1LTJB

Crystal structure of recombinant human fibrinogen fragment d with the peptide ligands gly-pro-arg-pro-amide and gly-his-arg-pro-amide
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
298
structure length
298
Chain Sequence
IPTNLRVLRSILENLRSKIQKLESDVSAQMEYCRTPCTVSCNIPVVSGKECEEIIRKGGETSEMYLIQPDSSVKPYRVYCDMNTENGGWTVIQNRQDGSVDFGRKWDPYKQGFGNVATNTDGKNYCGLPGEYWLGNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGGFTVQNEANKYQISVNKYRGTAGNALMDGASQLMGENRTMTIHNGMFFSTYDRDNDGWLTSDPRKQCSKEDGGGWWYNRCHAANPNGRYYWGGQYTWDMAKHGTDDGVVWMNWKGSWYSMRKMSMKIRPFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Blood clotting
molecule keywords Fibrinogen alpha/alpha-E chain
publication title 2.8 A Crystal Structures of Recombinant Fibrinogen Fragment D with and without Two Peptide Ligands: GHRP Binding to the "b" Site Disrupts Its Nearby Calcium-binding Site.
pubmed doi rcsb
source organism Homo sapiens
total genus 91
structure length 298
sequence length 298
chains with identical sequence E
ec nomenclature
pdb deposition date 2002-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1ltjB03
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 1ltjB01
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 1ltjB02
1LTJC 2A45I 1FZGA 2OYIC 1RE3B 2Q9IA 1RF0B 1Z3UA 1RF0A 2J60A 2J3OA 3BVHC 2HPCC 2J1GA 2FFDA 2Z4EA 3HUSC 1RF1A 1FZAC 1FZEC 1FIDA 1LWUB 2J2PA 1FZBA 2Q9IC 2H43B 2HODB 1LWUA 3H32B 1FZFA 2JHKF 3GHGB 1M1JB 2H43A 1FIBA 3H32A 1N73B 1N86B 1JY2N 2OYHB 1M1JA 1JY3N 3FIBA 4JYOX 1FICA 1N86A 2FFDC 2Z4EC 1RE3A 2OYHA 1JY3O 2HLOB 1JY2P 1RF1C 1FZCC 1JY3P 2J5ZA 1RE4B 3E1IC 1T3UA 2GY7A 1LT9B 1FZBC 1FZDA 2JHMF 1RE4A 2WNPF 4R9TA 1FZFC 1LT9A 2XNXB 1FZGC 1LTJB 2J64A 2J0HA 1W2EA 2A45H 2A45G 2XNXA 1Z3SA 1RE3C 2OYIB 1RF0C 2J61B 4ZFGA 2HODA 2J3UA 4M7HA 3GHGA 1JC9A 1N73A 1JY2O 3BVHB 2J3FD 2HPCB 3HUSB 4R9JA 3BVHA 2HLOA 2HPCA 1FZAB 2J3GA 1FZEB 2JHHC 4NYTA 1LWUC 2JHIF 2FIBA 2D39A 2Q9IB 2H43C 2HODC 3H32C 3GHGC 2J0GA 1M1JC 1N86C 1LTJA 1N73C 2OYHC 4M7FA 2FFDB 2J0YA 2Z4EB 2OYIA 2J61A 2HLOC 1FZCB 1RF1B 1RE4C 1FZCA 3E1IB 1LT9C 1FZBB 3HUSA 4JZCA 1FZFB 3E1IA 4EPUA 1FZAA 2JHLF 2J3FA 1FZEA 2XNXC 1FZGB
chains in the Genus database with same CATH superfamily
1FC2C 2E74D 3LW5H 2OYIC 1LGHB 3CXHI 2K9YA 3V2RA 4BRYA 1KFNA 1L0NK 3EFFK 3CD6P 1FOSE 2FFDA 5DJTB 1SQPG 3NTNA 2QM8A 1HGZA 3P7KA 3UIAA 4EI2A 3CXHE 2H43B 3O6QA 1M1KQ 1JOCA 4HH2A 2K9JA 2OYHA 1N7SA 2E75C 3B5ND 1PZQA 1KILA 3VMAA 1GL2B 3E1IC 4GOFA 3BCCG 1QL2A 1NTMG 1VQ4P 5B5EH 1S3JA 3HD7D 2Z5HA 2A06D 1FJKA 1URQD 2KXPB 1JY2O 1X79B 2E76B 3TNUA 3HUSB 1L4AA 1H89A 1RH5B 3H1KJ 3L72G 1ZN5A 2HFED 3AE3C 1PP9D 4R4LA 1FDOA 1Z56A 3H1HJ 1KFMA 2HLOC 1SQPE 4PD4I 2O1KA 3HE4A 1KB9I 3H25A 1Y47A 4WVZA 3MIWA 3GG2A 3CCJP 3V2NA 2M3EA 2WSEH 2KOGA 2IZ1A 4KJMA 4PD4E 3AE6C 3BCCE 2V4HA 3KYQA 1KB9E 1RF1A 1NTME 5H2FE 1L0LG 1VQNP 2B87A 1ZW0A 5CCGD 1NHLA 1BDCA 2YMYA 2QIWA 2JWAA 1N86B 1K05A 5EFWB 4WWIA 3AE8C 2E74B 1FZCC 2QSIA 4L76A 1JMBA 3L72E 4R9TA 4L73A 1J2JB 2WPRA 3CPWO 1L0ND 3IR9A 1W2EA 2K37A 3FGAD 2E5YA 5AW9B 1NTZG 2ZYGA 3P32A 1OXZA 3CXHH 1KC8Q 4EOTA 2AXCA 3D6ZA 4N78D 2YKPA 2D2CD 2XNDH 5CCHC 4W80A 1SFCC 3A0BE 1M56D 1FZEB 2V7QH 3B5NB 1LWUC 2H89C 1OX3A 4I2LC 1HGVA 2HODC 1GTWA 1AVYA 1IFNA 1NH4A 4ASVA 1BCCG 2J0YA 1FJPA 3HD7B 2OTKE 2R3CA 1L0LE 1URQB 3CX5E 5AVWB 1SQBJ 3TGUJ 1LT9C 1EXJA 4JZCA 3T97A 1FZAA 1E5WA 2K1AA 2OTJP 2KB7P 5AVZB 3U1CA 2J3OA 2HR3A 2QEXP 2WQYC 3CC4P 5BU8B 5AVQB 4K35A 2QJPB 3H1IJ 3L37A 1NTZE 3V4QA 1T2KD 4H0LB 2P1JA 3GHGB 1DH3A 1FIBA 1JNMA 2N9YB 2ZVOB 1JY3N 3FIBA 3CCSP 2FFDC 5AW8B 2A06G 1M90Q 3NMDA 1E79H 3H1LD 4PD4H 3FWNA 3RL0B 3D6YA 1JTHB 1NJIQ 2N1TA 1ZLLA 3PLNA 4GDOA 1KB9H 5CJ0A 2XNXB 2JO1A 1BCCE 5H2FH 2RH0A 1SQBK 2J61B 3I56P 4OGQC 3TYYA 2WPSA 1KILC 1PP9G 1HH0A 2ZXXA 4R9JA 2KP8A 1HWTC 1SVFA 4ZNCA 1KN7A 3MHVA 2W27A 2JKVA 3H1KD 2WWWA 1OFCX 3A7OA 4JQ0D 1T6AA 1KORA 2XV5A 4PV1D 3L73D 3AE7C 2PAJA 1L4AC 1EDKA 2Q1KA 3B8EB 3SWFA 2NPSA 2D2CB 3OJAB 3A0BH 1OVUA 4XFJA 2Y9ZA 1H8AA 1RF0B 2A06E 1VQOP 3HE5A 2PFXA 5KKZC 1QLED 3VP9A 2WITA 1SQVJ 2KYVA 2CPBA 3KPEA 3AE9C 3CX5H 2GUSA 1M1JB 1PP9E 1Y8AA 1L0NG 2K3RA 4L74A 3G9RA 3L70D 2KNCB 2AEJA 2ZJSE 1RF1C 5M1BA 3Q5PA 2GY7A 4Y28J 2OARA 5AVTB 2E75D 2XZRA 2WT7A 4UB8E 1PGPA 1K73Q 5AVSB 2BASA 2JHHC 1GK4A 4IFFA 1SP4A 3Q3DA 1GZLA 3CCLP 2KS1A 1NKZB 2KIKA 1OVRA 1GW4A 1IC2A 4K3AA 4JPZB 1RE4C 1HJBA 1NTMD 1SQBD 2WSFH 5APUA 1FZFB 2Z5IA 2BEQD 3CWBD 1L0NE 3I5CA 3VMXA 