2Q9IB

Crystal structure of d-dimer from human fibrin complexed with met-his-arg-pro-tyr-amide.
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
303
structure length
303
Chain Sequence
VNSNIPTNLRVLRSILENLRSKIQKLESDVSAQMEYCRTPCTVSCNIPVVSGKECEEIIRKGGETSEMYLIQPDSSVKPYRVYCDMNTENGGWTVIQNRQDGSVDFGRKWDPYKQGFGNVATNTDGKNYCGLPGEYWLGNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGGFTVQNEANKYQISVNKYRGTAGNALMDGASQLMGENRTMTIHNGMFFSTYDRDNDGWLTSDPRKQCSKEDGGGWWYNRCHAANPNGRYYWGGQYTWDMAKHGTDDGVVWMNWKGSWYSMRKMSMKIRPFFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibrinogen alpha chain
publication title Probing the beta-chain hole of fibrinogen with synthetic peptides that differ at their amino termini
pubmed doi rcsb
molecule tags Blood clotting
total genus 90
structure length 303
sequence length 303
chains with identical sequence E
ec nomenclature
pdb deposition date 2007-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 2q9iB01
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 2q9iB02
1RE4B 1FZAB 4JZCA 1N73B 2HPCC 3FIBA 1RE3B 1LTJB 2J3FA 2JHKF 2HODB 2J3OA 2XNXB 1RF1B 2J0GA 1FZEB 3H32C 1FZDA 2JHLF 2Z4EB 2J1GA 4EPUA 1FZCB 4JYOX 2JHHC 3HUSC 3E1IB 4ZFGA 1FIDA 2GY7A 1M1JC 4M7HA 2J3GA 4M7FA 2OYHB 2J60A 2J2PA 1FZFC 1JC9A 2Q9IB 2HLOC 1FZBC 2J64A 2J61A 2HPCB 3BVHB 2OYIB 2J0YA 1LWUB 4R9TA 2HODC 1FZGB 2FFDC 1RF0C 3H32B 2JHIF 1FICA 4NYTA 1LT9B 2J5ZA 1FIBA 1FZCC 2H43C 2J61B 2JHMF 3HUSB 1N86C 1RE4C 1FZAC 1N73C 2J0HA 2D39A 1Z3SA 4R9JA 1RE3C 1FZFB 1LTJC 2Q9IC 2J3FD 2HLOB 2J3UA 1FZBB 2XNXC 1RF1C 3BVHC 1FZEC 3GHGC 2OYIC 1LWUC 2Z4EC 1FZGC 2FFDB 1RF0B 3E1IC 2WNPF 1M1JB 1LT9C 1Z3UA 2H43B 2FIBA 2OYHC 1N86B
chains in the Genus database with same CATH superfamily
1RE4B 1FZAB 4JZCA 1N73B 2HPCC 3FIBA 1RE3B 1LTJB 2J3FA 2JHKF 2HODB 2J3OA 2XNXB 1RF1B 2J0GA 1FZEB 3H32C 1FZDA 3GHGB 2JHLF 2Z4EB 2J1GA 4EPUA 1FZCB 4JYOX 2JHHC 3HUSC 3E1IB 4ZFGA 1FIDA 2GY7A 1M1JC 4M7HA 2J3GA 4M7FA 2OYHB 2J60A 2J2PA 1FZFC 1JC9A 2Q9IB 2HLOC 1FZBC 2J64A 2J61A 2HPCB 3BVHB 2OYIB 2J0YA 1LWUB 4R9TA 2HODC 1FZGB 2FFDC 1RF0C 3H32B 2JHIF 1FICA 4NYTA 1LT9B 2J5ZA 1FIBA 1FZCC 2H43C 2J61B 2JHMF 3HUSB 1N86C 1RE4C 1FZAC 1N73C 2J0HA 2D39A 1Z3SA 4R9JA 1RE3C 1FZFB 1LTJC 2Q9IC 2J3FD 2HLOB 2J3UA 1FZBB 2XNXC 1RF1C 3BVHC 1FZEC 3GHGC 2OYIC 1LWUC 2Z4EC 1FZGC 2FFDB 1RF0B 3E1IC 2WNPF 1M1JB 1LT9C 1Z3UA 2H43B 2FIBA 2OYHC 1N86B
chains in the Genus database with same CATH topology
1RE4B 1FZAB 4JZCA 1N73B 2HPCC 3FIBA 1RE3B 1LTJB 2J3FA 2JHKF 2HODB 2J3OA 2XNXB 1RF1B 2J0GA 1FZEB 3H32C 1FZDA 2JHLF 2Z4EB 2J1GA 4EPUA 1FZCB 4JYOX 2JHHC 3HUSC 3E1IB 4ZFGA 1FIDA 2GY7A 1M1JC 4M7HA 2J3GA 4M7FA 2OYHB 2J60A 2J2PA 1FZFC 1JC9A 2Q9IB 2HLOC 1FZBC 2J64A 2J61A 2HPCB 3BVHB 2OYIB 2J0YA 1LWUB 4R9TA 2HODC 1FZGB 2FFDC 1RF0C 3H32B 2JHIF 1FICA 4NYTA 1LT9B 2J5ZA 1FIBA 1FZCC 2H43C 2J61B 2JHMF 3HUSB 1N86C 1RE4C 1FZAC 1N73C 2J0HA 2D39A 1Z3SA 4R9JA 1RE3C 1FZFB 1LTJC 2Q9IC 2J3FD 2HLOB 2J3UA 1FZBB 2XNXC 1RF1C 3BVHC 1FZEC 3GHGC 2OYIC 1LWUC 2Z4EC 1FZGC 2FFDB 1RF0B 3E1IC 2WNPF 1M1JB 1LT9C 1Z3UA 2H43B 2FIBA 2OYHC 