1LTJB

Crystal structure of recombinant human fibrinogen fragment d with the peptide ligands gly-pro-arg-pro-amide and gly-his-arg-pro-amide
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
298
structure length
298
Chain Sequence
IPTNLRVLRSILENLRSKIQKLESDVSAQMEYCRTPCTVSCNIPVVSGKECEEIIRKGGETSEMYLIQPDSSVKPYRVYCDMNTENGGWTVIQNRQDGSVDFGRKWDPYKQGFGNVATNTDGKNYCGLPGEYWLGNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGGFTVQNEANKYQISVNKYRGTAGNALMDGASQLMGENRTMTIHNGMFFSTYDRDNDGWLTSDPRKQCSKEDGGGWWYNRCHAANPNGRYYWGGQYTWDMAKHGTDDGVVWMNWKGSWYSMRKMSMKIRPFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibrinogen alpha/alpha-E chain
publication title 2.8 A Crystal Structures of Recombinant Fibrinogen Fragment D with and without Two Peptide Ligands: GHRP Binding to the "b" Site Disrupts Its Nearby Calcium-binding Site.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
total genus 91
structure length 298
sequence length 298
chains with identical sequence E
ec nomenclature
pdb deposition date 2002-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1ltjB03
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 1ltjB01
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 1ltjB02
2H43B 2OYIA 1LTJC 3BVHC 2D39A 2H43C 1RE4A 2J1GA 1FZDA 3GHGA 2J3FD 2HODB 1RE3B 1JY2P 1FIDA 2OYHB 4EPUA 2J3GA 3H32A 2HPCA 1RF1B 1LWUA 1RE3C 1LT9A 1M1JA 1FZCA 2J61B 3BVHB 2JHIF 3FIBA 1FZGB 2JHLF 1RF1C 1FZFB 1N73B 2JHKF 2OYIB 1RF0A 3E1IA 1JY3P 1N86A 1JY2N 1FZAC 2XNXA 2Z4EA 1FZGC 1FZBC 1FZFC 1N73C 2OYIC 1RE4B 3GHGB 1FICA 2J3OA 4NYTA 1RE4C 3GHGC 2GY7A 2J0HA 4JYOX 1JY3N 2Q9IA 2HPCB 3H32B 1LWUB 1M1JB 1FZCB 1FZAB 1FZBB 3HUSA 2JHMF 1JC9A 3H32C 2J2PA 2HPCC 1FZEA 1LWUC 2A45H 2FFDA 1RF0B 3E1IB 1LT9C 1M1JC 1FZCC 1N86B 2J60A 2HODA 2XNXB 2Z4EB 2J3UA 2OYHA 1FIBA 2HLOA 1RF0C 3E1IC 1LTJA 4M7HA 1N86C 2J5ZA 2XNXC 2Z4EC 3BVHA 4JZCA 2H43A 2J0YA 2A45G 2A45I 1T3UA 4ZFGA 2Q9IB 1LT9B 2WNPF 2J64A 3HUSB 4R9JA 2Q9IC 1FZEB 1JY2O 2FFDB 1RE3A 1Z3SA 3HUSC 2JHHC 1W2EA 1FZBA 2HLOB 1FZEC 1RF1A 2FFDC 1LTJB 2J3FA 1Z3UA 2J61A 2HODC 4R9TA 1FZAA 2OYHC 2J0GA 1FZGA 4M7FA 2HLOC 2FIBA 1JY3O 1FZFA 1N73A
chains in the Genus database with same CATH superfamily
2H43B 4N6JA 2YKOA 1JCCA 2FY8A 4UB8E 4YTPC 1PP9D 2KZIA 3Q1MA 1T8ZA 2HG5D 4EPUA 4XA4A 2J3GA 3KHUA 1SQPK 1KQSO 2RKLA 1Q82Q 1RE3C 1M1JA 1USDA 4U3FJ 1SFCC 5BVZA 2N1TC 1KB9I 1JY2N 1EDIA 1FZFC 3H1LG 1FC2C 4PD4E 1N2DC 4PV1B 2M5AB 1HWTC 3MGNA 2P1JA 2E5YA 1RHZB 1SFCB 3H1KJ 3CPWO 3P8MC 1QEXA 2K1AA 1LWUC 2ZJSE 3M0DC 4R4LA 2KNCB 1HJBA 2HODA 1KZUB 1URQC 4OVNF 4PD4D 3C8VA 3E1IC 1SQVD 3BVHA 1QVFO 1GL2A 1L0NK 1M56D 2Q1KA 4BRYA 4L76A 1NTKJ 4QMAA 3TNUA 3SWYA 3HD7B 2D2CC 1R8EA 2O3JA 3S9OA 1FJPA 3Q2YA 1ZLLA 1SP4A 2E75D 1RY3A 1J2JB 1KYOH 4EIJA 3E1RA 3H1IE 2OYHC 1FZGA 1S5LX 3S1KA 1BDCA 1Y47A 3PJSK 4BXLA 3RL0D 2OYHB 1L4AA 1PP9G 2WWWA 3H1ID 1HH0A 1SLQA 3FIBA 3CCLP 1VQMP 3M9HA 4I7ZC 1LJ2A 2QIWA 1VQLP 1H0TB 1Z56A 5KTBA 1SVFA 2QM7A 5CBNA 1L4AD 1WMKA 5CCGC 3V5BA 1SQPE 1SQXE 3CX5I 4HJGH 3GHGC 3WUVA 3H32B 1BGYE 1LTIC 3BRVB 3HUSA 2J2PA 2QRXA 4DZOA 2FFDA 2JR8A 3L72E 2J3UA 3AE3C 1IFJA 1M1KQ 1SQPD 2POHA 1SQXD 2B88A 4Y99C 1N7LA 5AW1B 1N7SA 1EDLA 1T3UA 3CWBJ 1R5LA 1SQVG 3AEEC 3ITKA 4LC1A 3M06A 3D70A 4JYBA 2Q9IC 4AUWA 1OVVA 3V2PA 1N7SD 2WSEJ 1L0NE 2FYNB 5AW6B 3M9BA 1FZAA 5APWA 1JY3O 3HRNA 3A5TA 2AXTE 3GG2A 3D71A 2UWJE 5L8RJ 3GW6A 1NTMG 2H8PD 3L71J 1JY2P 3L74G 2W6BA 1L2PA 3H1HE 1L0ND 3HE4A 1LT9A 3MIWA 2FYZA 3CCVP 1RF1C 4HKZH 1SQBJ 1NU1J 5C39A 3KZIH 3VMYA 2Q3EA 1N73C 2OYIC 2IFMA 5AVTB 2PFXA 4OGQD 3H1HD 3JCUE 4YXWH 3CCMP 3JSVC 2FYUJ 2WT7B 1YI2P 1JNMA 1FOSF 1GDTA 1N86B 2Z4EB 4KHXA 1FIBA 5GTHH 2JJLA 1K9MQ 1FDIA 1BE3J 3CXHI 2J5ZA 3FGAD 2R32A 5B66E 5KJ7C 3CCRP 2WSSH 1EZVI 2B89A 1DD3A 4GKGA 1QL2A 3BCCJ 1PGOA 3SFEC 1RE3A 1YTZT 3B5NC 1SFCA 4JPZB 2N1TA 2WPVB 2J0GA 5KAFH 4NPDA 1FZFA 4IL6X 3SFDC 1YYCA 1SFCD 2ZYDA 3NXSA 2B87A 2N1TD 4IFDK 2KSEA 1LWUA 4CPGA 3M0DA 5APYA 1NKNA 1URQA 2KXPB 1VQNP 3E1IA 1VDFA 3CC2P 4ZMDA 4U3FE 5KLVK 1URQD 1D7MA 3HD7D 2ZVOB 3L36A 2K9JB 4YXDC 4H44C 4UB6H 2OARA 1S72P 4Y28J 3H1KE 1NHLA 2OYHA 5CCHC 3GF7A 1AJYA 1JUNA 2CPSA 1KILB 2I8DA 2WSFH 3WU2H 2I1KA 1P84H 2IX7C 3FWNA 1H0TA 5APXA 4A7PA 3CCUP 3KXDA 2KLVA 2A06E 3H1KD 2Y9ZA 3E7KA 2SPZA 2XU6A 5GTHE 1NTKE 2HLOB 2QJPB 4L73A 1AQTA 1ZRTD 1FAVA 3PP5A 1L0LG 2E74B 2R44A 1KN7A 3L70J 5CCGA 4H13C 1KYOI 2J59M 2A06D 1GZLA 2RMZA 3O6QA 3GHGA 3PHLA 1Y9BA 1NTKD 3ABVC 1JCDA 