3V5BA 1GU5A 3AEDC 1PL5A 1DD4A 2QJYB 3BVHC 4PV1B 2W6JH 1NU1J 1FZAC 1S72P 1G2CA 3H1LG 1H88A 2YNYA 1UIIA 3H32B 3EWKA 2FYUJ 2H43A 1QVGO 5BU5A 3S9OA 3L4FA 4ASWA 4JYOX 1SLQA 1JY2P 2J5ZA 4HJGH 1JUNA 1FZGC 4EIJA 5KAFE 1MKMA 2OYIB 2ZAEB 3MGNA 3H1KG 2YMKA 1USDA 2Q3EA 2ZYDA 3IAOA 1FE6A 2KLVA 2N1TC 2VRSA 4IFDK 2Y9YA 3L73G 5KLVJ 1YYCA 5K5GB 3EFGA 1SQQK 2WMMA 5AW4B 3D70A 1LTJA 1NU1K 2XDJA 1OW7A 5CCHD 2ITAA 1YI2P 1SFCD 2E75B 1NGMB 4JYCA 3H1LE 2FYUK 3E1IB 4JF7A 4UB8H 4OVNF 2FXMA 3M0DA 2Q9IA 3BRVB 2J60A 3M0AA 2NPSC 1PGQA 3AECC 4N3YB 3L70G 1LP1A 4GOEA 1LTAC 3TSIA 2C9NY 1MUUA 2G3AA 3H1KE 1BCCD 4H44C 4I1LA 3K5BA 1N86A 3L73E 2HLOB 3FX0A 1BDDA 5KLVK 1MV8A 5CMZA 3KZIE 4D6TD 2Y0CA 2IDBA 5APQA 1R8EA 1J1EC 2XKMA 2J64A 2A45G 1KYOI 2WVRA 4M7HA 3G3ZA 5CBNA 1JO5A 3L36A 4IFMA 5DJUB 2L91A 3QH9A 4O9BA 2GM4A 3RK3C 4NYTA 4OGQD 1KV4A 1HJ0A 3C1LA 4EYYQ 1SQBG 3TGUG 2BCCD 5B66E 4GODA 3CWBG 3G4SP 2H88C 5KAFH 4NPFX 2C9LY 3L70E 1FZCB 2E42A 1FS0E 1SQXJ 2M5AB 3HD7A 3L74J 4TT3H 2O3JA 1URQA 2C0XA 1BGYD 1OIPA 3L71D 2A45I 2QJKC 3V6IA 1L4AD 1LTSC 3BATA 1NYHA 2JP3A 1WT6A 1GDTA 2IFNA 1DIPA 3B71A 1SFCB 2POHA 1SQQD 3H6PA 4H0LD 1LWUB 3I55P 4ZKUA 2HODB 3H1JJ 1YBKA 3VTPC 3VMYA 1IK9A 3PRJA 1ZR2A 3RL0D 1LTBC 1OZHA 1GMJA 3CCVP 1LT9B 1FDIA 1FZDA 2JHMF 1N8RQ 1SQBE 3TGUE 5BVZA 1IFIA 2YKOA 2Q7CA 1BSNA 3CWBE 2O01H 1SQXK 2J0HA 2KSEA 3ITKA 2XNXA 3EQ2A 2V7QJ 1NOHA 1K9MQ 5CCGA 2J58A 1BE3J 2FKWB 5KJ7A 3TF5A 4U3FJ 2K88A 3A2AA 4WBAA 4Y99C 5AW2B 3LIDA 5APTA 3MUDC 1QL1A 2Q3IA 3KZIH 2JJLA 2NRGA 5KLVD 1ZV8A 3A0HE 4BRYB 2J0GA 1Q86Q 1YQ3C 4M7FA 2FFDB 4RESB 3N7NA 4H13C 4ZKPA 4WY4A 4L75A 3A3YB 4IOIH 1LJ2A 3O6QB 4I7ZC 1LTIC 1LTJC 1IFDA 1RQVA 2K9JB 1JB0J 2ZYAA 3W67A 1SQPJ 4OGQB 2IZ0A 1RF0A 1KILB 1PPJD 3W68A 5B66H 2HPCC 2Z4EA 3AEGC 3LIEA 3M0DC 2Q9IC 3AEBC 4D6TG 1VPCA 1M1JA 3BCCJ 3FXDA 4OH8B 5AW0B 1EDJA 5KAIE 1L4AB 4RO0A 2PP6A 3G71P 5APSA 1WMKA 2A45H 1EZVD 2RN0A 1N73A 3HE4B 3L72J 2BCCG 2I8DA 4AYCA 5KKZB 2J3FD 1NAYA 1U7JA 1CI6B 1X22A 3A5TA 2B89A 1HUCA 1SQPK 4AUWA 2D39A 1XTGB 1BGYG 3Q5RA 3L71G 2OYHC 1L2PA 2N1TD 1N2DC 1N7SC 3RK2C 1SS1A 1YJWP 1RF1B 2R32A 2ZVNB 3MP7B 2B87B 3KXDA 3USSA 1N7LA 3SFDC 3TK1A 4D6TE 2FYNC 3M06A 1SQQG 2IYOA 2JEEA 2OQQA 1NU1G 1IFMA 1KZUB 4DOJA 1HBWA 3S4RA 1T3JA 3A0HH 3WUUA 1JM0A 2FYUG 3H1HD 4HYTB 3HTKB 1W5CE 2PRRA 1FZBA 4A7PA 2M3BA 3AE4C 1M57D 4XE5B 1KILE 2BCCE 3H32A 1RE3A 1JY3P 3L75J 4C7NB 1RE4B 4HKZH 1NTZJ 2C0WA 1BGYE 4H44D 4I6MC 2WZ7A 1KYOD 3L71E 1NTKJ 5AW1B 1VL2A 5APYA 2OGUA 1LNQA 1G1IA 2I1JA 5KLVG 2KZJA 2IX7C 1RY3A 5AVUB 1M7LA 1FBMA 3BVHB 3AE5C 3M9HA 1BE3D 3T97B 1FZAB 1SQQE 3SWYA 5KAIH 4U3FD 3IF4A 1K04A 1NU1E 2M0BA 3M9QA 2ZFCA 2IBZD 4PJ0E 1Y9BA 2FYUE 4LLHA 2P58A 2WSFJ 5KJ7C 3CCRP 3RK3D 1BSHA 1PPJG 3E1IA 1GD2E 2W90A 1FZGB 3CC2P 2FBWC 1LT1A 2LR2A 1MZ9A 3U59A 1NTZK 1SQVK 2RMZA 2OYOA 5AW6B 1S2EA 4WY4C 2KK7A 1NTKK 3CCQP 2N1TB 5TJHA 3VP8A 3HRNA 3GMAA 1A02F 3TGUD 4JYBA 5KLIC 3R2PA 4GKGA 1PV3A 3ZDMA 5KLVE 2L5GB 3CMEP 2W6BA 4BWNA 2MKVA 1FICA 2Z4EC 1ZOYC 2M8RA 1OW6A 1EZVG 5KTBA 3G6EP 3V4WA 2RKLA 1HF9A 1G1JA 4B86A 1ZRTD 4DZOA 2FXPA 3H1ID 2O01N 4ZFGA 1S9KD 3BASA 2N9BA 2R5DA 1AQTA 1S5LX 2Q5UA 1PPJE 2IPPA 3KDPB 3E7KA 2J5UA 2NPSB 1H0TB 2ZT9C 1VQ8P 1YJ9P 3MTUE 1Q90D 1GL2A 4LC1A 2JHIF 1EDIA 1GU4A 3CC7P 4XA4A 3O8ZA 4C7RA 4H44B 3HE5B 1EC5A 5AW7B 1U57A 1N73C 1AA0A 2WSCH 1VQKP 3B4SA 1EZVI 1FZCA 2M5AA 3VYIA 3HUSA 2KUBA 3H1HG 1J1EB 2Q6QA 3CI9A 2OTLP 1EZVE 1USEA 2QG4A 1PIXA 4PJ0H 4DCKA 1RQUA 2Y0EA 3LW5J 1DEBA 1SFCA 3RK3B 3KHUA 1KQGB 2J2PA 3R4YA 1A02J 1LWUA 2KZIA 2WT7B 3II6A 3F89A 5E79E 4PV1C 3U1AA 2AEFA 1KMIZ 3AEEC 1T3UA 5APWA 1FZBC 3CL3D 2W6AA 1AV1A 1SQVD 4JBZA 1LT9A 2KS1B 3WUVA 4TLFA 3FXEA 1BE3G 4U3FG 3JSVC 1QGKB 2QJKB 2KI7B 5APVA 1RE3C 1FOSF 3Q2YA 3L35A 2IBZG 1RHZB 4DJGA 3CCEP 3H1HE 3VMZA 2FYZA 1P84D 1CW5A 2QRXA 3AE2C 3P8MC 4YTPC 5AW5B 3H1JE 1J1DC 3GF3A 3SSUA 1OW8A 1Q2NA 3RBXA 1G2CB 1GW3A 3WUTA 1KYOE 1FZEA 3B5NA 4EDFA 1N7SD 1S4XA 3RK2D 1KILD 4BXLA 1ZMEC 3GW6A 4IL6E 2ZXEB 2IBZI 3RBZA 3H1LJ 2YXRB 2WPQA 1NAFA 3CCUP 2J1GA 5APXA 3C8VA 1BE3E 1FIDA 4U3FE 5AVVB 4Y99B 1VQ7P 4U7JA 2WSEJ 1NKNA 2IFMA 2YIUC 4KHXA 3SWKA 1VF5C 1K8AQ 2IBZE 3WU2E 3H1IG 2QA4P 5TISE 3AEFC 3ABVC 2O01J 3RK3E 4H13B 1NU1D 4I7ZB 1YIJP 2WSSH 1LTJB 2H8PD 1Z3SA 3L73J 1YQ4C 2FYUD 3GHGA 2UWJE 1JC9A 2HPCB 3CCMP 1Q7YQ 2GUVA 1PGJA 5E79H 4IL6X 1CI6A 1JTHA 1DD3A 2XU6A 2Q9IB 2H43C 1OVVA 2G8YA 5AVYB 1NVOA 1YJNP 4Z1MH 1YTZI 2J61A 3MZWB 1LP1B 1GL2C 4UB6E 3GF7A 3F5HA 3PH0A 1VQ6P 2BEZF 1ZRTE 