1N73C

Fibrin d-dimer, lamprey complexed with the peptide ligand: gly-his-arg-pro-amide
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
322
structure length
322
Chain Sequence
KTVQKILEEVRILEQIGVSHDAQIQELSEMWRVNQQFVTRLQQQLVDIRQTCSRSCQDTTANKISPITGKDCQQVVDNGGKDSGLYYIKPLKAKQPFLVFCEIENGNGWTVIQHRHDGSVNFTRDWVSYREGFGYLAPTLTTEFWLGNEKIHLLTGQQAYRLRIDLTDWENTHRYADYGHFKLTPESDEYRLFYSMYLDGDAGNAFDGFDFGDDPQDKFYTTHLGMLFSTPERDNDKYEGSCAEQDGSGWWMNRCHAGHLNGKYYFGGNYRKTDVEFPYDDGIIWATWHDRWYSLKMTTMKLLPMGRDLSGHGGQQQSKGNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal structure of fragment double-D from cross-linked lamprey fibrin reveals isopeptide linkages across an unexpected D-D interface
pubmed doi rcsb
molecule tags Blood clotting
molecule keywords Fibrin alpha-1 chain
total genus 92
structure length 322
sequence length 322
chains with identical sequence F
ec nomenclature
pdb deposition date 2002-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1n73C03
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 1n73C01
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 1n73C02
1LT9A 1RE4C 1FZBB 1RE3B 2JHIF 4JYOX 2FFDC 1JY2P 2OYIB 1RF0A 2A45I 2JHMF 2Z4EC 1FZFA 1LT9B 1RE3C 2J5ZA 1FZEC 2J0GA 2HLOA 1RE4A 3HUSC 3GHGC 2HLOB 1FZAC 3HUSB 1JY3O 2HPCA 3H32C 1FZCC 4EPUA 1FZEA 1N73B 2Q9IB 2FFDB 3H32B 1N73A 3HUSA 1M1JA 2Q9IA 2J3GA 2HPCC 1FZAB 3GHGA 1FZGB 1FZEB 1FZGA 2J0YA 2Z4EB 2H43B 3E1IC 1M1JB 2J61B 1LTJA 1T3UA 1M1JC 2XNXC 2J0HA 1N86B 4JZCA 2H43A 1RF1A 1RE3A 2XNXB 4M7FA 2JHLF 1LWUA 2J3FA 2OYIC 3BVHC 2H43C 2J3OA 2XNXA 1FICA 1RE4B 1JY2O 2JHKF 3FIBA 2HPCB 2OYHA 2D39A 1LT9C 2J60A 1FIBA 1FZDA 3E1IA 2OYIA 1FZCB 2HODC 1FZGC 1FIDA 2OYHC 1FZAA 4R9JA 2J3FD 1FZFB 1JY3P 1JY2N 3GHGB 2HLOC 2FIBA 4M7HA 1N86C 2HODB 2A45H 1FZCA 1LTJB 3H32A 2HODA 2J1GA 4NYTA 2FFDA 4ZFGA 2Z4EA 2A45G 1RF0C 2JHHC 3BVHA 3BVHB 1JY3N 2J64A 1LTJC 2WNPF 1RF1B 1FZBC 1JC9A 2J2PA 1Z3UA 1Z3SA 2OYHB 2GY7A 1LWUC 1RF1C 1N73C 2Q9IC 2J61A 4R9TA 1FZBA 1W2EA 3E1IB 1LWUB 2J3UA 1N86A 1RF0B 1FZFC