5CCGD 5KAFE 1SQBK 1X0TA 4H13B 2FKWB 3RK2B 4H0LB 2K9YA 1LGHB 3P32A 2JHKF 5AVUB 1ZXGA 3CCJP 3M9QA 3A0BH 1VQ7P 1HBWA 1ZR2A 2BCCE 2AEJA 4NYTA 2FYUK 1RE4C 2XV5A 1JY3N 2Q9IA 2HPCB 1PPJE 1GMJA 1JTHB 2YO2A 1FE6A 2IBZE 1AV1A 2W6JH 2C0XA 2BCCD 1X8YA 1MKMA 2XNXC 3O8ZA 1YTZI 3LIEA 3RK3B 4IFMA 1CI6B 3CX5E 2V4HA 2PGDA 3A0HE 2WNPF 1PPJD 2ZAEB 3EQ2A 3KDPB 1FZEB 5GTIH 3CL3D 1ZR4A 3CWBE 5KLVD 5KAIH 1H8AA 1RF1A 1GW4A 3CCQP 2FIBA 1BCCD 1N73A 2OYIA 3CX5D 1X9VA 1KQFB 1EC5A 2H43C 1EQ7A 5E79E 5AVQB 1SQQJ 3CC7P 3CWBD 1U57A 4I6MC 4EDFA 3L73J 2G3AA 3L75G 1EXIA 3UIAA 3II6A 4EOTA 1YIJP 2VRSA 2E76C 1IJDB 2K88A 1IK9A 1NKZB 1YQ4C 1Q81Q 1S5LH 4WWIA 5KJ7A 1SQBE 3VP8A 3KPEA 4K35A 5AVYB 1GW3A 1X79B 1SQXK 4PV1C 1OFCX 4RO0A 3AEBC 2E76B 3VTPC 1FDOA 1UIXA 3V6IA 1NAYA 2WPRA 3B5NA 3A0BE 1NTZJ 5KJ7D 4D6TJ 3VP9A 1WT6A 1ZP0C 1U7MA 2FYUE 1VQKP 5B5EE 1YITP 1MFTA 1SQBD 2M3BA 4JF7A 1OWAA 1QGKB 3B5ND 2B9BA 2A45G 3TGUG 1NVOA 3HE5A 1BE3E 2BCCG 5CJ4A 1NAFA 3LW5J 1NOHA 1E79H 4XFJA 1OW8A 2FYUD 3HD7C 3H25A 3A3YB 1LT1A 3BCCE 2GA1A 3F5HA 2JEEA 3L35A 3I56P 1LTJB 3H1JG 2NRGA 4LLHA 2ZYGA 1JO5A 3CXHE 5KLVG 2Z5HA 1BE3D 4DOJA 5APUA 1KILE 4JYCA 5GTIE 4O9BA 1PGJA 3Q3DA 1EZVE 1BCCG 2FXMA 2O1KA 3VMXA 3KYQA 5H2FE 3BCCD 1K04A 2J61B 3WUUA 4U7JA 3CXHD 5CCHA 3B8EB 3F89A 4YPCA 3QWOC 1JY3P 5APQA 4H44D 1EZVD 1G2CB 2PRRA 2N9YB 1W5CE 5CCHD 1GU4A 1S3JA 4JYOX 1USEA 2JP3A 2IDBA 3IR9A 3L4FA 2IBZI 1VQ8P 3H32C 5CMZA 2J60A 2R5DA 3H1LJ 1OIPA 5K5GB 3P8CE 2QE7H 3MTUE 3V4QA 1ZW0A 3V2RA 2QSIA 1FS0E 2YMKA 2KOGA 1KC8Q 1T2KC 2WPSA 1A02F 4H13D 3EFFK 4H0LD 3C9IA 1RQVA 2Q3IA 2J3FA 4JBZA 3AEGC 3I5CA 1BGYD 2FYNC 1AQ5A 1OVRA 1N8RQ 1SQQK 3AE9C 1JMBA 1PGQA 2KZJA 2BASA 1RE4A 2J1GA 2WSFJ 2J3FD 3L72D 3WUTA 4C7NA 5AVWB 2CK3H 4IFFA 3G71P 2LXCB 4DJGA 1IK7A 1Y8AA 2OYOA 2J5UA 2P58A 1PL5A 2XNXA 2P67A 3CD6P 4WY4C 3U59A 2M3EA 4IL6H 3TK1A 1KYOE 1ZMEC 3NTNA 1PP9J 3NFQA 2GY7A 3R2PA 2IYOA 4LGDE 1FZCB 4WY4B 4XE5B 2JHMF 2KS1B 1LTBC 1FOSE 1RF0B 2FXOA 5BU8B 3H1IG 1NJIQ 1KYOD 1BDDA 1VQOP 3FWLA 1N86C 3LW5H 4OH8B 2Z4EC 1JMMA 1U7JA 4W7ZA 2H43A 1MZ9A 1AVOA 1QL1A 5TISH 2W6AA 1S2EA 2Y0DA 4W80A 2P7JA 2XDJA 5AW7B 1KB9H 1S1CX 1Z3SA 1UIIA 2E5TA 4C7RA 1NH4A 2Y0CA 1NTKK 5CJ0A 1QLED 1SQVJ 1SQPG 2E42A 3HTKB 1SQXG 3MP7B 2ZFCA 2YXQB 4PJ0H 1IFPA 2AXCA 2M5AA 2E76D 1GU5A 1BGYG 2KUBA 1BSNA 3BASA 3P7KA 1SQQE 4MN4C 5AVSB 3L72G 4PV1D 1AA0A 2Y0EA 2M8RA 4TLFA 2KNCA 1KV4A 3L73E 1LP1B 1NO4A 2R3CA 1NTMJ 3ZDMA 1IFNA 1Q2NA 3L74J 1SQQD 2W90A 1M1JB 1OX3A 3G9RA 2ZYAA 3HD7A 1K05A 2V7QJ 1KMIZ 3PLNA 4DT0A 2A45H 2ZXXA 3L73D 1L0NG 2I1JA 4AYCA 2KP8A 1NTZE 1VQPP 3MD0A 1A02J 2J0YA 3SWKA 5KKZB 4ZFGA 1KILC 2L5GB 1KQLA 1RH5B 3KZIE 1GL2C 1XTGB 4R9JA 3H1HG 2WSCJ 2OQQA 1FU1A 4U3FD 1YJNP 1VQ5P 1HUCA 3PTZA 1NTZD 2KSJA 3VMAA 3AE6C 2YIUC 2NPSC 2HLOC 2E75B 5TISE 2C0WA 1GL2B 2QJPC 2KLUA 2QJKB 1CSBA 2JO1A 2QJYC 1VQ6P 4NPEA 2E74C 2CPBA 3TNUB 3G4SP 1CZQA 2H89C 3RBXA 2YIUB 4GOFA 1FJKA 2NPSB 2L91A 2P2UA 3H32A 3A2AA 1DIPA 2R3SA 2YMYA 2QJYB 1FZGB 4GOEA 5CBOA 3RK2C 2KIKA 4H0LC 2FBWC 3OW2O 2IPPA 3AECC 1JEKA 1W2BO 2KI7B 2H7HA 1L4AB 4L74A 1NU1K 1PV3A 2J58A 2Q7CA 1GK4A 4B86A 1PGPA 3VYIA 3CMAP 2HPCC 2YNYA 3B71A 3PRJA 5BU5A 1G1JA 3AEDC 1T2KD 3M0AA 1YJ9P 1JM0A 1Q90D 2FXPA 3H1LE 1DEEG 3AEAC 2HFED 2WQYC 2HR3A 5M1BA 3RK3C 3HUSB 2WITA 2FFDB 4PD4H 1FZEC 1FDMA 4C46A 4EI2A 3PH0A 2OTJP 3H1LD 3FXDA 4WY4A 4U3FG 1KD1Q 3FX0A 4UB6E 2XNDH 1M8OB 1K8AQ 2ITAA 4KJMA 2YKPA 2IBZD 1FIDA 3WMM0 4WY4D 5AW0B 4KT0J 3WU2E 1OXZA 1P84E 3H1KG 1L0LJ 1NTMK 2WT7A 3BATA 4Z1MH 2JHLF 2XZRA 1N86A 1HGZA 2Z4EA 4GDOA 3RBZA 2IFNA 4TT3H 3CCEP 1IZNB 3USSA 2V7QH 1H88A 1IFMA 1M7LA 1LTGC 3AEFC 1H89A 2A06G 1P84D 3L71E 2W27A 4RJTA 2DW3A 1NTKG 4OGQB 4RESB 5KLIC 1G1IA 2LXBA 4WB4A 1NU1E 3K5BA 2MJZA 2MKVA 2WSCH 1EDKA 3L71D 1OMIA 1LP1A 1YJWP 5KLIB 3B4SA 1PFIA 2YO3A 5CHXA 4R4MA 2WTYA 3Q5RA 4L75A 5AVXB 2ZVNB 4WBAA 1KQGB 3CLQA 4ZNCA 1NU1D 3TDKA 1HTLC 1K73Q 1LTAC 3G3ZA 1LTJC 3NMDA 2W8ZA 1SQVE 3D6YA 1RE3B 1OZHA 1ZOYC 2KB7P 4RKUJ 1PPJG 1OW6A 1ZN5A 2M0BA 3GMAA 2N1TB 2K9JA 3AE1C 4HYTB 1LNQA 2IBZG 2WPQA 1FZFB 5DJUB 1HF9A 1IFDA 2O01N 2NZ2A 3EFGA 1FZBC 2WZ7A 3U1CA 5AW4B 2B87B 5KAIE 1FICA 2J3OA 1KILA 1YHQP 4I1LA 1NTME 3L75J 2Y9YA 1LWUB 3L74E 3CWBG 2AXTH 1FZBB 1URQB 2PAJA 3E1IB 1KILD 3MUDC 5DJTB 2NPSA 4GIFA 3RL0g 2HLOA 1GL2D 2GUVA 1NTMD 2Q5UA 2A45I 3W67A 2D2CB 2NPSD 3L74D 1RQUA 3W68A 2J64A 2O01H 2C9LY 2KYVA 2AEFA 1S5LE 2E74D 3L71G 1W2EA 5AW8B 2O1JA 1PZQA 3Q5PA 3TGUJ 3JCUH 2XKMA 2BCCJ 2K3RA 4I2LC 5AVRB 2Q6QA 