2J0GA

L-ficolin complexed to n-acetyl-mannosamine
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
212
structure length
212
Chain Sequence
GPRTCKDLLDRGHFLSGWHTIYLPDCRPLTVLCDMDTDGGGWTVFQRRVDGSVDFYRDWATYKQGFGSRLGEFWLGNDNIHALTAQGTSELRTDLVDFEDNYQFAKYRSFKVADEAEKYNLVLGAFVEGSAGDSLTFHNNQSFSTKDQDNDLNTGNCAVMFQGAWWYKNCHTSNLNGRYLRGTHGSFANGINWKSGKGYNYSYKVSEMKVRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lectin
molecule keywords FICOLIN-2
publication title Structural Insights Into the Innate Immune Recognition Specificities of L- and H-Ficolins.
pubmed doi rcsb
source organism Homo sapiens
total genus 69
structure length 212
sequence length 212
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2006-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 2j0gA01
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 2j0gA02
2H43B 4JZCA 1LT9B 4ZFGA 1LTJC 2HPCC 2Z4EC 1FIDA 1FZFC 1RE4B 2JHIF 2J61A 2JHMF 3HUSB 4M7FA 2J5ZA 2J0HA 2H43C 2HPCB 1LT9C 2HODB 2J2PA 1RF0B 2OYIB 1FIBA 1N73B 1RE4C 4R9JA 4JYOX 4EPUA 2J61B 3HUSC 2OYHB 1RE3C 1Z3SA 3FIBA 2HODC 1RF0C 2OYIC 2Q9IB 2JHLF 2FFDB 2HLOC 1N73C 1FZDA 2D39A 3E1IC 4R9TA 1RE3B 2J3GA 2J3OA 2OYHC 1FZCB 2J3UA 2J3FA 4NYTA 1LWUB 2Q9IC 1FICA 2HLOB 1FZAC 2FFDC 3E1IB 4M7HA 2GY7A 1RF1B 1FZCC 3H32C 3GHGC 1LWUC 1FZAB 1FZGB 2J0YA 1N86B 1Z3UA 2FIBA 1RF1C 3BVHB 3H32B 1FZBC 2J60A 1FZGC 2J3FD 1N86C 1FZEC 1M1JB 2XNXB 2JHKF 3BVHC 2J64A 1FZBB 2WNPF 2J0GA 1LTJB 2Z4EB 1JC9A 1FZEB 2J1GA 1FZFB 1M1JC 2XNXC 2JHHC
chains in the Genus database with same CATH superfamily
2H43B 4JZCA 1LT9B 4ZFGA 1LTJC 2HPCC 2Z4EC 1FIDA 1FZFC 1RE4B 2JHIF 2J61A 2JHMF 3HUSB 4M7FA 2J5ZA 2J0HA 2H43C 2HPCB 1LT9C 2HODB 2J2PA 1RF0B 2OYIB 1FIBA 1N73B 1RE4C 4R9JA 4JYOX 4EPUA 2J61B 3HUSC 2OYHB 1RE3C 1Z3SA 3FIBA 2HODC 1RF0C 2OYIC 2Q9IB 2JHLF 2FFDB 2HLOC 1N73C 1FZDA 2D39A 3E1IC 4R9TA 1RE3B 2J3GA 2J3OA 2OYHC 1FZCB 2J3UA 3GHGB 2J3FA 4NYTA 1LWUB 2Q9IC 1FICA 2HLOB 1FZAC 2FFDC 3E1IB 4M7HA 2GY7A 1RF1B 1FZCC 3H32C 3GHGC 1LWUC 1FZAB 1FZGB 2J0YA 1N86B 1Z3UA 2FIBA 1RF1C 3BVHB 3H32B 1FZBC 2J60A 1FZGC 2J3FD 1N86C 1FZEC 1M1JB 2XNXB 2JHKF 3BVHC 2J64A 1FZBB 2WNPF 2J0GA 1LTJB 2Z4EB 1JC9A 1FZEB 2J1GA 1FZFB 1M1JC 2XNXC 2JHHC
chains in the Genus database with same CATH topology
2H43B 4JZCA 1LT9B 4ZFGA 1LTJC 2HPCC 2Z4EC 1FIDA 1FZFC 1RE4B 2JHIF 2J61A 2JHMF 3HUSB 4M7FA 2J5ZA 2J0HA 2H43C 2HPCB 1LT9C 2HODB 2J2PA 1RF0B 2OYIB 1FIBA 1N73B 1RE4C 4R9JA 4JYOX 4EPUA 2J61B 3HUSC 2OYHB 1RE3C 1Z3SA 3FIBA 2HODC 1RF0C 2OYIC 2Q9IB 2JHLF 2FFDB 2HLOC 1N73C 1FZDA 2D39A 3E1IC 4R9TA 1RE3B 2J3GA 2J3OA 2OYHC 1FZCB 2J3UA 2J3FA 4NYTA 1LWUB 2Q9IC 1FICA 2HLOB 1FZAC 2FFDC 3E1IB 4M7HA 2GY7A 1RF1B 1FZCC 3H32C 3GHGC 1LWUC 1FZAB 1FZGB 2J0YA 1N86B 1Z3UA 2FIBA 1RF1C 3BVHB 3H32B 1FZBC 2J60A 1FZGC 2J3FD 1N86C 1FZEC 1M1JB 2XNXB 2JHKF 3BVHC 2J64A 1FZBB 2WNPF 2J0GA 1LTJB 2Z4EB 1JC9A 1FZEB 2J1GA 1FZFB 1M1JC 2XNXC 2JHHC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H43 B;  4JZC A;  1LT9 B;  4ZFG A;  1LTJ C;  