chains in the Genus database with same CATH superfamily
3UIAA 3L75D 4ASWA 3AE7C 2JHIF 3TGUD 3A5TA 1FJKA 2FFDC 1RHZB 2KNCB 3LIDA 2K9JB 4L75A 3CWBG 4BXLA 4H0LB 5KAIH 2KS1B 2Q9IA 1L2PA 4M3LA 3RL0B 1M1JB 3CC4P 5APUA 3P32A 5AVSB 4JPZB 3W68A 2Q3IA 1UIIA 1X79B 3USSA 2P7JA 2AEMA 1QVGO 1IFMA 2JHKF 3W67A 5AVZB 5GTIH 1P84D 1HBWA 5KKZB 1BE3G 1JNMA 2ZYGA 2JDIH 1HVVA 2IDBA 1JOCA 1SQXG 3L71J 2J3FD 4N3YB 1LTJB 4GDOA 2E74D 1LJ2A 1YTZI 2HODA 2FFDA 4XA4A 2Y0DA 1SVFA 1FJPA 4WY4B 1L0NE 1VF5D 5CCGD 2RN0A 3HE5B 2HFED 3EQ2A 5H2FE 1LT1A 3H1JJ 2MKVA 4O9BA 2YKPA 1RF1C 1IFNA 4ZKUA 2M0BA 1FZBA 3CCUP 1NTMG 1LWUB 2J3UA 3F89A 1FZFC 1JTHA 3E1RA 2WSEJ 5GTIE 1BGYD 1S9KE 3G3ZA 3H1KJ 2HLOA 1LTAC 2ZXEB 1KV4A 2YXQB 4EPUA 2OYOA 4H13B 5KJ7A 2WWWA 3B4SA 3AEGC 1LTGC 1Z56A 3O8ZA 3BRVB 1EDLA 1URQD 3SSUA 2B89A 2J0YA 2PP6A 1KMIZ 3ZDMA 3PRJA 2BEZF 1OVVA 4ZMDA 2LXBA 2YIUC 4W80A 4H0LC 1T2KC 1ZR4A 3M0AA 2H43C 4KT0J 3VMXA 2J3OA 1NTZJ 2KLUA 1ZOYC 3L70E 1JB0J 1NTMJ 2P1JA 3E1IA 2NRGA 3L71E 2Z5HA 4M7HA 2H88C 2WSFJ 3MUDA 4IL6X 1SQXK 3H32A 3H1KG 1WMKA 1G2CB 2JWDA 1X0TA 4H13C 2W83C 4LC1A 3OA7A 1Z3UA 1YQ3C 1Z3SA 3CPWO 3H25A 3D6ZA 1N73C 1PFIA 3PP5A 3AEFC 1DD4A 3WU2E 1J1DB 1W5CE 2W27A 1LT9A 4U3FG 1BDDA 2QJPC 1EZVD 2WITA 1YHQP 1L4AB 5AW8B 1FZFA 2J5ZA 1PZQA 5KJ7D 2HLOB 2FXPA 1L4AD 1L4AA 3BRTB 1NTZD 2I1JA 2Q7CA 1FZAB 1LP1B 1OW6A 3M9QA 1EXIA 1S1CX 1GZLA 3H1IJ 4U3FJ 2BCCE 1P84I 1NYHA 3OW2O 3MZWB 2KP8A 4AYCA 2JJLA 4C7RA 1KD1Q 1JO5A 2VRSA 1PP9E 1NU1D 2XNXA 1SQVE 3V2RA 2FKWB 1P84H 1JMMA 1FIBA 5KAFH 3H1JD 2AXTE 4YXWH 1PGJA 4ZNCA 2XKMA 2QJKC 5KLVJ 1N86C 5AVQB 3CWBJ 1OW8A 3N4XA 3CX5I 2V7QJ 1H0TB 1KILC 2N1TB 1FDIA 3Q3DA 4XFJA 3T97A 3OJAB 1RF1B 5AVYB 2IFMA 2GY7A 3HE4A 3RK3C 3BCCJ 3RK2B 1OZHA 3MUDC 1EZVG 2V7QH 1SQQJ 5APWA 1LTSC 1RE3B 2L5GB 2OYIB 1VQMP 2YO3A 