2J0GA

L-ficolin complexed to n-acetyl-mannosamine
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
212
structure length
212
Chain Sequence
GPRTCKDLLDRGHFLSGWHTIYLPDCRPLTVLCDMDTDGGGWTVFQRRVDGSVDFYRDWATYKQGFGSRLGEFWLGNDNIHALTAQGTSELRTDLVDFEDNYQFAKYRSFKVADEAEKYNLVLGAFVEGSAGDSLTFHNNQSFSTKDQDNDLNTGNCAVMFQGAWWYKNCHTSNLNGRYLRGTHGSFANGINWKSGKGYNYSYKVSEMKVRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FICOLIN-2
publication title Structural Insights Into the Innate Immune Recognition Specificities of L- and H-Ficolins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lectin
total genus 69
structure length 212
sequence length 212
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2006-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 2j0gA01
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 2j0gA02
2Z4EB 1JC9A 4ZFGA 2Z4EC 4M7FA 3HUSB 1FZGB 2JHIF 1FZGC 2J64A 4M7HA 1FIBA 2J60A 1M1JB 1FZCB 1M1JC 1FZAB 1FZCC 4JZCA 2J3UA 1FZAC 2J3FD 2XNXB 2GY7A 2JHLF 1N73C 4EPUA 2XNXC 2J5ZA 1FZFC 1RF1B 2JHKF 2H43B 2D39A 2HPCB 1RF1C 2Q9IB 2H43C 1FICA 2HPCC 4NYTA 2Q9IC 1FZFB 3HUSC 2J3OA 1N86B 1N86C 2J1GA 1LT9B 1FZBB 2HLOB 1LT9C 1LWUB 3H32B 1FZBC 2HLOC 1LWUC 3H32C 2J0GA 2OYIB 1Z3UA 2OYIC 2WNPF 2J3GA 2FFDB 1RE4B 1RF0B 4R9TA 2FFDC 1RE4C 1RF0C 2OYHB 2OYHC 3FIBA 1FZEB 1Z3SA 2J61B 1LTJB 1FZEC 2FIBA 2J3FA 1LTJC 2J2PA 2JHMF 2J0YA 1FIDA 3BVHB 1RE3B 4JYOX 3BVHC 3GHGC 3E1IB 2JHHC 1RE3C 3E1IC 2HODB 1N73B 2J61A 1FZDA 2HODC 2J0HA 4R9JA
chains in the Genus database with same CATH superfamily
2Z4EB 1JC9A 4ZFGA 2Z4EC 4M7FA 3HUSB 1FZGB 2JHIF 1FZGC 2J64A 4M7HA 1FIBA 2J60A 1M1JB 1FZCB 1M1JC 1FZAB 1FZCC 4JZCA 2J3UA 1FZAC 2J3FD 2XNXB 2GY7A 2JHLF 1N73C 4EPUA 2XNXC 2J5ZA 1FZFC 1RF1B 2JHKF 2H43B 2D39A 2HPCB 1RF1C 2Q9IB 2H43C 1FICA 2HPCC 4NYTA 2Q9IC 1FZFB 3HUSC 2J3OA 1N86B 1N86C 2J1GA 1LT9B 1FZBB 2HLOB 1LT9C 1LWUB 3H32B 1FZBC 2HLOC 1LWUC 3H32C 2J0GA 2OYIB 1Z3UA 2OYIC 2WNPF 2J3GA 2FFDB 1RE4B 1RF0B 4R9TA 2FFDC 1RE4C 1RF0C 2OYHB 2OYHC 3FIBA 1FZEB 1Z3SA 2J61B 1LTJB 1FZEC 2FIBA 2J3FA 1LTJC 2J2PA 2JHMF 2J0YA 1FIDA 3BVHB 3GHGB 1RE3B 4JYOX 3BVHC 3GHGC 3E1IB 2JHHC 1RE3C 3E1IC 2HODB 1N73B 2J61A 1FZDA 2HODC 2J0HA 4R9JA
chains in the Genus database with same CATH topology
2Z4EB 1JC9A 4ZFGA 2Z4EC 4M7FA 3HUSB 1FZGB 2JHIF 1FZGC 2J64A 4M7HA 1FIBA 2J60A 1M1JB 1FZCB 1M1JC 1FZAB 1FZCC 4JZCA 2J3UA 1FZAC 2J3FD 2XNXB 2GY7A 2JHLF 1N73C 4EPUA 2XNXC 2J5ZA 1FZFC 1RF1B 2JHKF 2H43B 2D39A 2HPCB 1RF1C 2Q9IB 2H43C 1FICA 2HPCC 4NYTA 2Q9IC 1FZFB 3HUSC 2J3OA 1N86B 1N86C 2J1GA 1LT9B 1FZBB 2HLOB 1LT9C 1LWUB 3H32B 1FZBC 2HLOC 1LWUC 3H32C 2J0GA 2OYIB 1Z3UA 2OYIC 2WNPF 2J3GA 2FFDB 1RE4B 1RF0B 4R9TA 2FFDC 1RE4C 1RF0C 2OYHB 2OYHC 3FIBA 1FZEB 1Z3SA 2J61B 1LTJB 1FZEC 2FIBA 2J3FA 1LTJC 2J2PA 2JHMF 2J0YA 1FIDA 3BVHB 1RE3B 4JYOX 3BVHC 3GHGC 3E1IB 2JHHC 1RE3C 3E1IC 2HODB 1N73B 2J61A 1FZDA 2HODC 2J0HA 4R9JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z4E B;  1JC9 A;  4ZFG A;  2Z4E C;  4M7F A;  3HUS