1N86B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RE4 B;  1FZA B;  4JZC A;  1N73 B;  2HPC C;  3FIB A;  1RE3 B;  1LTJ B;  2J3F A;  2JHK F;  2HOD B;  2J3O A;  2XNX B;  1RF1 B;  2J0G A;  1FZE B;  3H32 C;  1FZD A;  2JHL F;  2Z4E B;  2J1G A;  4EPU A;  1FZC B;  4JYO X;  2JHH C;  3HUS C;  3E1I B;  4ZFG A;  1FID A;  2GY7 A;  1M1J C;  4M7H A;  2J3G A;  4M7F A;  2OYH B;  2J60 A;  2J2P A;  1FZF C;  1JC9 A;  2Q9I B;  2HLO C;  1FZB C;  2J64 A;  2J61 A;  2HPC B;  3BVH B;  2OYI B;  2J0Y A;  1LWU B;  4R9T A;  2HOD C;  1FZG B;  2FFD C;  1RF0 C;  3H32 B;  2JHI F;  1FIC A;  4NYT A;  1LT9 B;  2J5Z A;  1FIB A;  1FZC C;  2H43 C;  2J61 B;  2JHM F;  3HUS B;  1N86 C;  1RE4 C;  1FZA C;  1N73 C;  2J0H A;  2D39 A;  1Z3S A;  4R9J A;  1RE3 C;  1FZF B;  1LTJ C;  2Q9I C;  2J3F D;  2HLO B;  2J3U A;  1FZB B;  2XNX C;  1RF1 C;  3BVH C;  1FZE C;  3GHG C;  2OYI C;  1LWU C;  2Z4E C;  1FZG C;  2FFD B;  1RF0 B;  3E1I C;  2WNP F;  1M1J B;  1LT9 C;  1Z3U A;  2H43 B;  2FIB A;  2OYH C;  1N86 B; 
#chains in the Genus database with same CATH topology
 1RE4 B;  1FZA B;  4JZC A;  1N73 B;  2HPC C;  3FIB A;  1RE3 B;  1LTJ B;  2J3F A;  2JHK F;  2HOD B;  2J3O A;  2XNX B;  1RF1 B;  2J0G A;  1FZE B;  3H32 C;  1FZD A;  3GHG B;  2JHL F;  2Z4E B;  2J1G A;  4EPU A;  1FZC B;  4JYO X;  2JHH C;  3HUS C;  3E1I B;  4ZFG A;  1FID A;  2GY7 A;  1M1J C;  4M7H A;  2J3G A;  4M7F A;  2OYH B;  2J60 A;  2J2P A;  1FZF C;  1JC9 A;  2Q9I B;  2HLO C;  1FZB C;  2J64 A;  2J61 A;  2HPC B;  3BVH B;  2OYI B;  2J0Y A;  1LWU B;  4R9T A;  2HOD C;  1FZG B;  2FFD C;  1RF0 C;  3H32 B;  2JHI F;  1FIC A;  4NYT A;  1LT9 B;  2J5Z A;  1FIB A;  1FZC C;  2H43 C;  2J61 B;  2JHM F;  3HUS B;  1N86 C;  1RE4 C;  1FZA C;  1N73 C;  2J0H A;  2D39 A;  1Z3S A;  4R9J A;  1RE3 C;  1FZF B;  1LTJ C;  2Q9I C;  2J3F D;  2HLO B;  2J3U A;  1FZB B;  2XNX C;  1RF1 C;  3BVH C;  1FZE C;  3GHG C;  2OYI C;  1LWU C;  2Z4E C;  1FZG C;  2FFD B;  1RF0 B;  3E1I C;  2WNP F;  1M1J B;  1LT9 C;  1Z3U A;  2H43 B;  2FIB A;  2OYH C;  1N86 B; 
#chains in the Genus database with same CATH homology
 1RE4 B;  1FZA B;  4JZC A;  1N73 B;  2HPC C;  3FIB A;  1RE3 B;  1LTJ B;  2J3F A;  2JHK F;  2HOD B;  2J3O A;  2XNX B;  1RF1 B;  2J0G A;  1FZE B;  3H32 C;  1FZD A;  2JHL F;  2Z4E B;  2J1G A;  4EPU A;  1FZC B;  4JYO X;  2JHH C;  3HUS C;  3E1I B;  4ZFG A;  1FID A;  2GY7 A;  1M1J C;  4M7H A;  2J3G A;  4M7F A;  2OYH B;  2J60 A;  2J2P A;  1FZF C;  1JC9 A;  2Q9I B;  2HLO C;  1FZB C;  2J64 A;  2J61 A;  2HPC B;  3BVH B;  2OYI B;  2J0Y A;  1LWU B;  4R9T A;  2HOD C;  1FZG B;  2FFD C;  1RF0 C;  3H32 B;  2JHI F;  1FIC A;  4NYT A;  1LT9 B;  2J5Z A;  1FIB A;  1FZC C;  2H43 C;  2J61 B;  2JHM F;  3HUS B;  1N86 C;  1RE4 C;  1FZA C;  1N73 C;  2J0H A;  2D39 A;  1Z3S A;  4R9J A;  1RE3 C;  1FZF B;  1LTJ C;  2Q9I C;  2J3F D;  2HLO B;  2J3U A;  1FZB B;  2XNX C;  1RF1 C;  3BVH C;  1FZE C;  3GHG C;  2OYI C;  1LWU C;  2Z4E C;  1FZG C;  2FFD B;  1RF0 B;  3E1I C;  2WNP F;  1M1J B;  1LT9 C;  1Z3U A;  2H43 B;  2FIB A;  2OYH C;  1N86 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...