5AW6B 5KKZC 2B88A 3G71P 1KILE 1MZ9A 1DIPA 2Y9YA 4OGQB 1QL2A 4GODA 1K9MQ 5CCGA 1BGYG 1FZGA 2FY8A 5TJHA 3RL0C 4I1LA 1Y9BA 3EWKA 4JYBA 1NTMD 3IFMA 1RE3A 4MN4C 4DCKA 2O01H 3WU2H 4I6MC 1X8YA 1UIXA 3RK3B 2QEXP 2Q5UA 4OWFA 1YIJP 3H1JG 1RQVA 1FICA 1RE4B 1T8ZA 1URQB 1LT9C 3H1IG 1KN7A 5AW4B 1N7SB 2KXPB 3BATA 4IL6E 1SQXE 4I7ZC 1KTMA 2JR8A 4RESB 4CPGA 3JC22 3LW5H 1Q90D 1AFOA 3CCLP 1JEKA 1ZV8A 1MFZA 3BVHA 3T97B 2J2PA 1NOHA 3A0BE 4U3FE 2OYHB 2JWAA 1S5LX 2E76C 4HB1A 3A3YB 5KLIC 3D71A 2HG5D 4R4MA 1KYOI 2Q3EA 2OARA 1VQ9P 3VMZA 1JY2P 1CZQA 1GW4A 2WTYA 4H44D 3WUVA 1LNQA 1E5WA 2FYUE 1VQOP 3H1HJ 4IL6H 3CD6P 1FZEA 1N73A 2E42A 1NKNA 2E75C 2PAJA 4W7YA 1S2EA 5CCHD 1LGHB 3B5NA 3G9RA 3AE5C 3TGUG 5CCHC 4GKGA 3CLQA 1PPJE 1SQVK 2GA1A 4HYTB 2Q6QA 1AQ5A 3P8CE 1KB9D 3A0BH 1LWUA 5KLIB 2C9LY 5AVUB 3M9HA 2H8PD 2OTKE 1E79H 1Q86Q 1FZGC 1CW5A 1FZAA 1GU5A 1NTKE 3L75J 2D2CC 2KNCA 5CJ0A 2K1AA 2RKLA 2NPSD 1VF5C 5CCGC 1HUCA 1SQBK 4NYTA 2Z4EA 2IPPA 3ABVC 1J1EC 4LGDE 3KZIE 4OGQD 2J61A 1PL5A 2YKQA 3M0DA 1BCCD 2IBZD 3TF5A 1J1DC 3CX5E 1NH4A 2YMKA 2FBWC 4ASVA 2GM4A 1SQXJ 3BCCD 3HUSB 2P2UA 2HPCA 2W6BA 1FZCC 5APQA 1L0LD 1KYOD 1EC5A 4UB6H 1H0TA 1H89A 3GHGA 2WPRA 1BSHA 4A7PA 2QSIA 1JMBA 1IC2A 3L72J 1URQC 1FOSE 2FXOA 1YI2P 2O01J 4M7FA 3RBXA 2ZVOB 3U1CA 1PV3A 1AVOA 3H1LD 3HTKB 3L73D 1SQPJ 5L8RJ 4IFFA 3H6PA 1DEBA 5AVRB 1BSNA 2P67A 3L75G 1ZLLA 4LLHA 2ITAA 3MD0A 2W6JH 2CPBA 3GHGB 1SQPG 1KORA 1HGZA 3RGUA 2E76B 1LP1A 3PHLA 1QVFO 5AVTB 3HE5A 3P8MC 2WNPF 1GU4A 3AEDC 1USDA 2E74C 1LWUC 1OX3A 3NXSA 3PLNA 3V6IA 2Q9IC 3A0HH 2O3JA 2YXRB 5KTBA 1GL2B 1WRGA 4JYOX 1YITP 2O01N 2FYUD 2J58A 3VP8A 2Y0EA 4IFMA 1RE3C 2PGDA 1IFIA 3AE1C 4Y99B 2YKOA 1GK4A 2ZFCA 1FDMA 3E7KA 2H43B 3E1IC 3KXDA 5B5EE 1MKMA 2YIUB 4JZCA 1N86B 3NTNA 1KILB 2IFNA 1PGQA 4WY4A 2J3FA 3D70A 2P10A 2QJPB 3GF3A 4PD4D 1JTHB 1OFCX 5CBNA 3HTKA 1SFCC 2L91A 2HR3A 3U1AA 3NFQA 1NU1G 2Y9ZA 1T3JA 2R32A 3CXHD 5APSA 2ZXXA 