1M90Q 1SQBG 5APTA 1NU1G 1LTTC 1PIXA 3RK2D 1L0LK 1OVUA 1P84I 3H1JJ 3I55P 2ZT9C 2HPCA 4I7ZB 3P8CD 1TU3F 5B66H 1KFMA 5KLVJ 1JTHA 2FYUG 3RK3E 1BCCJ 1SS1A 2ZT9B 3L70E 3O6QB 3GHGB 3V2NA 3IFMA 3GLMA 1BE3G 1CI6A 1NYHA 2JWDA 3N7NA 2IZ0A 5AW2B 1XTCC 3VMZA 1JC9A 1FZEA 4IOIH 3BCCG 1FZCC 4Y99B 1IC2A 4BWNA 1IO4A 3RK3D 2WMMA 3L70D 1RF0C 2HYNA 2JWAA 2RH0A 1DX7A 1DEBA 3RGUA 4JZCA 1NTZK 2C9NY 1S4XA 2Q9IB 1EZVG 2JKVA 4N3YB 4K3AA 3VN0A 3OAKA 1BSHA 1LTSC 4N78E 1VF5C 1HVVA 3A7OA 3CI9A 3H6PA 2QM8A 4W7YA 3AE7C 4WVZA 1R5SA 3BRTB 4PD4I 3T97B 1VF5B 1M57D 4ASWA 2K37A 1T6AA 4OWFA 3SSUA 4N78D 2AEMA 5AW3B 1Q7YQ 1RF1B 1J1DC 1VQ9P 3N4XA 2YXRB 4JQ0D 5APSA 2GUSA 1JOCA 1N73B 2OYIB 4EYYQ 1L0LE 3CMEP 3OA7A 5AW9B 2QA4P 3IAOA 1OW7A 1J1DB 3CCSP 1HGVA 5AVZB 2RN0A 1M1JC 4ZKPA 1L0LD 5EFWB 3M91A 1LTJA 4M7HA 2W83C 1IFIA 3U1AA 3L70G 1MV8A 3B5NB 5KKZC 1JY2O 4IL6E 3H1IJ 3TYYA 3KQGA 2JHHC 1X22A 4D6TE 1Q86Q 1ZV8A 2J61A 2HODC 4HB1A 2IYPA 2WVRA 1FZBA 3EWKA 3GF3A 2R5BA 3BVHC 3HE5B 4AQRD 2E75C 4M3LA 1G2CA 2QJKC 1KORA 5TJHA 3S4RA 5AVVB 2G8YA 2HODB 2ZXEB 4D6TD 2JDIH 3MUDA 3BVHB 2JHIF 3CX5H 3A0HH 1SQPJ 1KTMA 1SQXJ 1NGMB 4BRYB 3RL0C 1FZGC 1BGYJ 1KB9E 2D2CD 1MFZA 1ZRTE 3SWFA 3L37A 1HJ0A 4H44B 3AE2C 2J0HA 3C1LA 3L72J 3RL0B 1VPCA 1MUUA 2WSEH 1L4AC 3L75E 4PJ0E 1GD2E 5E79H 2OGUA 1KB9D 3V4WA 1GTWA 2QG4A 1EXJA 4GODA 3AE8C 3JC22 1DH3A 2QEXP 1YQ3C 3Q5SA 2PP6A 3V2QA 3L75D 1L0NJ 4UB8H 3LIDA 3CC4P 1SQQG 3HUSC 2BEQD 2IZ1A 2FFDC 1Z3UA 1J1EC 3L73G 4M7FA 3QH9A 2ZT9D 2Z5IA 1T3JA 1VL2A 4ZKUA 3MHVA 4ASVA 2LR2A 2D39A 3TGUE 3MZWB 3H1HJ 1NWQA 1N7SC 1FZDA 1AVYA 1AFOA 1J1EB 5B5EH 2OTKE 3OJAB 1SQVK 4GT1A 1FZCA 1DD4A 2O01J 2KK7A 2KS1A 2BEZF 1EDJA 3H1JE 1N7SB 1RF0A 1FZAC 1NTZG 4D6TG 3TGUD 2P10A 5KLVE 1RE4B 3AE4C 4C7NB 1S9KE 1VQ4P 2E43A 4DCKA 2YKQA 1BCCE 1E5WA 1WRGA 3R4YA 2N9BA 3CXHH 3T97A 1FZAB 3H1JD 5APVA 1LT9C 3AE5C 1CW5A 1JB0J 1GK6A 2XNXB 3TSIA 1KFNA 4NPFX 4OGQC 2OTLP 1QX8A 1S9KD 1VF5D 5H2FH 4HH2A 3G6EP 1YBKA 2LKMA 3D6ZA 1FBMA 3FXEA 5AW5B 3HE4B 3HTKA 1LT9B 1PP9E 1QVGO 3VOPA 2QVAA 2H88C 3IF4A 3TF5A 2GM4A 4R9TA 3IN6A
chains in the Genus database with same CATH topology
2XKMA 2H43B 4I2LC 2YKOA 4N6JA 5CCGA 5AVRB 1JCCA 2E42A 3HTKB 2ZFCA 2J59M 5APTA 1GZLA 1LTTC 3GHGA 1T8ZA 3RK2D 1GU5A 1L0LK 1JCDA 2HG5D 4XA4A 4EPUA 2J3GA 5CCGD 3BASA 1SQPK 2HPCA 3P7KA 1SQBK 3P8CD 1RE3C 1M1JA 2FKWB 5AVSB 3RK2B 1KFMA 1SFCC 1JTHA 2JHKF 1LGHB 3P32A 2N1TC 5AVUB 2M8RA 5BVZA 1JY2N 1NO4A 3M9QA 2R3CA 1HBWA 1IFNA 1FZFC 1ZR2A 3GHGB 1N2DC 1HWTC 3V2NA 3MGNA 4NYTA 2P1JA 3IFMA 2FYUK 1RE4C 1SFCB 2XV5A 1CI6A 3N7NA 1JY3N 2Q9IA 2HPCB 5AW2B 3P8MC 1M1JB 1XTCC 3HD7A 3VMZA 1JC9A 1JTHB 1FZEA 1LWUC 2A45H 3M0DC 1FZCC 4Y99B 1HJBA 2I1JA 2HODA 2YO2A 1IC2A 1KZUB 1IO4A 3RK3D 1URQC 4AYCA 2C0XA 2KP8A 1X8YA 1RF0C 2HYNA 3E1IC 2XNXC 3O8ZA 3BVHA 1DX7A 1DEBA 1YTZI 3MD0A 4JZCA 1A02J 3LIEA 2J0YA 3RK3B 1GL2A 1L0NK 1CI6B 1NTZK 4IFMA 2C9NY 4ZFGA 2Q9IB 1KILC 2L5GB 2WNPF 1KQLA 4N3YB 3TNUA 3SWYA 3HD7B 1GL2C 1XTGB 3EQ2A 3VN0A 3KDPB 3OAKA 1FZEB 4R9JA 3CL3D 1ZR4A 1FJPA 1LTSC 1ZLLA 1SP4A 4N78E 1FU1A 1RY3A 1J2JB 1HVVA 1H8AA 3A7OA 4EIJA 1RF1A 3CI9A 1HUCA 2KSJA 3H6PA 1GW4A 2QM8A 2NPSC 4W7YA 2OYHC 1FZGA 2HLOC 2FIBA 1N73A 2OYIA 3BRTB 2C0WA 1GL2B 1X9VA 1CSBA 2H43C 2CPBA 3TNUB 1EQ7A 1CZQA 5AVQB 4N78D 3RL0D 1FJKA 2NPSB 2OYHB 4I6MC 5AW3B 2P2UA 1L4AA 3H32A 1RF1B 1J1DC 3A2AA 2WWWA 1HH0A 3UIAA 3N4XA 2YMYA 5APSA 2GUSA 1SLQA 3FIBA 3II6A 1FZGB 4EOTA 3M9HA 1JOCA 1N73B 2OYIB 2VRSA 3RK2C 1IJDB 1Z56A 5KTBA 1SVFA 2QM7A 3OA7A 1L4AD 1IK9A 1NKZB 5AW9B 5CCGC 3V5BA 1J1DB 5KJ7A 1HGVA 3VP8A 3KPEA 2IPPA 5AVYB 1GW3A 1X79B 3GHGC 1SQXK 5AVZB 2H7HA 1L4AB 3H32B 1LTIC 1NU1K 3BRVB 3VTPC 2J58A 2Q7CA 1GK4A 3HUSA 3VYIA 2WPRA 4B86A 3B5NA 2J2PA 2HPCC 2YNYA 5KJ7D 4DZOA 2FFDA 1M1JC 4ZKPA 5BU5A 3VP9A 2J3UA 1G1JA 1WT6A 1IFJA 3M0AA 1T2KD 3M91A 2POHA 1LTJA 4M7HA 4Y99C 2M3BA 1IFIA 4JF7A 1N7LA 1OWAA 3B5ND 2A45G 3U1AA 5AW1B 1N7SA 1T3UA 2HFED 3HE5A 5CJ4A 1NAFA 1NOHA 3RK3C 1MV8A 4LC1A 3HUSB 3M06A 3B5NB 2Q9IC 4JYBA 2WITA 4AUWA 1JY2O 2FFDB 3TYYA 3KQGA 2JHHC 3HD7C 3V2PA 1N7SD 1FDMA 1FZEC 4C46A 3A3YB 2JEEA 3L35A 1LTJB 1ZV8A 2J61A 2HODC 5AW6B 3M9BA 1FZAA 4LLHA 5APWA 1JO5A 1JY3O 1FZBA 4WY4A 3HRNA 3A5TA 2Z5HA 2R5BA 4DOJA 3BVHC 5APUA 3HE5B 4AQRD 4JYCA 4O9BA 4M3LA 1G2CA 2H8PD 2YKPA 5AVVB 2FXMA 2O1KA 2HODB 3VMXA 1JY2P 3KYQA 3WMM0 4WY4D 5AW0B 1FIDA 2W6BA 2ZXEB 3HE4A 1OXZA 1LT9A 2J61B 3MIWA 3MUDA 3BVHB 2JHIF 1NTMK 2FYZA 2WT7A 3BATA 5CCHA 2JHLF 3B8EB 1RF1C 2XZRA 1JY3P 1N86A 