4ZMDA 3NXSA 3H1IE 1FU1A 2P10A 1ZXGA 5KJ7D 1VQMP 3OW2O 3L70J 3PHLA 1S9KE 3FWLA 1AJYA 2HG5D 2E76C 1KQFB 3HUSC 4DT0A 1JMMA 3L75G 3HTKA 5CHXA 4WY4D 1NO4A 1SQVG 1KYOH 4C46A 5GTHE 2OYHB 1N7SB 3RK2B 4N6JA 1NTKG 2YKQA 3SFEC 1ZP0C 4IL6H 3PJSK 1X9VA 1RE4A 3CX5I 4C7NA 1U7MA 5GTIE 1T8ZA 2FYNB 1LTGC 3M9BA 5C39A 1X8YA 3P8CD 2CK3H 3TNUB 3WU2H 1FAVA 1NTMJ 5TISH 2KNCA 3BVHA 4W7YA 1TU3F 3CWBJ 2FIBA 1W2BO 3OAKA 1IK7A 1N86C 2ZT9D 2LXBA 2H7HA 2E74C 1AVOA 4GIFA 1IFPA 3L75E 3GLMA 1SQVE 2J3FA 2R3SA 1P84I 2YXQB 1NTKE 1FZGA 5CBOA 2B9BA 3TDKA 3JCUE 1SQXD 4QMAA 4W7ZA 3L74D 1FZEC 1P84E 2QM7A 3B5NC 4UB6H 4WB4A 4HB1A 1LTTC 1FZFA 1M8OB 1NTMK 2SPZA 3CMAP 1L0LJ 3HD7C 1URQC 4KT0J 3VOPA 3RL0g 1S1CX 1KTMA 4M3LA 4YXWH 3N4XA 3M91A 2R44A 1PGOA 1PFIA 2AXTE 2W8ZA 2NPSD 3H1JD 2MJZA 4MN4C 4WY4B 5AVXB 5GTHH 3PP5A 3OA7A 1H0TA 2J3GA 1VQLP 2QJPC 1QX8A 3CXHD 5KLIB 4H0LC 3GHGC 5GTIH 4YPCA 1DEEG 2E5TA 3C9IA 2YO2A 1IO4A 1KD1Q 2P67A 2Z4EB 2OYIA 3Q1MA 3V2QA 2O1JA 3RL0C 1X0TA 1L0LK 1BCCJ 2JHLF 2XNXC 4R4MA 1EDLA 1HTLC 2QE7H 1QVFO 5CCGC 4RJTA 2R5BA 3VN0A 1Q82Q 4NPDA 1YHQP 2ZT9B 4D6TJ 3D71A 1JCDA 3IN6A 1D7MA 1QEXA 2JWDA 1DX7A 1UIXA 1YITP 2JHKF 2QVAA 3Q5SA 5AVRB 1S5LE 1N73B 1JY2N 1AFOA 1SQPD 3JC22 4CPGA 2FXOA 1Q81Q 1VF5D 1VQPP 2D2CC 2P2UA 3JCUH 2BCCJ 4OWFA 1P84H 3CLQA 1RF0C 4PD4D 1OWAA 1WRGA 3BCCD 1NWQA 1KB9D 1BGYJ 2HLOA 1IJDB 3L71J 4NPEA 1JCCA 1KQLA 2AEMA 2WSCJ 1HVVA 1MFTA 2CPSA 1PP9J 2B88A 2NZ2A 2W83C 5AW3B 1M1JC 2J59M 1AQ5A 1R5SA 3PTZA 2AXTH 4N78E 1SQQJ 5CJ4A 3L72D 2DW3A 4LGDE 2WPVB 1FZBB 3MD0A 4EPUA 1OMIA 1SQXG 2P7JA 2JDIH 1EXIA 3L74G 1RE3B 3P8CE 1T2KC 1Z3UA 3AEAC 1GL2D 3BRTB 1MFZA 2I1KA 5B5EE 2JR8A 4AQRD 3V2PA 3QWOC 2GA1A 3MUDA 1KQSO 2E76D 3AE1C 1J1DB 4H13D 1JY3O 1FDMA 1L0LD 3CX5D 2YO3A 2LXCB 1JEKA 1ZR4A 1VDFA 3H1JG 5CCHA 2WNPF 1L0NJ 1FZFC 1GK6A 1YTZT 2KLUA 4YXDC 2HODA 3RGUA 1VQ5P 2J3UA 5L8RJ 3E1RA 2QJYC 1R5LA 1S5LH 2LKMA 2KSJA 1SQXE 3L75D 2HPCA 2E43A 3L74E 1NTZD 2IYPA 2YIUB 2PGDA 1VF5B 2HYNA 3H32C 1VQ9P 3KQGA 1NTKD 1XTCC 2FY8A 3NFQA 1CZQA 1EQ7A 3IFMA 2WTYA 4RKUJ 1IZNB 3WMM0 2Y0DA 3S1KA 1CSBA 4GT1A 1IFJA
chains in the Genus database with same CATH topology
1FU1A 3I5CA 2JEEA 3VMXA 5KJ7D 3LW5H 3V5BA 1IFMA 2OYIC 1GU5A 1KZUB 1LGHB 4DOJA 3V2RA 1S9KE 1HBWA 1T3JA 1KFNA 1L0NK 2HG5D 3BVHC 1FOSE 2FFDA 3HUSC 4HYTB 1FZAC 3NTNA 2QM8A 1HGZA 3HTKB 3P7KA 1JMMA 1G2CA 1FZBA 3UIAA 2M3BA 2H43B 1H88A 3HTKA 2YNYA 3H32B 5CHXA 4XE5B 2H43A 4WY4D 1NO4A 3H32A 5BU5A 3L4FA 1JOCA 4C46A 2OYHB 4HH2A 4JYOX 1N7SB 1RE3A 1SLQA 3RK2B 4N6JA 2OYHA 1JY2P 2YKQA 1JY3P 1N7SA 3B5ND 2J5ZA 4C7NB 1KILA 1RE4B 1GL2B 3E1IC 1X9VA 1RE4A 4C7NA 2C0WA 1QL2A 4I6MC 1JUNA 2WZ7A 1T8ZA 1FZGC 4EIJA 1LTGC 3M9BA 5AW1B 5APYA 3HD7D 1X8YA 2OYIB 2Z5HA 3P8CD 1G1IA 1FJKA 1URQD 2I1JA 3MGNA 3TNUB 1JY2O 1RY3A 2IX7C 5AVUB 1M7LA 1FBMA 1X79B 3TNUA 3BVHB 2KLVA 3M9HA 1FAVA 2N1TC 3HUSB 2VRSA 3BVHA 4IFDK 1L4AA 1FZAB 4W7YA 3SWYA 1H89A 2FIBA 3OAKA 1ZN5A 1YYCA 3EFGA 3M9QA 2HFED 1SQQK 2ZFCA 5AW4B 1N86C 1LTJA 1NU1K 4LLHA 2XDJA 1Z56A 5CCHD 2H7HA 1SFCD 5KJ7C 4GIFA 1KFMA 2HLOC 3RK3D 2O1KA 3HE4A 4JYCA 2FYUK 3E1IB 4JF7A 2FXMA 3E1IA 1GD2E 2J3FA 1FZGB 3MIWA 3M0DA 1MZ9A 1FZGA 3V2NA 2Q9IA 3U59A 1NTZK 1SQVK 2WSEH 2KOGA 3BRVB 2J60A 5AW6B 4WY4C 3M0AA 1NTKK 2NPSC 3KYQA 2N1TB 1RF1A 3VP8A 3HRNA 4N3YB 4W7ZA 1FZEC 1A02F 3B5NC 2QM7A 1LTAC 4JYBA 3TSIA 2C9NY 4WB4A 1MUUA 3R2PA 4GKGA 1LTTC 5CCGD 1FZFA 1NHLA 1NTMK 4I1LA 2L5GB 2YMYA 1N86B 2W6BA 1FICA 1N86A 2Z4EC 3HD7C 2HLOB 1FZCC 2M8RA 5KLVK 1URQC 3VOPA 1MV8A 5CMZA 5KTBA 3V4WA 1G1JA 4B86A 4R9TA 1J2JB 2WPRA 4DZOA 4M3LA 5APQA 3IR9A 1J1EC 2XKMA 3N4XA 2J64A 1W2EA 3M91A 2A45G 1PFIA 5AW9B 3P32A 4ZFGA 1S9KD 1OXZA 4M7HA 3G3ZA 3BASA 2N9BA 2NPSD 4EOTA 2MJZA 2R5DA 1JO5A 4WY4B 2Q5UA 2IPPA 3KDPB 4N78D 2YKPA 2NPSB 3L36A 5AVXB 3PP5A 5CCHC 4IFMA 3MTUE 4W80A 4O9BA 1SFCC 3OA7A 2J3GA 1FZEB 2GM4A 3B5NB 3RK3C 4NYTA 1GL2A 4LC1A 1LWUC 2JHIF 1GU4A 4I2LC 1HGVA 2HODC 4XA4A 3O8ZA 4C7RA 1GTWA 3HE5B 3GHGC 1NH4A 1IFNA 5AW7B 3C9IA 1N73C 2YO2A 1IO4A 2P67A 2J0YA 1FJPA 2WSCH 3HD7B 2OYIA 2Z4EB 2C9LY 1FZCB 2R3CA 2E42A 3HD7A 1URQB 3V2QA 2O1JA 1FZCA 5AVWB 3RL0C 3VYIA 1LT9C 1URQA 2C0XA 3HUSA 4JZCA 3T97A 1L0LK 1FZAA 2JHLF 2XNXC 1J1EB 2A45I 1HTLC 1E5WA 1L4AD 1LTSC 3CI9A 3BATA 2KB7P 5CCGC 5AVZB 1WT6A 2R5BA 3U1CA 2J3OA 3VN0A 1GDTA 2IFNA 5BU8B 1SFCB 2POHA 5AVQB 1JCDA 3H6PA 1DEBA 1SFCA 3RK3B 3L37A 1LWUB 2J2PA 1A02J 4ZKUA 3V4QA 1T2KD 2HODB 1LWUA 1DX7A 2JHKF 2P1JA 3GHGB 1DH3A 5AVRB 2WT7B 3II6A 1JNMA 1FIBA 1N73B 1JY2N 