4UB6E 1FZCA 3CCVP 4RJTA 5CJ4A 1K04A 2JHHC 2R44A 2W8ZA 1NAYA 3CI9A 3C8VA 2V4HA 3CXHI 1LTIC 2QA4P 2WSSH 3SFDC 1OW7A 3H1KE 2FYUK 3TYYA 4R9TA 2FXMA 4WY4C 2NPSB 2UWJE 1Q2NA 3M9BA 1BGYE 3AEEC 2LKMA 4DZOA 1IZNB 3TNUB 3VTPC 3L70D 1SFCB 1OWAA 1MFTA 1NKZB 1NTMK 4UB8H 2WPVB 1XTGB 3CWBE 1K73Q 3WUUA 2R3SA 1NJIQ 4I7ZB 1SQBD 3CMAP 3FXDA 3LW5J 4PD4H 4C7NA 3VP9A 4N78D 2AEFA 1NU1E 3L75E 2OYIC 2KLVA 3GLMA 4WB4A 1SQPE 5CHXA 3SWYA 2K88A 3H1IE 1KYOH 2G8YA 3B5NC 1YYCA 2FIBA 1PGPA 1SLQA 3D6YA 1Y8AA 1KQLA 5TISH 4W7ZA 3BASA 3V5BA 2J1GA 1ZR2A 2OQQA 1G1IA 1SQVJ 3V2PA 3HD7C 1HF9A 3KHUA 1CI6A 1YTZT 1KZUB 3S1KA 1L0NJ 5DJTB 2FYNB 1JY3N 3KQGA 3P8CD 1L0NG 2B87B 3AE4C 5KLVG 2QRXA 2JO1A 2I1KA 1QEXA 2WT7A 1P84E 1OVUA 1OMIA 4EIJA 2I8DA 1QX8A 2B9BA 5KAFE 3CL3D 3GMAA 4D6TE 2PFXA 5AW1B 2WT7B 1NTKK 2A45I 2ZYAA 3V2QA 1NTKG 2XU6A 4L74A 4KJMA 4Y99C 2GUSA 3GHGC 2KS1A 1JY3O 1EDKA 3CCMP 4B86A 5BU8B 2HPCC 1BE3D 1VQNP 1FAVA 1FZGB 1VQ7P 1J2JB 1U57A 1LTJA 3C9IA 2ZT9C 4GT1A 3A7OA 2A06D 1VQPP 3EFFK 1PPJG 1EDIA 2XNXB 1LTTC 1M7LA 2N9YB 1EQ7A 3VMAA 3FIBA 3M0DC 1QGKB 2E5TA 2R5DA 1GW3A 3H1HE 3MHVA 1KB9I 1BDCA 1X22A 1JY2N 2E75B 2CK3H 2JP3A 1ZRTD 2HODB 5AW5B 1HJBA 1S3JA 1M8OB 4YPCA 1FC2C 1SQBJ 2IYPA 3CCJP 2LXCB 2ZVNB 3QH9A 1BCCG 3H1KD 1SFCD 1L0LG 4WY4D 3FWNA 1FDOA 4NPDA 1DD3A 4WVZA 4NPEA 2FYZA 2QM7A 2E74B 1RE4C 4Z1MH 1MV8A 3JCUH 4XE5B 1RE4A 2O1KA 3L36A 3CWBD 2KIKA 5CCHA 4JQ0D 3U59A 1N73B 1DX7A 1EDJA 4ZKPA 2DW3A 1NTZE 2QJYC 1SQVG 1AVYA 2Z4EB 3SFEC 1NTME 1KB9E 3I56P 1XTCC 1SQQK 3V2NA 2C0XA 2C0WA 3V4QA 1HJ0A 1SQPK 3JSVC 2SPZA 4RO0A 4C46A 3FWLA 2OYHA 1YJNP 3TGUJ 4Y28J 1ZN5A 3G6EP 3IF4A 1SP4A 1NU1K 1JCCA 3CX5H 3I5CA 3PTZA 3TNUA 4EYYQ 1JY3P 3GW6A 3TK1A 5AW3B 1KC8Q 1N2DC 4KHXA 2BASA 1GL2C 1L0ND 5APTA 2A45G 1FE6A 5AW9B 4PV1C 3VN0A 1QL1A 3Q5PA 4TT3H 1LTJC 3AEAC 1VQ8P 3RK3D 1CI6B 5CBOA 1JUNA 5CMZA 1PP9D 4PD4E 3HE4B 2J59M 3II6A 3E1IB 3L74G 1SQQE 1RH5B 1OXZA 1GD2E 2NPSC 3S9OA 