1HGZA 2Z4EA 5APQA 3RL0C 3VMYA 1FZGC 1N73C 2OYIC 1G2CB 2IFNA 2IFMA 5AVTB 1MFZA 5CCHD 3L37A 3SWFA 1H88A 1GU4A 1IFMA 1M7LA 1LTGC 2J0HA 4JYOX 1H89A 2W27A 3IR9A 3L4FA 3RL0B 1VPCA 2WT7B 1MUUA 2WSEH 1L4AC 3H32C 5CMZA 1JNMA 1FOSF 1GDTA 1N86B 2J60A 4RESB 2R5DA 1GD2E 2Z4EB 4KHXA 1FIBA 1G1IA 3V4WA 4WB4A 2JJLA 1GTWA 2J5ZA 3P8CE 3MTUE 2R32A 3V4QA 2MJZA 2WSCH 5KJ7C 3V2RA 4GKGA 2KOGA 1DH3A 1QL2A 2PP6A 1PFIA 3V2QA 2YO3A 1T2KC 5CHXA 2WPSA 1A02F 3LIDA 2WTYA 1RE3A 1YTZT 5AVXB 4WBAA 3C9IA 3HUSC 2Q3IA 3B5NC 1SFCA 3CLQA 2FFDC 2N1TA 2J3FA 1Z3UA 1J1EC 2J0GA 1HTLC 4M7FA 3I5CA 1FZFA 1LTAC 2Z5IA 3G3ZA 1AQ5A 1LTJC 3NMDA 1T3JA 1SQQK 1YYCA 4ZKUA 2D39A 1SFCD 2BASA 3NXSA 1RE4A 1NWQA 2N1TD 1N7SC 1FZDA 2J1GA 2J3FD 4C7NA 5AVWB 1AFOA 4IFDK 1J1EB 1RE3B 4IFFA 2KB7P 3OJAB 1ZN5A 1LWUA 1SQVK 2N1TB 3M0DA 5APYA 1NKNA 4GT1A 4HYTB 1FZCA 1URQA 2WPQA 1FZFB 1N7SB 1RF0A 3E1IA 1VDFA 1FZAC 1IFDA 2XNXA 2P67A 3EFGA 4WY4C 1FZBC 3U59A 2WZ7A 3U1CA 5AW4B 3TK1A 1RE4B 4C7NB 1FICA 1S9KE 2J3OA 3NTNA 1KILA 2E43A 5KLVK 1URQD 4I1LA 3HD7D 2YKQA 3NFQA 2GY7A 1E5WA 1WRGA 1LWUB 3R2PA 2N9BA 4LGDE 3L36A 3T97A 1FZCB 1FZAB 4WY4B 1FZBB 4XE5B 1URQB 2OARA 2JHMF 2PAJA 1LTBC 5APVA 1FOSE 1RF0B 3E1IB 1LT9C 1KILD 1CW5A 2NPSA 1NHLA 4GIFA 1GK6A 2XNXB 2OYHA 5BU8B 5CCHC 2HLOA 1KFNA 3TSIA 1GL2D 2GUVA 1JUNA 1N86C 3LW5H 4OH8B 1S9KD 2CPSA 2Z4EC 1JMMA 4HH2A 1KILB 4W7ZA 2Q5UA 2WSFH 2I1KA 2H43A 2LKMA 2A45I 1MZ9A 2IX7C 1FBMA 1QL1A 5AW5B 3HE4B 2NPSD 2W6AA 3HTKA 1LT9B 5APXA 4W80A 2P7JA 2J64A 2KLVA 3VOPA 2O01H 2XU6A 2XDJA 2C9LY 2KYVA 5AW7B 1Z3SA 1W2EA 4C7RA 2HLOB 5AW8B 1NH4A 2O1JA 2GM4A 1FAVA 3PP5A 1NTKK 4R9TA 5CJ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H43 B;  2OYI A;  1LTJ C;  3BVH C;  2D39 A;  2H43 C;  1RE4 A;  2J1G A;  1FZD A;  3GHG A;  2J3F D;  2HOD B;  1RE3 B;  1JY2 P;  1FID A;  2OYH B;  4EPU A;  2J3G A;  3H32 A;  2HPC A;  1RF1 B;  1LWU A;  1RE3 C;  1LT9 A;  1M1J A;  1FZC A;  2J61 B;  3BVH B;  2JHI F;  3FIB A;  1FZG B;  2JHL F;  1RF1 C;  1FZF B;  1N73 B;  2JHK F;  2OYI B;  1RF0 A;  3E1I A;  1JY3 P;  1N86 A;  1JY2 N;  1FZA C;  2XNX A;  2Z4E A;  1FZG C;  1FZB C;  1FZF C;  1N73 C;  2OYI C;  1RE4 B;  3GHG B;  1FIC A;  2J3O A;  4NYT A;  1RE4 C;  3GHG C;  2GY7 A;  2J0H A;  4JYO X;  1JY3 N;  2Q9I A;  2HPC B;  3H32 B;  1LWU B;  1M1J B;  1FZC B;  1FZA B;  1FZB B;  3HUS A;  2JHM F;  1JC9 A;  3H32 C;  2J2P A;  2HPC C;  1FZE A;  1LWU C;  2A45 H;  2FFD A;  1RF0 B;  3E1I B;  1LT9 C;  1M1J C;  1FZC C;  1N86 B;  2J60 A;  2HOD A;  2XNX B;  2Z4E B;  2J3U A;  2OYH A;  1FIB A;  2HLO A;  1RF0 C;  3E1I C;  1LTJ A;  4M7H A;  1N86 C;  2J5Z A;  2XNX C;  2Z4E C;  3BVH A;  4JZC A;  2H43 A;  2J0Y A;  2A45 G;  2A45 I;  1T3U A;  4ZFG A;  2Q9I B;  1LT9 B;  2WNP F;  2J64 A;  3HUS B;  4R9J A;  2Q9I C;  1FZE B;  1JY2 O;  2FFD B;  1RE3 A;  1Z3S A;  3HUS C;  2JHH C;  1W2E A;  1FZB A;  2HLO B;  1FZE C;  1RF1 A;  2FFD C;  1LTJ B;  2J3F A;  1Z3U A;  2J61 A;  2HOD C;  4R9T A;  1FZA A;  2OYH C;  2J0G A;  1FZG A;  4M7F A;  2HLO C;  2FIB A;  1JY3 O;  1FZF A;  1N73 A; 
#chains in the Genus database with same CATH topology
 2H43 B;  4N6J A;  2YKO A;  1JCC A;  2FY8 A;  4UB8 E;  4YTP C;  1PP9 D;  2KZI A;  3Q1M A;  1T8Z A;  2HG5 D;  4EPU A;  4XA4 A;  2J3G A;  3KHU A;  1SQP K;  1KQS O;  2RKL A;  1Q82 Q;  1RE3 C;  1M1J A;  1USD A;  4U3F J;  1SFC C;  5BVZ A;  2N1T C;  1KB9 I;  1JY2 N;  1EDI A;  1FZF C;  3H1L G;  1FC2 C;  4PD4 E;  1N2D C;  4PV1 B;  2M5A B;  1HWT C;  3MGN A;  2P1J A;  2E5Y A;  1RHZ B;  1SFC B;  3H1K J;  3CPW O;  3P8M C;  1QEX A;  2K1A A;  1LWU C;  2ZJS E;  3M0D C;  4R4L A;  2KNC B;  1HJB A;  2HOD A;  1KZU B;  1URQ C;  4OVN F;  4PD4 D;  3C8V A;  3E1I C;  1SQV D;  3BVH A;  1QVF O;  1GL2 A;  1L0N K;  1M56 D;  2Q1K A;  4BRY A;  4L76 A;  1NTK J;  4QMA A;  3TNU A;  3SWY A;  3HD7 B;  2D2C C;  1R8E A;  2O3J A;  3S9O A;  1FJP A;  3Q2Y A;  1ZLL A;  1SP4 A;  2E75 D;  1RY3 A;  1J2J B;  1KYO H;  4EIJ A;  3E1R A;  3H1I E;  2OYH C;  1FZG A;  1S5L X;  3S1K A;  1BDC A;  1Y47 A;  3PJS K;  4BXL A;  3RL0 D;  2OYH B;  1L4A A;  1PP9 G;  2WWW A;  3H1I D;  1HH0 A;  1SLQ A;  3FIB A;  3CCL P;  1VQM P;  3M9H A;  4I7Z C;  1LJ2 A;  2QIW A;  1VQL P;  1H0T B;  1Z56 A;  5KTB A;  1SVF A;  2QM7 A;  5CBN A;  1L4A D;  1WMK A;  5CCG C;  3V5B A;  1SQP E;  1SQX E;  3CX5 I;  4HJG H;  3GHG C;  3WUV A;  3H32 B;  1BGY E;  1LTI C;  3BRV B;  3HUS A;  2J2P A;  2QRX A;  4DZO A;  2FFD A;  2JR8 A;  3L72 E;  2J3U A;  3AE3 C;  1IFJ A;  1M1K Q;  1SQP D;  2POH A;  1SQX D;  2B88 A;  4Y99 C;  1N7L A;  5AW1 B;  1N7S A;  1EDL A;  1T3U A;  3CWB J;  1R5L A;  1SQV G;  3AEE C;  3ITK A;  4LC1 A;  3M06 A;  3D70 A;  4JYB A;  2Q9I C;  4AUW A;  1OVV A;  3V2P A;  1N7S D;  2WSE J;  1L0N E;  2FYN B;  5AW6 B;  3M9B A;  1FZA A;  5APW A;  1JY3 O;  3HRN A;  3A5T A;  2AXT E;  3GG2 A;  3D71 A;  2UWJ E;  5L8R J;  3GW6 A;  1NTM G;  2H8P D;  3L71 J;  1JY2 P;  3L74 G;  2W6B A;  1L2P A;  3H1H E;  1L0N D;  3HE4 A;  1LT9 A;  3MIW A;  2FYZ A;  3CCV P;  1RF1 C;  4HKZ H;  1SQB J;  1NU1 J;  5C39 A;  3KZI H;  3VMY A;  2Q3E A;  1N73 C;  2OYI C;  2IFM A;  5AVT B;  2PFX A;  4OGQ D;  3H1H D;  3JCU E;  4YXW H;  3CCM P;  3JSV C;  2FYU J;  2WT7 B;  1YI2 P;  1JNM A;  1FOS F;  1GDT A;  1N86 B;  2Z4E B;  4KHX A;  1FIB A;  5GTH H;  2JJL A;  1K9M Q;  1FDI A;  1BE3 J;  3CXH I;  2J5Z A;  3FGA D;  2R32 A;  5B66 E;  5KJ7 C;  3CCR P;  2WSS H;  1EZV I;  2B89 A;  1DD3 A;  4GKG A;  1QL2 A;  3BCC J;  1PGO A;  3SFE C;  1RE3 A;  1YTZ T;  3B5N C;  1SFC A;  4JPZ B;  2N1T A;  2WPV B;  2J0G A;  5KAF H;  4NPD A;  1FZF A;  4IL6 X;  3SFD C;  1YYC A;  1SFC D;  2ZYD A;  3NXS A;  2B87 A;  2N1T D;  4IFD K;  2KSE A;  1LWU A;  4CPG A;  3M0D A;  5APY A;  1NKN A;  1URQ A;  2KXP B;  1VQN P;  3E1I A;  1VDF A;  3CC2 P;  4ZMD A;  4U3F E;  5KLV K;  1URQ D;  1D7M A;  3HD7 D;  2ZVO B;  3L36 A;  2K9J B;  4YXD C;  4H44 C;  4UB6 H;  2OAR A;  1S72 P;  4Y28 J;  3H1K E;  1NHL A;  2OYH A;  5CCH C;  3GF7 A;  1AJY A;  1JUN A;  2CPS A;  1KIL B;  2I8D A;  2WSF H;  3WU2 H;  2I1K A;  1P84 H;  2IX7 C;  3FWN A;  1H0T A;  5APX A;  4A7P A;  3CCU P;  3KXD A;  2KLV A;  2A06 E;  3H1K D;  2Y9Z A;  3E7K A;  2SPZ A;  2XU6 A;  5GTH E;  1NTK E;  2HLO B;  2QJP B;  4L73 A;  1AQT A;  1ZRT D;  1FAV A;  3PP5 A;  1L0L G;  2E74 B;  2R44 A;  1KN7 A;  3L70 J;  5CCG A;  4H13 C;  1KYO I;  2J59 M;  2A06 D;  1GZL A;  2RMZ A;  3O6Q A;  3GHG A;  3PHL A;  1Y9B A;  1NTK D;  3ABV C;  1JCD A;  5CCG D;  5KAF E;  1SQB K;  1X0T A;  4H13 B;  2FKW B;  3RK2 B;  4H0L B;  2K9Y A;  1LGH B;  3P32 A;  2JHK F;  5AVU B;  1ZXG A;  3CCJ P;  3M9Q A;  3A0B H;  1VQ7 P;  1HBW A;  1ZR2 A;  2BCC E;  2AEJ A;  4NYT A;  2FYU K;  1RE4 C;  2XV5 A;  1JY3 N;  2Q9I A;  2HPC B;  1PPJ E;  1GMJ A;  1JTH B;  2YO2 A;  1FE6 A;  2IBZ E;  1AV1 A;  2W6J H;  2C0X A;  2BCC D;  1X8Y A;  1MKM A;  2XNX C;  3O8Z A;  1YTZ I;  3LIE A;  3RK3 B;  4IFM A;  1CI6 B;  3CX5 E;  2V4H A;  2PGD A;  3A0H E;  2WNP F;  1PPJ D;  2ZAE B;  3EQ2 A;  3KDP B;  1FZE B;  5GTI H;  3CL3 D;  1ZR4 A;  3CWB E;  5KLV D;  5KAI H;  1H8A A;  1RF1 A;  1GW4 A;  3CCQ P;  2FIB A;  1BCC D;  1N73 A;  2OYI A;  3CX5 D;  1X9V A;  1KQF B;  1EC5 A;  2H43 C;  1EQ7 A;  5E79 E;  5AVQ B;  1SQQ J;  3CC7 P;  3CWB D;  1U57 A;  4I6M C;  4EDF A;  3L73 J;  2G3A A;  3L75 G;  1EXI A;  3UIA A;  3II6 A;  4EOT A;  1YIJ P;  2VRS A;  2E76 C;  1IJD B;  2K88 A;  1IK9 A;  1NKZ B;  1YQ4 C;  1Q81 Q;  1S5L H;  4WWI A;  5KJ7 A;  1SQB E;  3VP8 A;  3KPE A;  4K35 A;  5AVY B;  1GW3 A;  1X79 B;  1SQX K;  4PV1 C;  1OFC X;  4RO0 A;  3AEB C;  2E76 B;  3VTP C;  1FDO A;  1UIX A;  3V6I A;  1NAY A;  2WPR A;  3B5N A;  3A0B E;  1NTZ J;  5KJ7 D;  4D6T J;  3VP9 A;  1WT6 A;  1ZP0 C;  1U7M A;  2FYU E;  1VQK P;  5B5E E;  1YIT P;  1MFT A;  1SQB D;  2M3B A;  4JF7 A;  1OWA A;  1QGK B;  3B5N D;  2B9B A;  2A45 G;  3TGU G;  1NVO A;  3HE5 A;  1BE3 E;  2BCC G;  5CJ4 A;  1NAF A;  3LW5 J;  1NOH A;  1E79 H;  4XFJ A;  1OW8 A;  2FYU D;  3HD7 C;  3H25 A;  3A3Y B;  1LT1 A;  3BCC E;  2GA1 A;  3F5H A;  2JEE A;  3L35 A;  3I56 P;  1LTJ B;  3H1J G;  2NRG A;  4LLH A;  2ZYG A;  1JO5 A;  3CXH E;  5KLV G;  2Z5H A;  1BE3 D;  4DOJ A;  5APU A;  1KIL E;  4JYC A;  5GTI E;  4O9B A;  1PGJ A;  3Q3D A;  1EZV E;  1BCC G;  2FXM A;  2O1K A;  3VMX A;  3KYQ A;  5H2F E;  3BCC D;  1K04 A;  2J61 B;  3WUU A;  4U7J A;  3CXH D;  5CCH A;  3B8E B;  3F89 A;  4YPC A;  3QWO C;  1JY3 P;  5APQ A;  4H44 D;  1EZV D;  1G2C B;  2PRR A;  2N9Y B;  1W5C E;  5CCH D;  1GU4 A;  1S3J A;  4JYO X;  1USE A;  2JP3 A;  2IDB A;  3IR9 A;  3L4F A;  2IBZ I;  1VQ8 P;  3H32 C;  5CMZ A;  2J60 A;  2R5D A;  3H1L J;  1OIP A;  5K5G B;  3P8C E;  2QE7 H;  3MTU E;  3V4Q A;  1ZW0 A;  3V2R A;  2QSI A;  1FS0 E;  2YMK A;  2KOG A;  1KC8 Q;  1T2K C;  2WPS A;  1A02 F;  4H13 D;  3EFF K;  4H0L D;  3C9I A;  1RQV A;  2Q3I A;  2J3F A;  4JBZ A;  3AEG C;  3I5C A;  1BGY D;  2FYN C;  1AQ5 A;  1OVR A;  1N8R Q;  1SQQ K;  