1AFOA 1JY3N 3FIBA 3VTPC 3VMYA 1IK9A 2FFDC 1ZR2A 3RL0D 5AW8B 3U1AA 1LTBC 3NMDA 3RL0B 1T3UA 1JTHB 1LT9B 5APWA 1FZBC 3CL3D 1FZDA 2W6AA 2JHMF 2N1TA 1ZLLA 1LT9A 2P2UA 5CJ0A 5BVZA 1IFIA 2YKOA 2Q7CA 2XNXB 2O01H 1SQXK 2J0HA 3CLQA 2XNXA 5APVA 1RE3C 1RF0C 1SQBK 2J61B 3EQ2A 1FOSF 3TYYA 2WPSA 1OWAA 1WRGA 1KILC 1NOHA 3L35A 5CCGA 1HH0A 1NWQA 2J58A 2FKWB 5KJ7A 4R9JA 2KP8A 1HWTC 1SVFA 2HLOA 1IJDB 3VMZA 2FYZA 3A2AA 4WBAA 4Y99C 5AW2B 1CW5A 1JCCA 3LIDA 5APTA 1QL1A 1KQLA 2W27A 2Q3IA 1HVVA 2CPSA 2WWWA 2JJLA 3A7OA 1ZV8A 2J0GA 5AW3B 1M1JC 2J59M 3P8MC 2XV5A 5AW5B 1AQ5A 1J1DC 4M7FA 2FFDB 2PAJA 1L4AC 4N78E 5CJ4A 4RESB 3N7NA 4LGDE 4ZKPA 4WY4A 3B8EB 1G2CB 1FZBB 3SWFA 2NPSA 3A3YB 1GW3A 3MD0A 3OJAB 4EPUA 1FZEA 1LTIC 2P7JA 1LTJC 1IFDA 3B5NA 1N7SD 3RK2D 1KILD 1RE3B 1H8AA 1RF0B 3P8CE 3HE5A 1T2KC 1Z3UA 1GL2D 1RF0A 1KILB 2ZXEB 3BRTB 2WPQA 1NAFA 1MFZA 2I1KA 2J1GA 2HPCC 2Z4EA 5APXA 3VP9A 2WITA 3LIEA 2KYVA 1FIDA 2CPBA 5AVVB 4Y99B 3KPEA 3M0DC 4AQRD 1NKNA 2IFMA 3V2PA 4KHXA 2GUSA 2Q9IC 3MUDA 1M1JB 1VPCA 1M1JA 1J1DB 4OH8B 5AW0B 1JY3O 1FDMA 1L4AB 1RF1C 2YO3A 1ZR4A 1VDFA 2PP6A 2GY7A 5CCHA 2OARA 2WNPF 1FZFC 5AVTB 5APSA 1GK6A 1YTZT 1LTJB 2A45H 2H8PD 1Z3SA 2HODA 2J3UA 2XZRA 3GHGA 2WT7A 1JC9A 1N73A 3HE4B 4AYCA 2J3FD 2LKMA 2KSJA 2HPCB 2GUVA 2HPCA 1CI6B 5AVSB 2E43A 3A5TA 2BASA 2JHHC 1HUCA 1GK4A 1SQPK 4IFFA 1CI6A 4AUWA 1SP4A 1JTHA 2D39A 2XU6A 2Q9IB 1XTGB 2H43C 2HYNA 3H32C 1GZLA 3KQGA 1NKZB 1XTCC 5AVYB 3NFQA 2OYHC 1GW4A 2N1TD 1CZQA 1EQ7A 1N2DC 1YTZI 1N7SC 3IFMA 3RK2C 1IC2A 2J61A 1RF1B 2WTYA 2R32A 1RE4C 1GL2C 3WMM0 1HJBA 1N7LA 1CSBA 2WSFH 5APUA 3TK1A 4GT1A 1FZFB 3NXSA 2Z5IA 1IFJA 3M06A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LTJ C;  2A45 I;  1FZG A;  2OYI C;  1RE3 B;  2Q9I A;  1RF0 B;  1Z3U A;  1RF0 A;  2J60 A;  2J3O A;  3BVH C;  2HPC C;  2J1G A;  2FFD A;  2Z4E A;  3HUS C;  1RF1 A;  1FZA C;  1FZE C;  1FID A;  1LWU B;  2J2P A;  1FZB A;  2Q9I C;  2H43 B;  2HOD B;  1LWU A;  3H32 B;  1FZF A;  2JHK F;  3GHG B;  1M1J B;  2H43 A;  1FIB A;  3H32 A;  1N73 B;  1N86 B;  1JY2 N;  2OYH B;  1M1J A;  1JY3 N;  3FIB A;  4JYO X;  1FIC A;  1N86 A;  2FFD C;  2Z4E C;  1RE3 A;  2OYH A;  1JY3 O;  2HLO B;  1JY2 P;  1RF1 C;  1FZC C;  1JY3 P;  2J5Z A;  1RE4 B;  3E1I C;  1T3U A;  2GY7 A;  1LT9 B;  1FZB C;  1FZD A;  2JHM F;  1RE4 A;  2WNP F;  4R9T A;  1FZF C;  1LT9 A;  2XNX B;  1FZG C;  1LTJ B;  2J64 A;  2J0H A;  1W2E A;  2A45 H;  2A45 G;  2XNX A;  1Z3S A;  1RE3 C;  2OYI B;  1RF0 C;  2J61 B;  4ZFG A;  2HOD A;  2J3U A;  4M7H A;  3GHG A;  1JC9 A;  1N73 A;  1JY2 O;  3BVH B;  2J3F D;  2HPC B;  3HUS B;  4R9J A;  3BVH A;  2HLO A;  2HPC A;  1FZA B;  2J3G A;  1FZE B;  2JHH C;  4NYT A;  1LWU C;  2JHI F;  2FIB A;  2D39 A;  2Q9I B;  2H43 C;  2HOD C;  3H32 C;  3GHG C;  2J0G A;  1M1J C;  1N86 C;  1LTJ A;  1N73 C;  2OYH C;  4M7F A;  2FFD B;  2J0Y A;  2Z4E B;  2OYI A;  2J61 A;  2HLO C;  1FZC B;  1RF1 B;  1RE4 C;  1FZC A;  3E1I B;  1LT9 C;  1FZB B;  3HUS A;  4JZC A;  1FZF B;  3E1I A;  4EPU A;  1FZA A;  2JHL F;  2J3F A;  1FZE A;  2XNX C;  1FZG B; 
#chains in the Genus database with same CATH topology
 1FC2 C;  2E74 D;  3LW5 H;  2OYI C;  1LGH B;  3CXH I;  2K9Y A;  3V2R A;  4BRY A;  1KFN A;  1L0N K;  3EFF K;  3CD6 P;  1FOS E;  2FFD A;  5DJT B;  1SQP G;  3NTN A;  2QM8 A;  1HGZ A;  3P7K A;  3UIA A;  4EI2 A;  3CXH E;  2H43 B;  3O6Q A;  1M1K Q;  1JOC A;  4HH2 A;  2K9J A;  2OYH A;  1N7S A;  2E75 C;  3B5N D;  1PZQ A;  1KIL A;  3VMA A;  1GL2 B;  3E1I C;  4GOF A;  3BCC G;  1QL2 A;  1NTM G;  1VQ4 P;  5B5E H;  1S3J A;  3HD7 D;  2Z5H A;  2A06 D;  1FJK A;  1URQ D;  2KXP B;  1JY2 O;  1X79 B;  2E76 B;  3TNU A;  3HUS B;  1L4A A;  1H89 A;  1RH5 B;  3H1K J;  3L72 G;  1ZN5 A;  2HFE D;  3AE3 C;  1PP9 D;  4R4L A;  1FDO A;  1Z56 A;  3H1H J;  1KFM A;  2HLO C;  1SQP E;  4PD4 I;  2O1K A;  3HE4 A;  1KB9 I;  3H25 A;  1Y47 A;  4WVZ A;  3MIW A;  3GG2 A;  3CCJ P;  3V2N A;  2M3E A;  2WSE H;  2KOG A;  2IZ1 A;  4KJM A;  4PD4 E;  3AE6 C;  3BCC E;  2V4H A;  3KYQ A;  1KB9 E;  1RF1 A;  1NTM E;  5H2F E;  1L0L G;  1VQN P;  2B87 A;  1ZW0 A;  5CCG D;  1NHL A;  1BDC A;  2YMY A;  2QIW A;  2JWA A;  1N86 B;  1K05 A;  5EFW B;  4WWI A;  3AE8 C;  2E74 B;  1FZC C;  2QSI A;  4L76 A;  1JMB A;  3L72 E;  4R9T A;  4L73 A;  1J2J B;  2WPR A;  3CPW O;  1L0N D;  3IR9 A;  1W2E A;  2K37 A;  3FGA D;  2E5Y A;  5AW9 B;  1NTZ G;  2ZYG A;  3P32 A;  1OXZ A;  3CXH H;  1KC8 Q;  4EOT A;  2AXC A;  3D6Z A;  4N78 D;  