4IFDK 2JHMF 4HJGH 2OTLP 5GTHH 3M91A 3F5HA 2D2CB 2J3GA 2K9JA 1EZVI 5TISE 1EXJA 2IBZG 4U7JA 1YBKA 4U3FD 2WPQA 3MGNA 1A02J 2WSFH 2BCCG 1H8AA 3CCQP 4OGQC 3AE3C 2N9BA 3GG2A 3K5BA 2N1TD 3OAKA 3Q5SA 2WQYC 3L70J 1N7SA 1MUUA 2KZIA 5APXA 3Q2YA 4R9JA 2M8RA 2IZ0A 1YJ9P 3BCCE 4H44C 1FS0E 5KJ7C 2M5AA 3PH0A 3AE6C 3CCSP 2XV5A 2IZ1A 3L74D 3QWOC 2ZAEB 3CC2P 3MP7B 1VF5B 2HYNA 1FOSF 1SS1A 3GF7A 3O6QA 4JYCA 1SQPD 1IK7A 4BRYA 2XZRA 1FU1A 1GL2A 1FZBB 3AE8C 3AEBC 2QM8A 2QVAA 4AQRD 5AVVB 4D6TG 2Z4EC 2KYVA 3TGUE 2E43A 1NTZK 2QJYB 1NAFA 2J0GA 2RMZA 1N7SD 3P7KA 1OIPA 1L0LJ 2D2CD 3L71D 3S4RA 3BCCG 3M06A 3B5NB 3O6QB 4WWIA 1M1JC 1M90Q 2BCCJ 1IO4A 4TLFA 1HGVA 2K3RA 3H1HG 3FX0A 4QMAA 1S4XA 1PPJD 5AW2B 3RL0D 3WUTA 1URQA 2E76D 2IBZE 1BE3J 3CX5D 1Q7YQ 1VQ5P 3AECC 3H1LG 2E75D 5DJUB 2KSJA 4IOIH 2KZJA 2Q1KA 1NO4A 2QG4A 1ZMEC 2PRRA 4GOEA 2H89C 1GK6A 2N1TA 1A02F 5K5GB 2IYOA 1JC9A 2NZ2A 1G2CA 2FYUJ 1Q81Q 3R2PA 4NPFX 3FXEA 5M1BA 2R3CA 3KYQA 1KILD 4JF7A 1SQVD 2N1TC 3PJSK 1LT9B 3VOPA 3H1JE 1FZAC 1VQLP 3LIEA 1AQTA 1N8RQ 5KLVD 1S5LE 3HRNA 1LTBC 3H32B 5AW0B 1K8AQ 1IJDB 1OVRA 1FZEB 2G3AA 5H2FH 1GL2D 1T3UA 1PIXA 3KZIH 2J0HA 2YNYA 4HH2A 3VMYA 2JEEA 2P58A 1KFNA 2OGUA 1DH3A 2WPSA 4RKUJ 2WSEH 3SWFA 3H1ID 3L72E 2J60A 2ZT9B 1FZDA 1SFCA 3IAOA 4D6TJ 1FZCB 3CMEP 1L0LE 2OYHC 1TU3F 5E79H 1DEEG 1PP9J 4L76A 5GTHE 1YQ4C 3L70G 4BWNA 5APYA 1PP9G 1RY3A 1G1JA 1S5LH 1KFMA 5KAIE 3L74E 4ZFGA 1L0NK 1Q82Q 1J1EB 1GTWA 4C7NB 1N7LA 3Q1MA 1U7JA 1S72P 1SQBE 3NMDA 1YJWP 3L73E 1BCCJ 2H7HA 3KPEA 3CCRP 4H13D 4N78E 4D6TD 1RF0B 4HKZH 1VQKP 4BRYB 1AJYA 2YMYA 1RF0A 5BU5A 2AXTH 3HUSC 2QE7H 2WMMA 3B71A 2O1JA 1WT6A 1VQ6P 4PJ0H 2Q9IB 2WZ7A 3HUSA 1M1KQ 3IN6A 3L4FA 5AVXB 1W2BO 3L37A 3CC7P 5AVWB 3N7NA 4I2LC 3RK3E 3RL0g 2R5BA 3Q5RA 2B87A 4H0LD 1HWTC 2XNXC 2AXCA 3A0HE 1RF1A 2BCCD 2JHLF 3RK2C 2KOGA 1SQQD 1N7SC 1SQBG 5B66E 1RQUA 2D39A 1D7MA 1M57D 4GOFA 2HODC 1FIDA 1NTKJ 4GIFA 2KSEA 1R5LA 1L4AC 