2HPC C;  2Z4E C;  1FID A;  1FZF C;  1RE4 B;  2JHI F;  2J61 A;  2JHM F;  3HUS B;  4M7F A;  2J5Z A;  2J0H A;  2H43 C;  2HPC B;  1LT9 C;  2HOD B;  2J2P A;  1RF0 B;  2OYI B;  1FIB A;  1N73 B;  1RE4 C;  4R9J A;  4JYO X;  4EPU A;  2J61 B;  3HUS C;  2OYH B;  1RE3 C;  1Z3S A;  3FIB A;  2HOD C;  1RF0 C;  2OYI C;  2Q9I B;  2JHL F;  2FFD B;  2HLO C;  1N73 C;  1FZD A;  2D39 A;  3E1I C;  4R9T A;  1RE3 B;  2J3G A;  2J3O A;  2OYH C;  1FZC B;  2J3U A;  2J3F A;  4NYT A;  1LWU B;  2Q9I C;  1FIC A;  2HLO B;  1FZA C;  2FFD C;  3E1I B;  4M7H A;  2GY7 A;  1RF1 B;  1FZC C;  3H32 C;  3GHG C;  1LWU C;  1FZA B;  1FZG B;  2J0Y A;  1N86 B;  1Z3U A;  2FIB A;  1RF1 C;  3BVH B;  3H32 B;  1FZB C;  2J60 A;  1FZG C;  2J3F D;  1N86 C;  1FZE C;  1M1J B;  2XNX B;  2JHK F;  3BVH C;  2J64 A;  1FZB B;  2WNP F;  2J0G A;  1LTJ B;  2Z4E B;  1JC9 A;  1FZE B;  2J1G A;  1FZF B;  1M1J C;  2XNX C;  2JHH C; 
#chains in the Genus database with same CATH topology
 2H43 B;  4JZC A;  1LT9 B;  4ZFG A;  1LTJ C;  2HPC C;  2Z4E C;  1FID A;  1FZF C;  1RE4 B;  2JHI F;  2J61 A;  2JHM F;  3HUS B;  4M7F A;  2J5Z A;  2J0H A;  2H43 C;  2HPC B;  1LT9 C;  2HOD B;  2J2P A;  1RF0 B;  2OYI B;  1FIB A;  1N73 B;  1RE4 C;  4R9J A;  4JYO X;  4EPU A;  2J61 B;  3HUS C;  2OYH B;  1RE3 C;  1Z3S A;  3FIB A;  2HOD C;  1RF0 C;  2OYI C;  2Q9I B;  2JHL F;  2FFD B;  2HLO C;  1N73 C;  1FZD A;  2D39 A;  3E1I C;  4R9T A;  1RE3 B;  2J3G A;  2J3O A;  2OYH C;  1FZC B;  2J3U A;  3GHG B;  2J3F A;  4NYT A;  1LWU B;  2Q9I C;  1FIC A;  2HLO B;  1FZA C;  2FFD C;  3E1I B;  4M7H A;  2GY7 A;  1RF1 B;  1FZC C;  3H32 C;  3GHG C;  1LWU C;  1FZA B;  1FZG B;  2J0Y A;  1N86 B;  1Z3U A;  2FIB A;  1RF1 C;  3BVH B;  3H32 B;  1FZB C;  2J60 A;  1FZG C;  2J3F D;  1N86 C;  1FZE C;  1M1J B;  2XNX B;  2JHK F;  3BVH C;  2J64 A;  1FZB B;  2WNP F;  2J0G A;  1LTJ B;  2Z4E B;  1JC9 A;  1FZE B;  2J1G A;  1FZF B;  1M1J C;  2XNX C;  2JHH C; 
#chains in the Genus database with same CATH homology
 2H43 B;  4JZC A;  1LT9 B;  4ZFG A;  1LTJ C;  2HPC C;  2Z4E C;  1FID A;  1FZF C;  1RE4 B;  2JHI F;  2J61 A;  2JHM F;  3HUS B;  4M7F A;  2J5Z A;  2J0H A;  2H43 C;  2HPC B;  1LT9 C;  2HOD B;  2J2P A;  1RF0 B;  2OYI B;  1FIB A;  1N73 B;  1RE4 C;  4R9J A;  4JYO X;  4EPU A;  2J61 B;  3HUS C;  2OYH B;  1RE3 C;  1Z3S A;  3FIB A;  2HOD C;  1RF0 C;  2OYI C;  2Q9I B;  2JHL F;  2FFD B;  2HLO C;  1N73 C;  1FZD A;  2D39 A;  3E1I C;  4R9T A;  1RE3 B;  2J3G A;  2J3O A;  2OYH C;  1FZC B;  2J3U A;  2J3F A;  4NYT A;  1LWU B;  2Q9I C;  1FIC A;  2HLO B;  1FZA C;  2FFD C;  3E1I B;  4M7H A;  2GY7 A;  1RF1 B;  1FZC C;  3H32 C;  3GHG C;  1LWU C;  1FZA B;  1FZG B;  2J0Y A;  1N86 B;  1Z3U A;  2FIB A;  1RF1 C;  3BVH B;  3H32 B;  1FZB C;  2J60 A;  1FZG C;  2J3F D;  1N86 C;  1FZE C;  1M1J B;  2XNX B;  2JHK F;  3BVH C;  2J64 A;  1FZB B;  2WNP F;  2J0G A;  1LTJ B;  2Z4E B;  1JC9 A;  1FZE B;  2J1G A;  1FZF B;  1M1J C;  2XNX C;  2JHH C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...