2YKP A;  2D2C D;  2XND H;  5CCH C;  4W80 A;  1SFC C;  3A0B E;  1M56 D;  1FZE B;  2V7Q H;  3B5N B;  1LWU C;  2H89 C;  1OX3 A;  4I2L C;  1HGV A;  2HOD C;  1GTW A;  1AVY A;  1IFN A;  1NH4 A;  4ASV A;  1BCC G;  2J0Y A;  1FJP A;  3HD7 B;  2OTK E;  2R3C A;  1L0L E;  1URQ B;  3CX5 E;  5AVW B;  1SQB J;  3TGU J;  1LT9 C;  1EXJ A;  4JZC A;  3T97 A;  1FZA A;  1E5W A;  2K1A A;  2OTJ P;  2KB7 P;  5AVZ B;  3U1C A;  2J3O A;  2HR3 A;  2QEX P;  2WQY C;  3CC4 P;  5BU8 B;  5AVQ B;  4K35 A;  2QJP B;  3H1I J;  3L37 A;  1NTZ E;  3V4Q A;  1T2K D;  4H0L B;  2P1J A;  3GHG B;  1DH3 A;  1FIB A;  1JNM A;  2N9Y B;  2ZVO B;  1JY3 N;  3FIB A;  3CCS P;  2FFD C;  5AW8 B;  2A06 G;  1M90 Q;  3NMD A;  1E79 H;  3H1L D;  4PD4 H;  3FWN A;  3RL0 B;  3D6Y A;  1JTH B;  1NJI Q;  2N1T A;  1ZLL A;  3PLN A;  4GDO A;  1KB9 H;  5CJ0 A;  2XNX B;  2JO1 A;  1BCC E;  5H2F H;  2RH0 A;  1SQB K;  2J61 B;  3I56 P;  4OGQ C;  3TYY A;  2WPS A;  1KIL C;  1PP9 G;  1HH0 A;  2ZXX A;  4R9J A;  2KP8 A;  1HWT C;  1SVF A;  4ZNC A;  1KN7 A;  3MHV A;  2W27 A;  2JKV A;  3H1K D;  2WWW A;  1OFC X;  3A7O A;  4JQ0 D;  1T6A A;  1KOR A;  2XV5 A;  4PV1 D;  3L73 D;  3AE7 C;  2PAJ A;  1L4A C;  1EDK A;  2Q1K A;  3B8E B;  3SWF A;  2NPS A;  2D2C B;  3OJA B;  3A0B H;  1OVU A;  4XFJ A;  2Y9Z A;  1H8A A;  1RF0 B;  2A06 E;  1VQO P;  3HE5 A;  2PFX A;  5KKZ C;  1QLE D;  3VP9 A;  2WIT A;  1SQV J;  2KYV A;  2CPB A;  3KPE A;  3AE9 C;  3CX5 H;  2GUS A;  1M1J B;  1PP9 E;  1Y8A A;  1L0N G;  2K3R A;  4L74 A;  3G9R A;  3L70 D;  2KNC B;  2AEJ A;  2ZJS E;  1RF1 C;  5M1B A;  3Q5P A;  2GY7 A;  4Y28 J;  2OAR A;  5AVT B;  2E75 D;  2XZR A;  2WT7 A;  4UB8 E;  1PGP A;  1K73 Q;  5AVS B;  2BAS A;  2JHH C;  1GK4 A;  4IFF A;  1SP4 A;  3Q3D A;  1GZL A;  3CCL P;  2KS1 A;  1NKZ B;  2KIK A;  1OVR A;  1GW4 A;  1IC2 A;  4K3A A;  4JPZ B;  1RE4 C;  1HJB A;  1NTM D;  1SQB D;  2WSF H;  5APU A;  1FZF B;  2Z5I A;  2BEQ D;  3CWB D;  1L0N E;  3I5C A;  3VMX A;  3V5B A;  1GU5 A;  3AED C;  1PL5 A;  1DD4 A;  2QJY B;  3BVH C;  4PV1 B;  2W6J H;  1NU1 J;  1FZA C;  1S72 P;  1G2C A;  3H1L G;  1H88 A;  2YNY A;  1UII A;  3H32 B;  3EWK A;  2FYU J;  2H43 A;  1QVG O;  5BU5 A;  3S9O A;  3L4F A;  4ASW A;  4JYO X;  1SLQ A;  1JY2 P;  2J5Z A;  4HJG H;  1JUN A;  1FZG C;  4EIJ A;  5KAF E;  1MKM A;  2OYI B;  2ZAE B;  3MGN A;  3H1K G;  2YMK A;  1USD A;  2Q3E A;  2ZYD A;  3IAO A;  1FE6 A;  2KLV A;  2N1T C;  2VRS A;  4IFD K;  2Y9Y A;  3L73 G;  5KLV J;  1YYC A;  5K5G B;  3EFG A;  1SQQ K;  2WMM A;  5AW4 B;  3D70 A;  1LTJ A;  1NU1 K;  2XDJ A;  1OW7 A;  5CCH D;  2ITA A;  1YI2 P;  1SFC D;  2E75 B;  1NGM B;  4JYC A;  3H1L E;  2FYU K;  3E1I B;  4JF7 A;  4UB8 H;  4OVN F;  2FXM A;  3M0D A;  2Q9I A;  3BRV B;  2J60 A;  3M0A A;  2NPS C;  1PGQ A;  3AEC C;  4N3Y B;  3L70 G;  1LP1 A;  4GOE A;  1LTA C;  3TSI A;  2C9N Y;  1MUU A;  2G3A A;  3H1K E;  1BCC D;  4H44 C;  4I1L A;  3K5B A;  1N86 A;  3L73 E;  2HLO B;  3FX0 A;  1BDD A;  5KLV K;  1MV8 A;  5CMZ A;  3KZI E;  4D6T D;  2Y0C A;  2IDB A;  5APQ A;  1R8E A;  1J1E C;  2XKM A;  2J64 A;  2A45 G;  1KYO I;  2WVR A;  4M7H A;  3G3Z A;  5CBN A;  1JO5 A;  3L36 A;  4IFM A;  5DJU B;  2L91 A;  3QH9 A;  4O9B A;  2GM4 A;  3RK3 C;  4NYT A;  4OGQ D;  1KV4 A;  1HJ0 A;  3C1L A;  4EYY Q;  1SQB G;  3TGU G;  2BCC D;  5B66 E;  4GOD A;  3CWB G;  3G4S P;  2H88 C;  5KAF H;  4NPF X;  2C9L Y;  3L70 E;  1FZC B;  2E42 A;  1FS0 E;  1SQX J;  2M5A B;  3HD7 A;  3L74 J;  4TT3 H;  2O3J A;  1URQ A;  2C0X A;  1BGY D;  1OIP A;  3L71 D;  2A45 I;  2QJK C;  3V6I A;  1L4A D;  1LTS C;  3BAT A;  1NYH A;  2JP3 A;  1WT6 A;  1GDT A;  2IFN A;  1DIP A;  3B71 A;  1SFC B;  2POH A;  1SQQ D;  3H6P A;  4H0L D;  1LWU B;  3I55 P;  4ZKU A;  2HOD B;  3H1J J;  1YBK A;  3VTP C;  3VMY A;  1IK9 A;  3PRJ A;  1ZR2 A;  3RL0 D;  1LTB C;  1OZH A;  1GMJ A;  3CCV P;  1LT9 B;  1FDI A;  1FZD A;  2JHM F;  1N8R Q;  1SQB E;  3TGU E;  5BVZ A;  1IFI A;  2YKO A;  2Q7C A;  1BSN A;  3CWB E;  2O01 H;  1SQX K;  2J0H A;  2KSE A;  3ITK A;  2XNX A;  3EQ2 A;  2V7Q J;  1NOH A;  1K9M Q;  5CCG A;  2J58 A;  1BE3 J;  2FKW B;  5KJ7 A;  3TF5 A;  4U3F J;  2K88 A;  3A2A A;  4WBA A;  4Y99 C;  5AW2 B;  3LID A;  5APT A;  3MUD C;  1QL1 A;  2Q3I A;  3KZI H;  2JJL A;  2NRG A;  5KLV D;  1ZV8 A;  3A0H E;  4BRY B;  2J0G A;  1Q86 Q;  1YQ3 C;  4M7F A;  2FFD B;  4RES B;  3N7N A;  4H13 C;  4ZKP A;  4WY4 A;  4L75 A;  3A3Y B;  4IOI H;  1LJ2 A;  3O6Q B;  4I7Z C;  1LTI C;  1LTJ C;  