1IK9A 3VYIA 1USEA 3HD7D 2Y0CA 1PGOA 2E5YA 3FGAD 2IBZI 4OH8B 3G4SP 5C39A 4JBZA 2YO2A 1H88A 2FYNC 3L73J 1BCCE 1W2EA 2NPSA 3RBZA 1N86A 3AE9C 2Z5IA 3H1LE 4K3AA 2XNDH 1VPCA 1JCDA 4EOTA 3L73G 5KLVE 1FZEC 2W90A 1KYOE 2KI7B 4DJGA 1NTZG 3H32C 1M56D 2LR2A 2M5AB 2FFDB 1M1JA 5AW7B 2CPSA 4PD4I 1GMJA 4K35A 2IX7C 2ZT9D 4H44B 3TDKA 1X9VA 1SQQG 2QJKB 2H43A 1T2KD 4OVNF 1FBMA 1ZP0C 3B5ND 1NHLA 1IFDA 2WSCH 2OTJP 2KUBA 4L73A 3L72D 1JY2O 4YXDC 1VQ4P 1K05A 1L0LK 3L71G 4UB8E 1FZFB 1EZVE 3V4WA 1ZW0A 5KLVK 2C9NY 5EFWB 2JKVA 1SQXD 1IFJA 4PV1B 3L74J 2WVRA 4DT0A 1RF0C 3BVHB 4PV1D 1GDTA 2J64A 1IFPA 1NWQA 3B8EB 5B5EH 1AA0A 1VDFA 5B66H 1CSBA 2FYUG 2J5UA 3L35A 5APVA 1QLED 2AEJA 2WSCJ 4N6JA 1KQGB 2K37A 3CXHH 1R8EA 1NVOA 4WBAA 1ZXGA 3ITKA 1S9KD 3A2AA 1NU1J 2K9YA 5E79E 2RH0A 3MTUE 2BEQD 3HD7B 1BGYJ 2ZJSE 1KQFB 4EDFA 1U7MA 3HD7A 2QIWA 3SWKA 2J61B 3L72G 1T6AA 1JM0A 2MJZA 1AV1A 3RK2D 1KILA 2A06E 2KB7P 3BVHC 3KDPB 2XDJA 1R5SA 2POHA 4YTPC 3MIWA 2HPCB 4DOJA 2KK7A 3H1LJ 3CXHE 2OYIA 1Y47A 3R4YA 3CCEP 1VL2A 1HH0A 3AE2C 2HLOC 3IR9A 3JCUE 3H1HD 2A45H 1BE3E 3WMM0 2M3BA 1HTLC 4AUWA 1NTKD 3C1LA 4EI2A 1ZRTE 2GUVA 4PJ0E 2ZYDA 1KQSO 1NGMB 3TSIA 5BVZA 1FZBC 3I55P 2M3EA 2W6AA 1KB9H 3EFGA 2A06G 4R4LA
chains in the Genus database with same CATH topology
3UIAA 3CL3D 3VMZA 2JHIF 3A5TA 1FJKA 1KILD 2FFDC 1JY2P 1CZQA 5AW1B 1NTKK 4JF7A 2WT7B 1GW4A 2WTYA 2A45I 2N1TC 3V2QA 2XU6A 1LT9B 4Y99C 3VOPA 2GUSA 3GHGC 1FZAC 1E5WA 1JY3O 3LIEA 3HRNA 3LIDA 1LTBC 1FZEA 4B86A 3H32B 1N73A 5BU8B 2Q9IA 2E42A 5AW0B 1NKNA 2HPCC 4M3LA 1IJDB 2PAJA 1FAVA 4W7YA 1FZGB 5CCHD 1FZEB 1LGHB 3RL0B 3B5NA 1J2JB 1GL2D 1M1JB 1LTJA 1T3UA 3C9IA 5APUA 5CCHC 4GKGA 3CLQA 4GT1A 1SQVK 3A7OA 3P32A 2J0HA 2YNYA 4HYTB 4HH2A 5AVSB 1AQ5A 2Q3IA 3P8CE 2XNXB 1X79B 3VMYA 2JEEA 2P7JA 1LWUA 1LTTC 2C9LY 1KFNA 5AVUB 3M9HA 1M7LA 1DH3A 1EQ7A 2WPSA 1IFMA 2WSEH 3SWFA 2JHKF 2H8PD 5AVZB 3FIBA 3M0DC 1HBWA 2J60A 1FZDA 2R5DA 1SFCA 