3AE9 C;  1JMB A;  1PGQ A;  2KZJ A;  2BAS A;  1RE4 A;  2J1G A;  2WSF J;  2J3F D;  3L72 D;  3WUT A;  4C7N A;  5AVW B;  2CK3 H;  4IFF A;  3G71 P;  2LXC B;  4DJG A;  1IK7 A;  1Y8A A;  2OYO A;  2J5U A;  2P58 A;  1PL5 A;  2XNX A;  2P67 A;  3CD6 P;  4WY4 C;  3U59 A;  2M3E A;  4IL6 H;  3TK1 A;  1KYO E;  1ZME C;  3NTN A;  1PP9 J;  3NFQ A;  2GY7 A;  3R2P A;  2IYO A;  4LGD E;  1FZC B;  4WY4 B;  4XE5 B;  2JHM F;  2KS1 B;  1LTB C;  1FOS E;  1RF0 B;  2FXO A;  5BU8 B;  3H1I G;  1NJI Q;  1KYO D;  1BDD A;  1VQO P;  3FWL A;  1N86 C;  3LW5 H;  4OH8 B;  2Z4E C;  1JMM A;  1U7J A;  4W7Z A;  2H43 A;  1MZ9 A;  1AVO A;  1QL1 A;  5TIS H;  2W6A A;  1S2E A;  2Y0D A;  4W80 A;  2P7J A;  2XDJ A;  5AW7 B;  1KB9 H;  1S1C X;  1Z3S A;  1UII A;  2E5T A;  4C7R A;  1NH4 A;  2Y0C A;  1NTK K;  5CJ0 A;  1QLE D;  1SQV J;  1SQP G;  2E42 A;  3HTK B;  1SQX G;  3MP7 B;  2ZFC A;  2YXQ B;  4PJ0 H;  1IFP A;  2AXC A;  2M5A A;  2E76 D;  1GU5 A;  1BGY G;  2KUB A;  1BSN A;  3BAS A;  3P7K A;  1SQQ E;  4MN4 C;  5AVS B;  3L72 G;  4PV1 D;  1AA0 A;  2Y0E A;  2M8R A;  4TLF A;  2KNC A;  1KV4 A;  3L73 E;  1LP1 B;  1NO4 A;  2R3C A;  1NTM J;  3ZDM A;  1IFN A;  1Q2N A;  3L74 J;  1SQQ D;  2W90 A;  1M1J B;  1OX3 A;  3G9R A;  2ZYA A;  3HD7 A;  1K05 A;  2V7Q J;  1KMI Z;  3PLN A;  4DT0 A;  2A45 H;  2ZXX A;  3L73 D;  1L0N G;  2I1J A;  4AYC A;  2KP8 A;  1NTZ E;  1VQP P;  3MD0 A;  1A02 J;  2J0Y A;  3SWK A;  5KKZ B;  4ZFG A;  1KIL C;  2L5G B;  1KQL A;  1RH5 B;  3KZI E;  1GL2 C;  1XTG B;  4R9J A;  3H1H G;  2WSC J;  2OQQ A;  1FU1 A;  4U3F D;  1YJN P;  1VQ5 P;  1HUC A;  3PTZ A;  1NTZ D;  2KSJ A;  3VMA A;  3AE6 C;  2YIU C;  2NPS C;  2HLO C;  2E75 B;  5TIS E;  2C0W A;  1GL2 B;  2QJP C;  2KLU A;  2QJK B;  1CSB A;  2JO1 A;  2QJY C;  1VQ6 P;  4NPE A;  2E74 C;  2CPB A;  3TNU B;  3G4S P;  1CZQ A;  2H89 C;  3RBX A;  2YIU B;  4GOF A;  1FJK A;  2NPS B;  2L91 A;  2P2U A;  3H32 A;  3A2A A;  1DIP A;  2R3S A;  2YMY A;  2QJY B;  1FZG B;  4GOE A;  5CBO A;  3RK2 C;  2KIK A;  4H0L C;  2FBW C;  3OW2 O;  2IPP A;  3AEC C;  1JEK A;  1W2B O;  2KI7 B;  2H7H A;  1L4A B;  4L74 A;  1NU1 K;  1PV3 A;  2J58 A;  2Q7C A;  1GK4 A;  4B86 A;  1PGP A;  3VYI A;  3CMA P;  2HPC C;  2YNY A;  3B71 A;  3PRJ A;  5BU5 A;  1G1J A;  3AED C;  1T2K D;  3M0A A;  1YJ9 P;  1JM0 A;  1Q90 D;  2FXP A;  3H1L E;  1DEE G;  3AEA C;  2HFE D;  2WQY C;  2HR3 A;  5M1B A;  3RK3 C;  3HUS B;  2WIT A;  2FFD B;  4PD4 H;  1FZE C;  1FDM A;  4C46 A;  4EI2 A;  3PH0 A;  2OTJ P;  3H1L D;  3FXD A;  4WY4 A;  4U3F G;  1KD1 Q;  3FX0 A;  4UB6 E;  2XND H;  1M8O B;  1K8A Q;  2ITA A;  4KJM A;  2YKP A;  2IBZ D;  1FID A;  3WMM 0;  4WY4 D;  5AW0 B;  4KT0 J;  3WU2 E;  1OXZ A;  1P84 E;  3H1K G;  1L0L J;  1NTM K;  2WT7 A;  3BAT A;  4Z1M H;  2JHL F;  2XZR A;  1N86 A;  1HGZ A;  2Z4E A;  4GDO A;  3RBZ A;  2IFN A;  4TT3 H;  3CCE P;  1IZN B;  3USS A;  2V7Q H;  1H88 A;  1IFM A;  1M7L A;  1LTG C;  3AEF C;  1H89 A;  2A06 G;  1P84 D;  3L71 E;  2W27 A;  4RJT A;  2DW3 A;  1NTK G;  4OGQ B;  4RES B;  5KLI C;  1G1I A;  2LXB A;  4WB4 A;  1NU1 E;  3K5B A;  2MJZ A;  2MKV A;  2WSC H;  1EDK A;  3L71 D;  1OMI A;  1LP1 A;  1YJW P;  5KLI B;  3B4S A;  1PFI A;  2YO3 A;  5CHX A;  4R4M A;  2WTY A;  3Q5R A;  4L75 A;  5AVX B;  2ZVN B;  4WBA A;  1KQG B;  3CLQ A;  4ZNC A;  1NU1 D;  3TDK A;  1HTL C;  1K73 Q;  1LTA C;  3G3Z A;  1LTJ C;  3NMD A;  2W8Z A;  1SQV E;  3D6Y A;  1RE3 B;  1OZH A;  1ZOY C;  2KB7 P;  4RKU J;  1PPJ G;  1OW6 A;  1ZN5 A;  2M0B A;  3GMA A;  2N1T B;  2K9J A;  3AE1 C;  4HYT B;  1LNQ A;  2IBZ G;  2WPQ A;  1FZF B;  5DJU B;  1HF9 A;  1IFD A;  2O01 N;  2NZ2 A;  3EFG A;  1FZB C;  2WZ7 A;  3U1C A;  5AW4 B;  2B87 B;  5KAI E;  1FIC A;  2J3O A;  1KIL A;  1YHQ P;  4I1L A;  1NTM E;  3L75 J;  2Y9Y A;  1LWU B;  3L74 E;  3CWB G;  2AXT H;  1FZB B;  1URQ B;  2PAJ A;  3E1I B;  1KIL D;  3MUD C;  5DJT B;  2NPS A;  4GIF A;  3RL0 g;  2HLO A;  1GL2 D;  2GUV A;  1NTM D;  2Q5U A;  2A45 I;  3W67 A;  2D2C B;  2NPS D;  3L74 D;  1RQU A;  3W68 A;  2J64 A;  2O01 H;  2C9L Y;  2KYV A;  2AEF A;  1S5L E;  2E74 D;  3L71 G;  1W2E A;  5AW8 B;  2O1J A;  1PZQ A;  3Q5P A;  3TGU J;  3JCU H;  2XKM A;  2BCC J;  2K3R A;  4I2L C;  5AVR B;  2Q6Q A;  1M90 Q;  1SQB G;  5APT A;  1NU1 G;  1LTT C;  1PIX A;  3RK2 D;  1L0L K;  1OVU A;  1P84 I;  3H1J J;  3I55 P;  2ZT9 C;  2HPC A;  4I7Z B;  3P8C D;  1TU3 F;  5B66 H;  1KFM A;  5KLV J;  1JTH A;  2FYU G;  3RK3 E;  1BCC J;  1SS1 A;  2ZT9 