1IFD A;  1RQV A;  2K9J B;  1JB0 J;  2ZYA A;  3W67 A;  1SQP J;  4OGQ B;  2IZ0 A;  1RF0 A;  1KIL B;  1PPJ D;  3W68 A;  5B66 H;  2HPC C;  2Z4E A;  3AEG C;  3LIE A;  3M0D C;  2Q9I C;  3AEB C;  4D6T G;  1VPC A;  1M1J A;  3BCC J;  3FXD A;  4OH8 B;  5AW0 B;  1EDJ A;  5KAI E;  1L4A B;  4RO0 A;  2PP6 A;  3G71 P;  5APS A;  1WMK A;  2A45 H;  1EZV D;  2RN0 A;  1N73 A;  3HE4 B;  3L72 J;  2BCC G;  2I8D A;  4AYC A;  5KKZ B;  2J3F D;  1NAY A;  1U7J A;  1CI6 B;  1X22 A;  3A5T A;  2B89 A;  1HUC A;  1SQP K;  4AUW A;  2D39 A;  1XTG B;  1BGY G;  3Q5R A;  3L71 G;  2OYH C;  1L2P A;  2N1T D;  1N2D C;  1N7S C;  3RK2 C;  1SS1 A;  1YJW P;  1RF1 B;  2R32 A;  2ZVN B;  3MP7 B;  2B87 B;  3KXD A;  3USS A;  1N7L A;  3SFD C;  3TK1 A;  4D6T E;  2FYN C;  3M06 A;  1SQQ G;  2IYO A;  2JEE A;  2OQQ A;  1NU1 G;  1IFM A;  1KZU B;  4DOJ A;  1HBW A;  3S4R A;  1T3J A;  3A0H H;  3WUU A;  1JM0 A;  2FYU G;  3H1H D;  4HYT B;  3HTK B;  1W5C E;  2PRR A;  1FZB A;  4A7P A;  2M3B A;  3AE4 C;  1M57 D;  4XE5 B;  1KIL E;  2BCC E;  3H32 A;  1RE3 A;  1JY3 P;  3L75 J;  4C7N B;  1RE4 B;  4HKZ H;  1NTZ J;  2C0W A;  1BGY E;  4H44 D;  4I6M C;  2WZ7 A;  1KYO D;  3L71 E;  1NTK J;  5AW1 B;  1VL2 A;  5APY A;  2OGU A;  1LNQ A;  1G1I A;  2I1J A;  5KLV G;  2KZJ A;  2IX7 C;  1RY3 A;  5AVU B;  1M7L A;  1FBM A;  3BVH B;  3AE5 C;  3M9H A;  1BE3 D;  3T97 B;  1FZA B;  1SQQ E;  3SWY A;  5KAI H;  4U3F D;  3IF4 A;  1K04 A;  1NU1 E;  2M0B A;  3M9Q A;  2ZFC A;  2IBZ D;  4PJ0 E;  1Y9B A;  2FYU E;  4LLH A;  2P58 A;  2WSF J;  5KJ7 C;  3CCR P;  3RK3 D;  1BSH A;  1PPJ G;  3E1I A;  1GD2 E;  2W90 A;  1FZG B;  3CC2 P;  2FBW C;  1LT1 A;  2LR2 A;  1MZ9 A;  3U59 A;  1NTZ K;  1SQV K;  2RMZ A;  2OYO A;  5AW6 B;  1S2E A;  4WY4 C;  2KK7 A;  1NTK K;  3CCQ P;  2N1T B;  5TJH A;  3VP8 A;  3HRN A;  3GMA A;  1A02 F;  3TGU D;  4JYB A;  5KLI C;  3R2P A;  4GKG A;  1PV3 A;  3ZDM A;  5KLV E;  2L5G B;  3CME P;  2W6B A;  4BWN A;  2MKV A;  1FIC A;  2Z4E C;  1ZOY C;  2M8R A;  1OW6 A;  1EZV G;  5KTB A;  3G6E P;  3V4W A;  2RKL A;  1HF9 A;  1G1J A;  4B86 A;  1ZRT D;  4DZO A;  2FXP A;  3H1I D;  2O01 N;  4ZFG A;  1S9K D;  3BAS A;  2N9B A;  2R5D A;  1AQT A;  1S5L X;  2Q5U A;  1PPJ E;  2IPP A;  3KDP B;  3E7K A;  2J5U A;  2NPS B;  1H0T B;  2ZT9 C;  1VQ8 P;  1YJ9 P;  3MTU E;  1Q90 D;  1GL2 A;  4LC1 A;  2JHI F;  1EDI A;  1GU4 A;  3CC7 P;  4XA4 A;  3O8Z A;  4C7R A;  4H44 B;  3HE5 B;  1EC5 A;  5AW7 B;  1U57 A;  1N73 C;  1AA0 A;  2WSC H;  1VQK P;  3B4S A;  1EZV I;  1FZC A;  2M5A A;  3VYI A;  3HUS A;  2KUB A;  3H1H G;  1J1E B;  2Q6Q A;  3CI9 A;  2OTL P;  1EZV E;  1USE A;  2QG4 A;  1PIX A;  4PJ0 H;  4DCK A;  1RQU A;  2Y0E A;  3LW5 J;  1DEB A;  1SFC A;  3RK3 B;  3KHU A;  1KQG B;  2J2P A;  3R4Y A;  1A02 J;  1LWU A;  2KZI A;  2WT7 B;  3II6 A;  3F89 A;  5E79 E;  4PV1 C;  3U1A A;  2AEF A;  1KMI Z;  3AEE C;  1T3U A;  5APW A;  1FZB C;  3CL3 D;  2W6A A;  1AV1 A;  1SQV D;  4JBZ A;  1LT9 A;  2KS1 B;  3WUV A;  4TLF A;  3FXE A;  1BE3 G;  4U3F G;  3JSV C;  1QGK B;  2QJK B;  2KI7 B;  5APV A;  1RE3 C;  1FOS F;  3Q2Y A;  3L35 A;  2IBZ G;  1RHZ B;  4DJG A;  3CCE P;  3H1H E;  3VMZ A;  2FYZ A;  1P84 D;  1CW5 A;  2QRX A;  3AE2 C;  3P8M C;  4YTP C;  5AW5 B;  3H1J E;  1J1D C;  3GF3 A;  3SSU A;  1OW8 A;  1Q2N A;  3RBX A;  1G2C B;  1GW3 A;  3WUT A;  1KYO E;  1FZE A;  3B5N A;  4EDF A;  1N7S D;  1S4X A;  3RK2 D;  1KIL D;  4BXL A;  1ZME C;  3GW6 A;  4IL6 E;  2ZXE B;  2IBZ I;  3RBZ A;  3H1L J;  2YXR B;  2WPQ A;  1NAF A;  3CCU P;  2J1G A;  5APX A;  3C8V A;  1BE3 E;  1FID A;  4U3F E;  5AVV B;  4Y99 B;  1VQ7 P;  4U7J A;  2WSE J;  1NKN A;  2IFM A;  2YIU C;  4KHX A;  3SWK A;  1VF5 C;  1K8A Q;  2IBZ E;  3WU2 E;  3H1I G;  2QA4 P;  5TIS E;  3AEF C;  3ABV C;  2O01 J;  3RK3 E;  4H13 B;  1NU1 D;  4I7Z B;  1YIJ P;  2WSS H;  1LTJ B;  2H8P D;  1Z3S A;  3L73 J;  1YQ4 C;  2FYU D;  3GHG A;  2UWJ E;  1JC9 A;  2HPC B;  3CCM P;  1Q7Y Q;  2GUV A;  1PGJ A;  5E79 H;  4IL6 X;  1CI6 A;  1JTH A;  1DD3 A;  2XU6 A;  2Q9I B;  2H43 C;  1OVV A;  2G8Y A;  5AVY B;  1NVO A;  1YJN P;  4Z1M H;  1YTZ I;  2J61 A;  3MZW B;  1LP1 B;  1GL2 C;  4UB6 E;  3GF7 A;  3F5H A;  3PH0 A;  1VQ6 P;  2BEZ F;  1ZRT E;  4ZMD A;  3NXS A;  3H1I E;  1FU1 A;  2P10 A;  1ZXG A;  5KJ7 D;  1VQM P;  3OW2 O;  3L70 J;  3PHL A;  1S9K E;  3FWL A;  1AJY A;  2HG5 D;  2E76 C;  1KQF B;  3HUS C;  4DT0 A;  1JMM A;  3L75 G;  3HTK A;  5CHX A;  4WY4 D;  1NO4 A;  1SQV G;  1KYO H;  4C46 A;  