1RF1 C;  4R9T A;  1H8A A;  4LC1 A;  1FZG C;  1IFM A;  2R3C A;  1G1J A;  2XZR A;  1YYC A;  3RK2 B;  3I5C A;  2R5D A;  2Z5H A;  3E1I C;  1L4A B;  3GHG C;  1N86 A;  4AYC A;  1G2C B;  2Q9I B;  4RES B;  1LT9 A;  1PFI A;  1NU1 K;  3HD7 C;  4N78 E;  3FIB A;  4W80 A;  1HBW A;  2OYH A;  2YKP A;  1NTZ K;  2JHL F;  5AW5 B;  1G2C A;  2QM7 A;  1FID A;  1SVF A;  2O1K A;  1JY2 P;  3TSI A;  3A2A A;  1LWU C;  3KDP B;  1LTJ A;  1MFZ A;  4HYT B;  3TYY A;  2HOD C;  4JF7 A;  4NYT A;  2XV5 A;  2WPQ A;  1SLQ A;  1FZE B;  4LGD E;  3RL0 D;  4ZKP A;  3RL0 B;  1FJP A;  3A7O A;  1NKN A;  1FJK A;  1M1J A;  1J2J B;  3L37 A;  1FZD A;  2WSE H;  1NH4 A;  2Z5I A;  1URQ C;  5AVV B;  1JCC A;  2HFE D;  1KFN A;  1N2D C;  2FXM A;  1RF0 A;  2P7J A;  4N6J A;  1N73 A;  2H43 B;  1IJD B;  4GKG A;  3A3Y B;  3V2Q A;  1GU5 A;  1LWU B;  1GL2 A;  1NAF A;  2GM4 A;  3BVH C;  1L4A A;  3EFG A;  2Z4E B;  2J0H A;  1IC2 A;  2J0G A;  3A5T A;  2BAS A;  1FZE C;  2W6B A;  3HE5 A;  2IFM A;  3TK1 A;  2Q9I C;  5AVQ B;  3RK2 D;  1JO5 A;  2A45 H;  5AVS B;  1HVV A;  1NHL A;  2NPS A;  5AW0 B;  2J61 B;  3O8Z A;  2E42 A;  1DH3 A;  1T2K D;  4M7H A;  5APU A;  3BRT B;  5CMZ A;  1KZU B;  3V4W A;  4LLH A;  1J1E B;  1FZA A;  5AW2 B;  1FAV A;  3BAT A;  2WNP F;  2HPC A;  1N7S D;  1HJB A;  2WPS A;  2H43 A;  3BVH B;  3EQ2 A;  3II6 A;  1FZC C;  2HLO B;  2Z4E C;  3UIA A;  1FZF A;  1SFC A;  2FKW B;  2VRS A;  2FFD C;  2WT7 A;  5CJ4 A;  3KQG A;  2D39 A;  2WT7 B;  1GTW A;  1URQ B;  3G3Z A;  1SFC D;  2FFD A;  5KTB A;  2N9B A;  2JHI F;  5APW A;  3RK2 C;  5AW9 B;  2HPC B;  1J1D B;  2W27 A;  1SFC C;  1FZA B;  1FZF C;  1FZC A;  2P1J A;  4C7N B;  2H43 C;  5AVZ B;  4IFF A;  2J3F A;  4Y99 C;  1CI6 B;  1XTG B;  5AVU B;  4B86 A;  2J64 A;  1RE4 C;  1XTC C;  1IO4 A;  1GL2 D;  2NPS C;  1SQB K;  3LID A;  3VOP A;  1N7S C;  4Y99 B;  3TNU B;  2FFD B;  5CCH D;  3SWY A;  3HE5 B;  1Z3S A;  2JEE A;  2Q9I A;  1Z56 A;  4M7F A;  3U59 A;  1SQV K;  5AVR B;  1WRG A;  1YTZ T;  1SFC B;  1CZQ A;  4I6M C;  3B5N C;  5AW7 B;  3BVH A;  1GL2 C;  1L0N K;  5AW8 B;  2NPS D;  3PP5 A;  3WMM 0;  3VMX A;  2H7H A;  2J61 A;  2POH A;  2O1J A;  3HD7 B;  1QL2 A;  1M1J B;  3P8M C;  2J3U A;  4N3Y B;  2M3B A;  5AVY B;  1X8Y A;  2KLV A;  3MD0 A;  4EPU A;  2YO2 A;  1GU4 A;  5BVZ A;  1X79 B;  4JYO X;  2HOD A;  1NWQ A;  1GL2 B;  1LWU A;  1CSB A;  3L4F A;  3T97 A;  2A45 G;  3NFQ A;  1JC9 A;  1JCD A;  3VP9 A;  1N7L A;  2H8P D;  3TNU A;  3SWF A;  2OYH C;  1RF0 B;  3C9I A;  4XA4 A;  1MZ9 A;  1JOC A;  1HGV A;  2J59 M;  3HTK B;  1LTA C;  4DZO A;  2FYZ A;  3HD7 A;  1T2K C;  4M3L A;  3B5N D;  1GW3 A;  1JTH B;  1FU1 A;  1LT9 C;  1MV8 A;  1URQ D;  2P2U A;  2J0Y A;  3BAS A;  3MGN A;  1N86 C;  1NTK K;  3B5N A;  3B8E B;  1DX7 A;  2O01 H;  2WPR A;  4I2L C;  2OAR A;  3N4X A;  5AW3 B;  3RK3 B;  1FOS E;  2C9L Y;  2YKO A;  1OXZ A;  1LTJ B;  2FIB A;  1IFJ A;  1FBM A;  1RF1 A;  1GK6 A;  1VPC A;  1JTH