1JNMA 1GW3A 1FZCB 1HVVA 1FZGC 2OYHC 1CW5A 1FZAA 1GU5A 1JOCA 2J3FD 1JY2N 4N3YB 2HODB 5AW5B 1HJBA 5CJ0A 1LTJB 5APYA 1RY3A 1G1JA 1KFMA 1YTZI 2NPSD 5CCGC 1HUCA 1SQBK 2HODA 4NYTA 2FFDA 4XA4A 4ZFGA 2Z4EA 1SVFA 2IPPA 1L0NK 1FJPA 1J1EB 4WY4B 1GTWA 5CCGD 1J1EC 4LGDE 3HE5B 2HFED 3EQ2A 4C7NB 1SFCD 1N7LA 4O9BA 4WY4D 2YKPA 1RF1C 1IFNA 4ZKUA 3NMDA 2J61A 1FZBA 2H7HA 3KPEA 2FYZA 2QM7A 1LWUB 4N78E 2YKQA 2J3UA 1RF0B 3M0DA 1FZFC 1JTHA 1RE4C 1J1DC 1NH4A 1RF0A 2YMYA 1S9KE 2GM4A 5BU5A 3G3ZA 1MV8A 2HLOA 4XE5B 1RE4A 3HUSC 2O1KA 1LTAC 3HUSB 2P2UA 2ZXEB 2HPCA 3L36A 2O1JA 2W6BA 1FZCC 5APQA 5CCHA 4EPUA 1WT6A 3U59A 1N73B 5KJ7A 2WWWA 1DX7A 2WZ7A 2Q9IB 3HUSA 1LTGC 1Z56A 1H89A 3O8ZA 3BRVB 1URQD 3L4FA 4ZKPA 3GHGA 5AVXB 2WPRA 3L37A 2J0YA 5AVWB 2Z4EB 3N7NA 2PP6A 4I2LC 2R5BA 1IC2A 1HWTC 1URQC 1FOSE 2XNXC 1XTCC 1RF1A 1SQQK 4W80A 3V2NA 2JHLF 3RK2C 4M7FA 3U1CA 2KOGA 2C0XA 2C0WA 1N7SC 1T2KC 1ZR4A 3M0AA 3V4QA 2H43C 1SQPK 3VMXA 2J3OA 3HTKB 4C46A 4IFFA 2OYHA 2D39A 3H6PA 1ZN5A 1DEBA 5AVRB 2P1JA 1SP4A 2P67A 3E1IA 1NU1K 1JCCA 1ZLLA 4LLHA 2HODC 3I5CA 1FIDA 3MD0A 3TNUA 1JY3P 2CPBA 4GIFA 3GHGB 2Z5HA 4M7HA 3MUDA 1SQXK 1L4AC 3H32A 3TK1A 1HGZA 5AW3B 1IK9A 1N2DC 4KHXA 2BASA 3VYIA 1GL2C 5APTA 3HD7D 2A45G 5AW9B 3VN0A 1G2CB 1QL1A 5AVTB 3HE5A 1LTJC 4LC1A 3P8MC 2WNPF 3OA7A 3RK3D 1Z3UA 1CI6B 4OH8B 1GU4A 1Z3SA 5CMZA 1JUNA 1LWUC 2YO2A 3HE4B 3NXSA 1N73C 2Q9IC 1PFIA 3PP5A 1H88A 2J59M 1W2EA 2NPSA 3II6A 3E1IB 1J1DB 1N86A 2W27A 1LT9A 2Z5IA 1OXZA 1GL2B 1WRGA 5KTBA 1GD2E 4JYOX 2NPSC 4IFDK 1VPCA 1JCDA 2WITA 1L4AB 5AW8B 2JHMF 2J58A 4EOTA 1FZFA 3VP8A 4IFMA 1RE3C 2J5ZA 1FZEC 5KJ7D 2HLOB 1IFIA 1L4AD 1L4AA 4Y99B 3H32C 2YKOA 1GK4A 3M91A 2ZFCA 3BRTB 1FDMA 2FFDB 1M1JA 2J3GA 2I1JA 5AW7B 2Q7CA 1FZAB 2CPSA 3M9QA 2IX7C 2H43B 3E1IC 1GZLA 2WPQA 3MGNA 1X9VA 1N86B 1A02J 4JZCA 3NTNA 2H43A 2WSFH 2KP8A 1T2KD 4AYCA 1KILB 1FBMA 2IFNA 1H8AA 3B5ND 1NHLA 2JJLA 4WY4A 4C7RA 1JO5A 2J3FA 1IFDA 2WSCH 