5GTH E;  2OYH B;  1N7S B;  3RK2 B;  4N6J A;  1NTK G;  2YKQ A;  3SFE C;  1ZP0 C;  4IL6 H;  3PJS K;  1X9V A;  1RE4 A;  3CX5 I;  4C7N A;  1U7M A;  5GTI E;  1T8Z A;  2FYN B;  1LTG C;  3M9B A;  5C39 A;  1X8Y A;  3P8C D;  2CK3 H;  3TNU B;  3WU2 H;  1FAV A;  1NTM J;  5TIS H;  2KNC A;  3BVH A;  4W7Y A;  1TU3 F;  3CWB J;  2FIB A;  1W2B O;  3OAK A;  1IK7 A;  1N86 C;  2ZT9 D;  2LXB A;  2H7H A;  2E74 C;  1AVO A;  4GIF A;  1IFP A;  3L75 E;  3GLM A;  1SQV E;  2J3F A;  2R3S A;  1P84 I;  2YXQ B;  1NTK E;  1FZG A;  5CBO A;  2B9B A;  3TDK A;  3JCU E;  1SQX D;  4QMA A;  4W7Z A;  3L74 D;  1FZE C;  1P84 E;  2QM7 A;  3B5N C;  4UB6 H;  4WB4 A;  4HB1 A;  1LTT C;  1FZF A;  1M8O B;  1NTM K;  2SPZ A;  3CMA P;  1L0L J;  3HD7 C;  1URQ C;  4KT0 J;  3VOP A;  3RL0 g;  1S1C X;  1KTM A;  4M3L A;  4YXW H;  3N4X A;  3M91 A;  2R44 A;  1PGO A;  1PFI A;  2AXT E;  2W8Z A;  2NPS D;  3H1J D;  2MJZ A;  4MN4 C;  4WY4 B;  5AVX B;  5GTH H;  3PP5 A;  3OA7 A;  1H0T A;  2J3G A;  1VQL P;  2QJP C;  1QX8 A;  3CXH D;  5KLI B;  4H0L C;  3GHG C;  5GTI H;  4YPC A;  1DEE G;  2E5T A;  3C9I A;  2YO2 A;  1IO4 A;  1KD1 Q;  2P67 A;  2Z4E B;  2OYI A;  3Q1M A;  3V2Q A;  2O1J A;  3RL0 C;  1X0T A;  1L0L K;  1BCC J;  2JHL F;  2XNX C;  4R4M A;  1EDL A;  1HTL C;  2QE7 H;  1QVF O;  5CCG C;  4RJT A;  2R5B A;  3VN0 A;  1Q82 Q;  4NPD A;  1YHQ P;  2ZT9 B;  4D6T J;  3D71 A;  1JCD A;  3IN6 A;  1D7M A;  1QEX A;  2JWD A;  1DX7 A;  1UIX A;  1YIT P;  2JHK F;  2QVA A;  3Q5S A;  5AVR B;  1S5L E;  1N73 B;  1JY2 N;  1AFO A;  1SQP D;  3JC2 2;  4CPG A;  2FXO A;  1Q81 Q;  1VF5 D;  1VQP P;  2D2C C;  2P2U A;  3JCU H;  2BCC J;  4OWF A;  1P84 H;  3CLQ A;  1RF0 C;  4PD4 D;  1OWA A;  1WRG A;  3BCC D;  1NWQ A;  1KB9 D;  1BGY J;  2HLO A;  1IJD B;  3L71 J;  4NPE A;  1JCC A;  1KQL A;  2AEM A;  2WSC J;  1HVV A;  1MFT A;  2CPS A;  1PP9 J;  2B88 A;  2NZ2 A;  2W83 C;  5AW3 B;  1M1J C;  2J59 M;  1AQ5 A;  1R5S A;  3PTZ A;  2AXT H;  4N78 E;  1SQQ J;  5CJ4 A;  3L72 D;  2DW3 A;  4LGD E;  2WPV B;  1FZB B;  3MD0 A;  4EPU A;  1OMI A;  1SQX G;  2P7J A;  2JDI H;  1EXI A;  3L74 G;  1RE3 B;  3P8C E;  1T2K C;  1Z3U A;  3AEA C;  1GL2 D;  3BRT B;  1MFZ A;  2I1K A;  5B5E E;  2JR8 A;  4AQR D;  3V2P A;  3QWO C;  2GA1 A;  3MUD A;  1KQS O;  2E76 D;  3AE1 C;  1J1D B;  4H13 D;  1JY3 O;  1FDM A;  1L0L D;  3CX5 D;  2YO3 A;  2LXC B;  1JEK A;  1ZR4 A;  1VDF A;  3H1J G;  5CCH A;  2WNP F;  1L0N J;  1FZF C;  1GK6 A;  1YTZ T;  2KLU A;  4YXD C;  2HOD A;  3RGU A;  1VQ5 P;  2J3U A;  5L8R J;  3E1R A;  2QJY C;  1R5L A;  1S5L H;  2LKM A;  2KSJ A;  1SQX E;  3L75 D;  2HPC A;  2E43 A;  3L74 E;  1NTZ D;  2IYP A;  2YIU B;  2PGD A;  1VF5 B;  2HYN A;  3H32 C;  1VQ9 P;  3KQG A;  1NTK D;  1XTC C;  2FY8 A;  3NFQ A;  1CZQ A;  1EQ7 A;  3IFM A;  2WTY A;  4RKU J;  1IZN B;  3WMM 0;  2Y0D A;  3S1K A;  1CSB A;  4GT1 A;  1IFJ A; 
#chains in the Genus database with same CATH homology
 1FU1 A;  3I5C A;  2JEE A;  3VMX A;  5KJ7 D;  3LW5 H;  3V5B A;  1IFM A;  2OYI C;  1GU5 A;  1KZU B;  1LGH B;  4DOJ A;  3V2R A;  1S9K E;  1HBW A;  1T3J A;  1KFN A;  1L0N K;  2HG5 D;  3BVH C;  1FOS E;  2FFD A;  3HUS C;  4HYT B;  1FZA C;  3NTN A;  2QM8 A;  1HGZ A;  3HTK B;  3P7K A;  1JMM A;  1G2C A;  1FZB A;  3UIA A;  2M3B A;  2H43 B;  1H88 A;  3HTK A;  2YNY A;  3H32 B;  5CHX A;  4XE5 B;  2H43 A;  4WY4 D;  1NO4 A;  3H32 A;  5BU5 A;  3L4F A;  1JOC A;  4C46 A;  2OYH B;  4HH2 A;  4JYO X;  1N7S B;  1RE3 A;  1SLQ A;  3RK2 B;  4N6J A;  2OYH A;  1JY2 P;  2YKQ A;  1JY3 P;  1N7S A;  3B5N D;  2J5Z A;  4C7N B;  1KIL A;  1RE4 B;  1GL2 B;  3E1I C;  1X9V A;  1RE4 A;  4C7N A;  2C0W A;  1QL2 A;  4I6M C;  1JUN A;  2WZ7 A;  1T8Z A;  1FZG C;  4EIJ A;  1LTG C;  3M9B A;  5AW1 B;  5APY A;  3HD7 D;  1X8Y A;  2OYI B;  2Z5H A;  3P8C D;  1G1I A;  1FJK A;  1URQ D;  2I1J A;  3MGN A;  3TNU B;  1JY2 O;  1RY3 A;  2IX7 C;  5AVU B;  1M7L A;  1FBM A;  1X79 B;  3TNU A;  3BVH B;  2KLV A;  3M9H A;  1FAV A;  2N1T C;  3HUS B;  2VRS A;  3BVH A;  4IFD K;  1L4A A;  1FZA B;  4W7Y A;  3SWY A;  1H89 A;  2FIB A;  3OAK A;  1ZN5 A;  1YYC A;  3EFG A;  3M9Q A;  2HFE D;  1SQQ K;  2ZFC A;  5AW4 B;  1N86 C;  1LTJ A;  1NU1 K;  4LLH A;  2XDJ A;  1Z56 A;  5CCH D;  2H7H A;  1SFC D;  5KJ7 C;  4GIF A;  1KFM A;  2HLO C;  3RK3 D;  2O1K A;  3HE4 A;  4JYC A;  2FYU K;  3E1I B;  4JF7 A;  2FXM A;  3E1I A;  1GD2 E;  2J3F A;  1FZG B;  3MIW A;  3M0D A;  1MZ9 A;  1FZG A;  3V2N A;  2Q9I A;  3U59 A;  1NTZ K;  1SQV K;  2WSE H;  2KOG A;  3BRV B;  2J60 A;  5AW6 B;  4WY4 C;  3M0A A;  1NTK K;  2NPS C;  3KYQ A;  2N1T B;  1RF1 A;  3VP8 A;  3HRN A;  4N3Y B;  4W7Z A;  1FZE C;  1A02 F;  3B5N C;  2QM7 A;  1LTA C;  4JYB A;  3TSI A;  2C9N Y;  4WB4 A;  1MUU A;  3R2P A;  4GKG A;  1LTT C;  5CCG D;  1FZF A;  1NHL A;  1NTM K;  4I1L A;  2L5G B;  2YMY A;  1N86 B;  2W6B A;  1FIC A;  1N86 A;  2Z4E C;  3HD7 C;  2HLO B;  1FZC C;  2M8R A;  5KLV K;  1URQ C;  3VOP A;  1MV8 A;  5CMZ A;  5KTB A;  3V4W A;  1G1J A;  4B86 A;  4R9T A;  1J2J B;  2WPR A;  4DZO A;  4M3L A;  5APQ A;  3IR9 A;  1J1E C;  2XKM A;  3N4X A;  2J64 A;  1W2E A;  3M91 A;  2A45 G;  1PFI A;  5AW9 B;  3P32 A;  4ZFG A;  1S9K D;  1OXZ A;  4M7H A;  3G3Z A;  3BAS A;  2N9B A;  2NPS D;  4EOT A;  2MJZ A;  2R5D A;  1JO5 A;  4WY4 B;  2Q5U A;  2IPP A;  3KDP B;  4N78 D;  2YKP A;  2NPS B;  3L36 A;  5AVX B;  3PP5 A;  5CCH C;  4IFM A;  3MTU E;  4W80 A;  4O9B A;  1SFC C;  3OA7 A;  2J3G A;  1FZE B;  2GM4 A;  3B5N B;  3RK3 C;  4NYT A;  1GL2 A;  4LC1 A;  1LWU C;  2JHI F;  1GU4 A;  4I2L C;  1HGV A;  2HOD C;  4XA4 A;  3O8Z A;  4C7R A;  1GTW A;  3HE5 B;  3GHG C;  1NH4 A;  1IFN A;  5AW7 B;  3C9I A;  1N73 C;  2YO2 A;  1IO4 A;  2P67 A;  2J0Y A;  1FJP A;  2WSC H;  3HD7 B;  2OYI A;  2Z4E B;  2C9L Y;  1FZC B;  2R3C A;  2E42 A;  3HD7 A;  1URQ B;  3V2Q A;  2O1J A;  1FZC A;  5AVW B;  3RL0 C;  3VYI A;  1LT9 C;  1URQ A;  2C0X A;  3HUS A;  4JZC A;  3T97 A;  1L0L K;  1FZA A;  2JHL F;  2XNX C;  1J1E B;  2A45 I;  1HTL C;  1E5W A;  1L4A D;  1LTS C;  3CI9 A;  3BAT A;  2KB7 P;  5CCG C;  5AVZ B;  1WT6 A;  2R5B A;  3U1C A;  2J3O A;  3VN0 A;  1GDT A;  2IFN A;  5BU8 B;  1SFC B;  2POH A;  5AVQ B;  1JCD A;  3H6P A;  1DEB A;  1SFC A;  3RK3 B;  3L37 A;  1LWU B;  2J2P A;  1A02 J;  4ZKU A;  3V4Q A;  1T2K D;  2HOD B;  1LWU A;  1DX7 A;  2JHK F;  2P1J A;  3GHG B;  1DH3 A;  5AVR B;  2WT7 B;  3II6 A;  1JNM A;  1FIB A;  1N73 B;  1JY2 N;  1AFO A;  1JY3 N;  3FIB A;  3VTP C;  3VMY A;  1IK9 A;  2FFD C;  1ZR2 A;  3RL0 D;  5AW8 B;  3U1A A;  1LTB C;  3NMD A;  3RL0 B;  1T3U A;  1JTH B;  1LT9 B;  5APW A;  1FZB C;  3CL3 D;  1FZD A;  2W6A A;  2JHM F;  2N1T A;  1ZLL A;  1LT9 A;  2P2U A;  5CJ0 A;  5BVZ A;  1IFI A;  2YKO A;  2Q7C A;  2XNX B;  2O01 H;  1SQX K;  2J0H A;  3CLQ A;  2XNX A;  5APV A;  1RE3 C;  1RF0 C;  1SQB K;  2J61 B;  3EQ2 A;  1FOS F;  3TYY A;  2WPS A;  1OWA A;  1WRG A;  1KIL C;  1NOH A;  3L35 A;  5CCG A;  1HH0 A;  1NWQ A;  2J58 A;  2FKW B;  5KJ7 A;  4R9J A;  2KP8 A;  1HWT C;  1SVF A;  2HLO A;  1IJD B;  3VMZ A;  2FYZ A;  3A2A A;  4WBA A;  4Y99 C;  5AW2 B;  1CW5 A;  1JCC A;  3LID A;  5APT A;  1QL1 A;  1KQL A;  2W27 A;  2Q3I A;  1HVV A;  2CPS A;  2WWW A;  2JJL A;  3A7O A;  1ZV8 A;  2J0G A;  5AW3 B;  1M1J C;  2J59 M;  3P8M C;  2XV5 A;  5AW5 B;  1AQ5 A;  1J1D C;  4M7F A;  2FFD B;  2PAJ A;  1L4A C;  4N78 E;  5CJ4 A;  4RES B;  3N7N A;  4LGD E;  4ZKP A;  4WY4 A;  3B8E B;  1G2C B;  1FZB B;  3SWF A;  2NPS A;  3A3Y B;  1GW3 A;  3MD0 A;  3OJA B;  4EPU A;  1FZE A;  1LTI C;  2P7J A;  1LTJ C;  1IFD A;  3B5N A;  1N7S D;  3RK2 D;  1KIL D;  1RE3 B;  1H8A A;  1RF0 B;  3P8C E;  3HE5 A;  1T2K C;  1Z3U A;  1GL2 D;  1RF0 A;  1KIL B;  2ZXE B;  3BRT B;  2WPQ A;  1NAF A;  1MFZ A;  2I1K A;  2J1G A;  2HPC C;  2Z4E A;  5APX A;  3VP9 A;  2WIT A;  3LIE A;  2KYV A;  1FID A;  2CPB A;  5AVV B;  4Y99 B;  3KPE A;  3M0D C;  4AQR D;  1NKN A;  2IFM A;  3V2P A;  4KHX A;  2GUS A;  2Q9I C;  3MUD A;  1M1J B;  1VPC A;  1M1J A;  1J1D B;  4OH8 B;  5AW0 B;  1JY3 O;  1FDM A;  1L4A B;  1RF1 C;  2YO3 A;  1ZR4 A;  1VDF A;  2PP6 A;  2GY7 A;  5CCH A;  2OAR A;  2WNP F;  1FZF C;  5AVT B;  5APS A;  1GK6 A;  1YTZ T;  1LTJ B;  2A45 H;  2H8P D;  1Z3S A;  2HOD A;  2J3U A;  2XZR A;  3GHG A;  2WT7 A;  1JC9 A;  1N73 A;  3HE4 B;  4AYC A;  2J3F D;  2LKM A;  2KSJ A;  2HPC B;  2GUV A;  2HPC A;  1CI6 B;  5AVS B;  2E43 A;  3A5T A;  2BAS A;  2JHH C;  1HUC A;  1GK4 A;  1SQP K;  4IFF A;  1CI6 A;  4AUW A;  1SP4 A;  1JTH A;  2D39 A;  2XU6 A;  2Q9I B;  1XTG B;  2H43 C;  2HYN A;  3H32 C;  1GZL A;  3KQG A;  1NKZ B;  1XTC C;  5AVY B;  3NFQ A;  2OYH C;  1GW4 A;  2N1T D;  1CZQ A;  1EQ7 A;  1N2D C;  1YTZ I;  1N7S C;  3IFM A;  3RK2 C;  1IC2 A;  2J61 A;  1RF1 B;  2WTY A;  2R32 A;  1RE4 C;  1GL2 C;  3WMM 0;  1HJB A;  1N7L A;  1CSB A;  2WSF H;  5APU A;  3TK1 A;  4GT1 A;  1FZF B;  3NXS A;  2Z5I A;  1IFJ A;  3M06 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...