A;  4IFM A;  4WY4 B;  1ZN5 A;  1N7S A;  1RE3 A;  3U1C A;  5APV A;  2L5G B;  1RE4 A;  3U1A A;  2KYV A;  1FIB A;  2WSC H;  4WBA A;  1N86 B;  1CW5 A;  1IK9 A;  2HOD B;  1JY2 N;  3IFM A;  4EIJ A;  1ZV8 A;  5KLV K;  3RK3 C;  4C7R A;  1DEB A;  4OH8 B;  1LTS C;  2R32 A;  2J1G A;  2JHK F;  1L0L K;  2I1K A;  3IR9 A;  2J3G A;  5CJ0 A;  3BRV B;  3M91 A;  1L4A D;  2C0W A;  4O9B A;  1T3J A;  3VN0 A;  2Q5U A;  1SQX K;  2Z4E A;  3M06 A;  1HTL C;  2XU6 A;  1GK4 A;  2HYN A;  2HPC C;  2IPP A;  4DOJ A;  1FZA C;  1FZF B;  1ZR4 A;  5APS A;  1SQQ K;  3GHG B;  2J3O A;  1HH0 A;  3M9B A;  3VMY A;  1H88 A;  1NTM K;  5APY A;  3NMD A;  2YNY A;  1A02 J;  1GD2 E;  2XDJ A;  3VP8 A;  2W6A A;  2XNX C;  1E5W A;  1SP4 A;  1NOH A;  2P67 A;  3RK3 D;  3H32 A;  1KIL B;  2N1T A;  1S9K D;  1KQL A;  4WY4 C;  4AUW A;  3N7N A;  1FZE A;  1KIL C;  1MUU A;  2YKQ A;  1L4A C;  1NO4 A;  2A45 I;  5AW4 B;  3B5N B;  4XE5 B;  1ZR2 A;  3M0A A;  2JHM F;  2GUV A;  2C9N Y;  1T3U A;  2MJZ A;  1N73 C;  2WWW A;  4JYC A;  5KJ7 C;  1RF0 C;  2OYH B;  3VMZ A;  1WT6 A;  2FYU K;  5AVT B;  3L35 A;  3V5B A;  1URQ A;  4R9J A;  3HE4 B;  2XNX B;  1M1J C;  1AQ5 A;  2KSJ A;  2CPB A;  3OAK A;  3LW5 H;  1FIC A;  1X9V A;  2WZ7 A;  5AW6 B;  4GIF A;  1Z3U A;  4N78 D;  4JZC A;  3P32 A;  1LTG C;  4WY4 D;  2M8R A;  4W7Z A;  2YMY A;  1LTJ C;  5KJ7 D;  3HD7 D;  5CHX A;  3VTP C;  1LTT C;  3M9H A;  2QM8 A;  2J58 A;  2N1T B;  1JUN A;  3M0D C;  3MTU E;  2NPS B;  2JHH C;  1S9K E;  2YO3 A;  3OJA B;  4ZKU A;  3CL3 D;  3HTK A;  3NXS A;  3V2P A;  3HUS B;  1VDF A;  5APX A;  3M0D A;  1YTZ I;  1LT9 B;  2JJL A;  1FZB B;  3GHG A;  3E1I A;  3CLQ A;  1FZG B;  1GDT A;  1HGZ A;  1FZG A;  3NTN A;  1ZLL A;  4JYB A;  2Q7C A;  2C0X A;  1N73 B;  5CCG D;  1LTB C;  4C46 A;  1T8Z A;  1FOS F;  1LTI C;  2GY7 A;  5APQ A;  3P8C D;  3KYQ A;  5CCG A;  3HUS C;  1OWA A;  5CCH A;  5KJ7 A;  1H89 A;  1CI6 A;  2OYI A;  4IFD K;  1QL1 A;  1FZB C;  1IFD A;  1FZC B;  2HLO C;  1SQP K;  2IX7 C;  4W7Y A;  1JY3 P;  1HUC A;  2LKM A;  2J2P A;  1KFM A;  5BU8 B;  1A02 F;  2WSF H;  1JY3 N;  2HG5 D;  5BU5 A;  2IFN A;  3CI9 A;  1FDM A;  2CPS A;  4EOT A;  1KIL A;  4HH2 A;  3RL0 C;  2KOG A;  4WY4 A;  3OA7 A;  2N1T C;  5AW1 B;  3V2N A;  4AQR D;  3H32 C;  2XNX A;  3HE4 A;  3VYI A;  3MUD A;  1G1I A;  1JY2 O;  2ZFC A;  2J3F D;  1W2E A;  2KP8 A;  2PAJ A;  3H6P A;  1HWT C;  3L36 A;  2OYI B;  1J1E C;  2Q3I A;  2E43 A;  2XKM A;  4C7N A;  4I1L A;  1NKZ B;  1EQ7 A;  5AVW B;  1JMM A;  1RY3 A;  3P8C E;  4GT1 A;  3H32 B;  1AFO A;  4ZFG A;  2I1J A;  1M7L A;  3LIE A;  1IFI A;  3V4Q A;  1J1D C;  2WTY A;  1JY3 O;  3HRN A;  4WB4 A;  3V2R A;  3E1I B;  2ZXE B;  2HLO A;  1KIL D;  3P7K A;  1FZB A;  2OYI C;  2R5B A;  2N1T D;  1RE4 B;  3M9Q A;  5AVX B;  5CCH C;  3HUS A;  1RE3 B;  2KB7 P;  5CCG C;  2J60 A;  2PP6 A;  1N7S B;  1JNM A;  1IFN A;  1RE3 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...