B;  1FZG B;  2JHI F;  1FZG C;  2J64 A;  4M7H A;  1FIB A;  2J60 A;  1M1J B;  1FZC B;  1M1J C;  1FZA B;  1FZC C;  4JZC A;  2J3U A;  1FZA C;  2J3F D;  2XNX B;  2GY7 A;  2JHL F;  1N73 C;  4EPU A;  2XNX C;  2J5Z A;  1FZF C;  1RF1 B;  2JHK F;  2H43 B;  2D39 A;  2HPC B;  1RF1 C;  2Q9I B;  2H43 C;  1FIC A;  2HPC C;  4NYT A;  2Q9I C;  1FZF B;  3HUS C;  2J3O A;  1N86 B;  1N86 C;  2J1G A;  1LT9 B;  1FZB B;  2HLO B;  1LT9 C;  1LWU B;  3H32 B;  1FZB C;  2HLO C;  1LWU C;  3H32 C;  2J0G A;  2OYI B;  1Z3U A;  2OYI C;  2WNP F;  2J3G A;  2FFD B;  1RE4 B;  1RF0 B;  4R9T A;  2FFD C;  1RE4 C;  1RF0 C;  2OYH B;  2OYH C;  3FIB A;  1FZE B;  1Z3S A;  2J61 B;  1LTJ B;  1FZE C;  2FIB A;  2J3F A;  1LTJ C;  2J2P A;  2JHM F;  2J0Y A;  1FID A;  3BVH B;  1RE3 B;  4JYO X;  3BVH C;  3GHG C;  3E1I B;  2JHH C;  1RE3 C;  3E1I C;  2HOD B;  1N73 B;  2J61 A;  1FZD A;  2HOD C;  2J0H A;  4R9J A; 
#chains in the Genus database with same CATH topology
 2Z4E B;  1JC9 A;  4ZFG A;  2Z4E C;  4M7F A;  3HUS B;  1FZG B;  2JHI F;  1FZG C;  2J64 A;  4M7H A;  1FIB A;  2J60 A;  1M1J B;  1FZC B;  1M1J C;  1FZA B;  1FZC C;  4JZC A;  2J3U A;  1FZA C;  2J3F D;  2XNX B;  2GY7 A;  2JHL F;  1N73 C;  4EPU A;  2XNX C;  2J5Z A;  1FZF C;  1RF1 B;  2JHK F;  2H43 B;  2D39 A;  2HPC B;  1RF1 C;  2Q9I B;  2H43 C;  1FIC A;  2HPC C;  4NYT A;  2Q9I C;  1FZF B;  3HUS C;  2J3O A;  1N86 B;  1N86 C;  2J1G A;  1LT9 B;  1FZB B;  2HLO B;  1LT9 C;  1LWU B;  3H32 B;  1FZB C;  2HLO C;  1LWU C;  3H32 C;  2J0G A;  2OYI B;  1Z3U A;  2OYI C;  2WNP F;  2J3G A;  2FFD B;  1RE4 B;  1RF0 B;  4R9T A;  2FFD C;  1RE4 C;  1RF0 C;  2OYH B;  2OYH C;  3FIB A;  1FZE B;  1Z3S A;  2J61 B;  1LTJ B;  1FZE C;  2FIB A;  2J3F A;  1LTJ C;  2J2P A;  2JHM F;  2J0Y A;  1FID A;  3BVH B;  3GHG B;  1RE3 B;  4JYO X;  3BVH C;  3GHG C;  3E1I B;  2JHH C;  1RE3 C;  3E1I C;  2HOD B;  1N73 B;  2J61 A;  1FZD A;  2HOD C;  2J0H A;  4R9J A; 
#chains in the Genus database with same CATH homology
 2Z4E B;  1JC9 A;  4ZFG A;  2Z4E C;  4M7F A;  3HUS B;  1FZG B;  2JHI F;  1FZG C;  2J64 A;  4M7H A;  1FIB A;  2J60 A;  1M1J B;  1FZC B;  1M1J C;  1FZA B;  1FZC C;  4JZC A;  2J3U A;  1FZA C;  2J3F D;  2XNX B;  2GY7 A;  2JHL F;  1N73 C;  4EPU A;  2XNX C;  2J5Z A;  1FZF C;  1RF1 B;  2JHK F;  2H43 B;  2D39 A;  2HPC B;  1RF1 C;  2Q9I B;  2H43 C;  1FIC A;  2HPC C;  4NYT A;  2Q9I C;  1FZF B;  3HUS C;  2J3O A;  1N86 B;  1N86 C;  2J1G A;  1LT9 B;  1FZB B;  2HLO B;  1LT9 C;  1LWU B;  3H32 B;  1FZB C;  2HLO C;  1LWU C;  3H32 C;  2J0G A;  2OYI B;  1Z3U A;  2OYI C;  2WNP F;  2J3G A;  2FFD B;  1RE4 B;  1RF0 B;  4R9T A;  2FFD C;  1RE4 C;  1RF0 C;  2OYH B;  2OYH C;  3FIB A;  1FZE B;  1Z3S A;  2J61 B;  1LTJ B;  1FZE C;  2FIB A;  2J3F A;  1LTJ C;  2J2P A;  2JHM F;  2J0Y A;  1FID A;  3BVH B;  1RE3 B;  4JYO X;  3BVH C;  3GHG C;  3E1I B;  2JHH C;  1RE3 C;  3E1I C;  2HOD B;  1N73 B;  2J61 A;  1FZD A;  2HOD C;  2J0H A;  4R9J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...