B;  3L70 E;  3O6Q B;  3GHG B;  3V2N A;  3IFM A;  3GLM A;  1BE3 G;  1CI6 A;  1NYH A;  2JWD A;  3N7N A;  2IZ0 A;  5AW2 B;  1XTC C;  3VMZ A;  1JC9 A;  1FZE A;  4IOI H;  3BCC G;  1FZC C;  4Y99 B;  1IC2 A;  4BWN A;  1IO4 A;  3RK3 D;  2WMM A;  3L70 D;  1RF0 C;  2HYN A;  2JWA A;  2RH0 A;  1DX7 A;  1DEB A;  3RGU A;  4JZC A;  1NTZ K;  2C9N Y;  1S4X A;  2Q9I B;  1EZV G;  2JKV A;  4N3Y B;  4K3A A;  3VN0 A;  3OAK A;  1BSH A;  1LTS C;  4N78 E;  1VF5 C;  1HVV A;  3A7O A;  3CI9 A;  3H6P A;  2QM8 A;  4W7Y A;  3AE7 C;  4WVZ A;  1R5S A;  3BRT B;  4PD4 I;  3T97 B;  1VF5 B;  1M57 D;  4ASW A;  2K37 A;  1T6A A;  4OWF A;  3SSU A;  4N78 D;  2AEM A;  5AW3 B;  1Q7Y Q;  1RF1 B;  1J1D C;  1VQ9 P;  3N4X A;  2YXR B;  4JQ0 D;  5APS A;  2GUS A;  1JOC A;  1N73 B;  2OYI B;  4EYY Q;  1L0L E;  3CME P;  3OA7 A;  5AW9 B;  2QA4 P;  3IAO A;  1OW7 A;  1J1D B;  3CCS P;  1HGV A;  5AVZ B;  2RN0 A;  1M1J C;  4ZKP A;  1L0L D;  5EFW B;  3M91 A;  1LTJ A;  4M7H A;  2W83 C;  1IFI A;  3U1A A;  3L70 G;  1MV8 A;  3B5N B;  5KKZ C;  1JY2 O;  4IL6 E;  3H1I J;  3TYY A;  3KQG A;  2JHH C;  1X22 A;  4D6T E;  1Q86 Q;  1ZV8 A;  2J61 A;  2HOD C;  4HB1 A;  2IYP A;  2WVR A;  1FZB A;  3EWK A;  3GF3 A;  2R5B A;  3BVH C;  3HE5 B;  4AQR D;  2E75 C;  4M3L A;  1G2C A;  2QJK C;  1KOR A;  5TJH A;  3S4R A;  5AVV B;  2G8Y A;  2HOD B;  2ZXE B;  4D6T D;  2JDI H;  3MUD A;  3BVH B;  2JHI F;  3CX5 H;  3A0H H;  1SQP J;  1KTM A;  1SQX J;  1NGM B;  4BRY B;  3RL0 C;  1FZG C;  1BGY J;  1KB9 E;  2D2C D;  1MFZ A;  1ZRT E;  3SWF A;  3L37 A;  1HJ0 A;  4H44 B;  3AE2 C;  2J0H A;  3C1L A;  3L72 J;  3RL0 B;  1VPC A;  1MUU A;  2WSE H;  1L4A C;  3L75 E;  4PJ0 E;  1GD2 E;  5E79 H;  2OGU A;  1KB9 D;  3V4W A;  1GTW A;  2QG4 A;  1EXJ A;  4GOD A;  3AE8 C;  3JC2 2;  1DH3 A;  2QEX P;  1YQ3 C;  3Q5S A;  2PP6 A;  3V2Q A;  3L75 D;  1L0N J;  4UB8 H;  3LID A;  3CC4 P;  1SQQ G;  3HUS C;  2BEQ D;  2IZ1 A;  2FFD C;  1Z3U A;  1J1E C;  3L73 G;  4M7F A;  3QH9 A;  2ZT9 D;  2Z5I A;  1T3J A;  1VL2 A;  4ZKU A;  3MHV A;  4ASV A;  2LR2 A;  2D39 A;  3TGU E;  3MZW B;  3H1H J;  1NWQ A;  1N7S C;  1FZD A;  1AVY A;  1AFO A;  1J1E B;  5B5E H;  2OTK E;  3OJA B;  1SQV K;  4GT1 A;  1FZC A;  1DD4 A;  2O01 J;  2KK7 A;  2KS1 A;  2BEZ F;  1EDJ A;  3H1J E;  1N7S B;  1RF0 A;  1FZA C;  1NTZ G;  4D6T G;  3TGU D;  2P10 A;  5KLV E;  1RE4 B;  3AE4 C;  4C7N B;  1S9K E;  1VQ4 P;  2E43 A;  4DCK A;  2YKQ A;  1BCC E;  1E5W A;  1WRG A;  3R4Y A;  2N9B A;  3CXH H;  3T97 A;  1FZA B;  3H1J D;  5APV A;  1LT9 C;  3AE5 C;  1CW5 A;  1JB0 J;  1GK6 A;  2XNX B;  3TSI A;  1KFN A;  4NPF X;  4OGQ C;  2OTL P;  1QX8 A;  1S9K D;  1VF5 D;  5H2F H;  4HH2 A;  3G6E P;  1YBK A;  2LKM A;  3D6Z A;  1FBM A;  3FXE A;  5AW5 B;  3HE4 B;  3HTK A;  1LT9 B;  1PP9 E;  1QVG O;  3VOP A;  2QVA A;  2H88 C;  3IF4 A;  3TF5 A;  2GM4 A;  4R9T A;  3IN6 A; 
#chains in the Genus database with same CATH homology
 2XKM A;  2H43 B;  4I2L C;  2YKO A;  4N6J A;  5CCG A;  5AVR B;  1JCC A;  2E42 A;  3HTK B;  2ZFC A;  2J59 M;  5APT A;  1GZL A;  1LTT C;  3GHG A;  1T8Z A;  3RK2 D;  1GU5 A;  1L0L K;  1JCD A;  2HG5 D;  4XA4 A;  4EPU A;  2J3G A;  5CCG D;  3BAS A;  1SQP K;  2HPC A;  3P7K A;  1SQB K;  3P8C D;  1RE3 C;  1M1J A;  2FKW B;  5AVS B;  3RK2 B;  1KFM A;  1SFC C;  1JTH A;  2JHK F;  1LGH B;  3P32 A;  2N1T C;  5AVU B;  2M8R A;  5BVZ A;  1JY2 N;  1NO4 A;  3M9Q A;  2R3C A;  1HBW A;  1IFN A;  1FZF C;  1ZR2 A;  3GHG B;  1N2D C;  1HWT C;  3V2N A;  3MGN A;  4NYT A;  2P1J A;  3IFM A;  2FYU K;  1RE4 C;  1SFC B;  2XV5 A;  1CI6 A;  3N7N A;  1JY3 N;  2Q9I A;  2HPC B;  5AW2 B;  3P8M C;  1M1J B;  1XTC C;  3HD7 A;  3VMZ A;  1JC9 A;  1JTH B;  1FZE A;  1LWU C;  2A45 H;  3M0D C;  1FZC C;  4Y99 B;  1HJB A;  2I1J A;  2HOD A;  2YO2 A;  1IC2 A;  1KZU B;  1IO4 A;  3RK3 D;  1URQ C;  4AYC A;  2C0X A;  2KP8 A;  1X8Y A;  1RF0 C;  2HYN A;  3E1I C;  2XNX C;  3O8Z A;  3BVH A;  1DX7 A;  1DEB A;  1YTZ I;  3MD0 A;  4JZC A;  1A02 J;  3LIE A;  2J0Y A;  3RK3 B;  1GL2 A;  1L0N K;  1CI6 B;  1NTZ K;  4IFM A;  2C9N Y;  4ZFG A;  2Q9I B;  1KIL C;  2L5G B;  2WNP F;  1KQL A;  4N3Y B;  3TNU A;  3SWY A;  3HD7 B;  1GL2 C;  1XTG B;  3EQ2 A;  3VN0 A;  3KDP B;  3OAK A;  1FZE B;  4R9J A;  3CL3 D;  1ZR4 A;  1FJP A;  1LTS C;  1ZLL A;  1SP4 A;  4N78 E;  1FU1 A;  1RY3 A;  1J2J B;  1HVV A;  1H8A A;  3A7O A;  4EIJ A;  1RF1 A;  3CI9 A;  1HUC A;  2KSJ A;  3H6P A;  1GW4 A;  2QM8 A;  2NPS C;  4W7Y A;  2OYH C;  1FZG A;  2HLO C;  2FIB A;  1N73 A;  2OYI A;  3BRT B;  2C0W A;  1GL2 B;  1X9V A;  1CSB A;  2H43 C;  2CPB A;  3TNU B;  1EQ7 A;  1CZQ A;  5AVQ B;  4N78 D;  3RL0 D;  1FJK A;  2NPS B;  2OYH B;  4I6M C;  5AW3 B;  2P2U A;  1L4A A;  3H32 A;  1RF1 B;  1J1D C;  3A2A A;  2WWW A;  1HH0 A;  3UIA A;  3N4X A;  2YMY A;  5APS A;  2GUS A;  1SLQ A;  3FIB A;  3II6 A;  1FZG B;  4EOT A;  3M9H A;  1JOC A;  1N73 B;  2OYI B;  2VRS A;  3RK2 C;  1IJD B;  1Z56 A;  5KTB A;  1SVF A;  2QM7 A;  3OA7 A;  1L4A D;  1IK9 A;  1NKZ B;  5AW9 B;  5CCG C;  3V5B A;  1J1D B;  5KJ7 A;  1HGV A;  3VP8 A;  3KPE A;  2IPP A;  5AVY B;  1GW3 A;  1X79 B;  3GHG C;  1SQX K;  5AVZ B;  2H7H A;  1L4A B;  3H32 B;  1LTI C;  1NU1 K;  3BRV B;  3VTP C;  2J58 A;  2Q7C A;  1GK4 A;  3HUS A;  3VYI A;  2WPR A;  4B86 A;  3B5N A;  2J2P A;  2HPC C;  2YNY A;  5KJ7 D;  4DZO A;  2FFD A;  1M1J C;  4ZKP A;  5BU5 A;  3VP9 A;  2J3U A;  1G1J A;  1WT6 A;  1IFJ A;  3M0A A;  1T2K D;  3M91 A;  2POH A;  1LTJ A;  4M7H A;  4Y99 C;  2M3B A;  1IFI A;  4JF7 A;  1N7L A;  1OWA A;  3B5N D;  2A45 G;  3U1A A;  5AW1 B;  1N7S A;  1T3U A;  2HFE D;  3HE5 A;  5CJ4 A;  1NAF A;  1NOH A;  3RK3 C;  1MV8 A;  4LC1 A;  3HUS B;  3M06 A;  3B5N B;  2Q9I C;  4JYB A;  2WIT A;  4AUW A;  1JY2 O;  2FFD B;  3TYY A;  3KQG A;  2JHH C;  3HD7 C;  3V2P A;  1N7S D;  1FDM A;  1FZE C;  4C46 A;  3A3Y B;  2JEE A;  3L35 A;  1LTJ B;  1ZV8 A;  2J61 A;  2HOD C;  5AW6 B;  3M9B A;  1FZA A;  4LLH A;  5APW A;  1JO5 A;  1JY3 O;  1FZB A;  4WY4 A;  3HRN A;  3A5T A;  2Z5H A;  2R5B A;  4DOJ A;  3BVH C;  5APU A;  3HE5 B;  4AQR D;  4JYC A;  4O9B A;  4M3L A;  1G2C A;  2H8P D;  2YKP A;  5AVV B;  2FXM A;  2O1K A;  2HOD B;  3VMX A;  1JY2 P;  3KYQ A;  3WMM 0;  4WY4 D;  5AW0 B;  1FID A;  2W6B A;  2ZXE B;  3HE4 A;  1OXZ A;  1LT9 A;  2J61 B;  3MIW A;  3MUD A;  3BVH B;  2JHI F;  1NTM K;  2FYZ A;  2WT7 A;  3BAT A;  5CCH A;  2JHL F;  3B8E B;  1RF1 C;  2XZR A;  1JY3 P;  1N86 A;  1HGZ A;  2Z4E A;  5APQ A;  3RL0 C;  3VMY A;  1FZG C;  1N73 C;  2OYI C;  1G2C B;  2IFN A;  2IFM A;  5AVT B;  1MFZ A;  5CCH D;  3L37 A;  3SWF A;  1H88 A;  1GU4 A;  1IFM A;  1M7L A;  1LTG C;  2J0H A;  4JYO X;  1H89 A;  2W27 A;  3IR9 A;  3L4F A;  3RL0 B;  1VPC A;  2WT7 B;  1MUU A;  2WSE H;  1L4A C;  3H32 C;  5CMZ A;  1JNM A;  1FOS F;  1GDT A;  1N86 B;  2J60 A;  4RES B;  2R5D A;  1GD2 E;  2Z4E B;  4KHX A;  1FIB A;  1G1I A;  3V4W A;  4WB4 A;  2JJL A;  1GTW A;  2J5Z A;  3P8C E;  3MTU E;  2R32 A;  3V4Q A;  2MJZ A;  2WSC H;  5KJ7 C;  3V2R A;  4GKG A;  2KOG A;  1DH3 A;  1QL2 A;  2PP6 A;  1PFI A;  3V2Q A;  2YO3 A;  1T2K C;  5CHX A;  2WPS A;  1A02 F;  3LID A;  2WTY A;  1RE3 A;  1YTZ T;  5AVX B;  4WBA A;  3C9I A;  3HUS C;  2Q3I A;  3B5N C;  1SFC A;  3CLQ A;  2FFD C;  2N1T A;  2J3F A;  1Z3U A;  1J1E C;  2J0G A;  1HTL C;  4M7F A;  3I5C A;  1FZF A;  1LTA C;  2Z5I A;  3G3Z A;  1AQ5 A;  1LTJ C;  3NMD A;  1T3J A;  1SQQ K;  1YYC A;  4ZKU A;  2D39 A;  1SFC D;  2BAS A;  3NXS A;  1RE4 A;  1NWQ A;  2N1T D;  1N7S C;  1FZD A;  2J1G A;  2J3F D;  4C7N A;  5AVW B;  1AFO A;  4IFD K;  1J1E B;  1RE3 B;  4IFF A;  2KB7 P;  3OJA B;  1ZN5 A;  1LWU A;  1SQV K;  2N1T B;  3M0D A;  5APY A;  1NKN A;  4GT1 A;  4HYT B;  1FZC A;  1URQ A;  2WPQ A;  1FZF B;  1N7S B;  1RF0 A;  3E1I A;  1VDF A;  1FZA C;  1IFD A;  2XNX A;  2P67 A;  3EFG A;  4WY4 C;  1FZB C;  3U59 A;  2WZ7 A;  3U1C A;  5AW4 B;  3TK1 A;  1RE4 B;  4C7N B;  1FIC A;  1S9K E;  2J3O A;  3NTN A;  1KIL A;  2E43 A;  5KLV K;  1URQ D;  4I1L A;  3HD7 D;  2YKQ A;  3NFQ A;  2GY7 A;  1E5W A;  1WRG A;  1LWU B;  3R2P A;  2N9B A;  4LGD E;  3L36 A;  3T97 A;  1FZC B;  1FZA B;  4WY4 B;  1FZB B;  4XE5 B;  1URQ B;  2OAR A;  2JHM F;  2PAJ A;  1LTB C;  5APV A;  1FOS E;  1RF0 B;  3E1I B;  1LT9 C;  1KIL D;  1CW5 A;  2NPS A;  1NHL A;  4GIF A;  1GK6 A;  2XNX B;  2OYH A;  5BU8 B;  5CCH C;  2HLO A;  1KFN A;  3TSI A;  1GL2 D;  2GUV A;  1JUN A;  1N86 C;  3LW5 H;  4OH8 B;  1S9K D;  2CPS A;  2Z4E C;  1JMM A;  4HH2 A;  1KIL B;  4W7Z A;  2Q5U A;  2WSF H;  2I1K A;  2H43 A;  2LKM A;  2A45 I;  1MZ9 A;  2IX7 C;  1FBM A;  1QL1 A;  5AW5 B;  3HE4 B;  2NPS D;  2W6A A;  3HTK A;  1LT9 B;  5APX A;  4W80 A;  2P7J A;  2J64 A;  2KLV A;  3VOP A;  2O01 H;  2XU6 A;  2XDJ A;  2C9L Y;  2KYV A;  5AW7 B;  1Z3S A;  1W2E A;  4C7R A;  2HLO B;  5AW8 B;  1NH4 A;  2O1J A;  2GM4 A;  1FAV A;  3PP5 A;  1NTK K;  4R9T A;  5CJ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...