2VRSA 1JTHB 2XNXA 1JY2O 1SFCC 2N9BA 3HTKA 3V2RA 2FKWB 3U1AA 2N1TD 1JMMA 3OAKA 1N7SA 1FIBA 3NFQA 1MUUA 1T3JA 1L0LK 5APXA 4R9JA 1FZFB 2XKMA 2R32A 2M8RA 5APSA 1N86C 5AVQB 3V4WA 1FZCA 5KJ7C 3N4XA 5KLVK 2C9NY 1IFJA 1KILC 5CJ4A 1RF0C 2JHHC 2N1TB 2XV5A 3BVHB 3CI9A 3T97A 3OJAB 1GDTA 2J64A 1RF1B 1NWQA 3B8EB 1LTIC 5AVYB 2IFMA 2HYNA 1FOSF 2GY7A 3TYYA 2FYUK 4JYCA 3HE4A 3RK3C 4R9TA 1VDFA 2FXMA 1CSBA 3RK2B 2XZRA 4WY4C 1FU1A 2NPSB 3L35A 5APVA 3M9BA 5APWA 4N6JA 1GL2A 1LTSC 2LKMA 1FZBB 1RE3B 2L5GB 2QM8A 2OYIB 4AQRD 5AVVB 2YO3A 5AW6B 4DZOA 2Z4EC 2KYVA 4WBAA 3TNUB 2E43A 1NTZK 1NAFA 3VTPC 2J0GA 1SFCB 1MZ9A 1OWAA 1N7SD 1S9KD 3A2AA 1NKZB 3P7KA 1NTMK 1QL2A 3MTUE 1XTGB 3HD7B 3M06A 5CCGA 3B5NB 1FZGA 3HD7A 2J61B 1M1JC 1IO4A 1HGVA 2MJZA 3RL0C 4I1LA 4JYBA 3RK2D 4C7NA 3IFMA 3VP9A 1RE3A 5AW2B 4N78D 1KILA 2O01H 4I6MC 3RL0D 1X8YA 2KB7P 1URQA 3RK3B 2OYIC 3BVHC 2KLVA 2Q5UA 3KDPB 4WB4A 2XDJA 1FICA 2POHA 1RE4B 1T8ZA 5CHXA 3SWYA 1URQB 2HPCB 3MIWA 1LT9C 4DOJA 5AW4B 1N7SB 2OYIA 3BATA 3B5NC 1YYCA 2KSJA 1HH0A 2HLOC 2FIBA 3IR9A 2A45H 3WMM0 2M3BA 4RESB 1HTLC 1SLQA 1KQLA 4AUWA 3LW5H 1NO4A 1AFOA 2GUVA 4W7ZA 3BASA 3V5BA 2J1GA 1ZR2A 1G1IA 1ZV8A 3V2PA 1MFZA 3BVHA 3HD7C 3TSIA 1CI6A 1GK6A 2N1TA 1YTZT 5BVZA 1KZUB 1A02F 1JY3N 3KQGA 3P8CD 1FZBC 1JC9A 2J2PA 1NOHA 1G2CA 2W6AA 2OYHB 3EFGA 3A3YB 3R2PA 2I1KA 2WT7A 4EIJA 2HG5D 2R3CA 3KYQA 2OARA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LT9 A;  1RE4 C;  1FZB B;  1RE3 B;  2JHI F;  4JYO X;  2FFD C;  1JY2 P;  2OYI B;  1RF0 A;  2A45 I;  2JHM F;  2Z4E C;  1FZF A;  1LT9 B;  1RE3 C;  2J5Z A;  1FZE C;  2J0G A;  2HLO A;  1RE4 A;  3HUS C;  3GHG C;  2HLO B;  1FZA C;  3HUS B;  1JY3 O;  2HPC A;  3H32 C;  1FZC C;  4EPU A;  1FZE A;  1N73 B;  2Q9I B;  2FFD B;  3H32 B;  1N73 A;  3HUS A;  1M1J A;  2Q9I A;  2J3G A;  2HPC C;  1FZA B;  3GHG A;  1FZG B;  1FZE B;  1FZG A;  2J0Y A;  2Z4E B;  2H43 B;  3E1I C;  1M1J B;  2J61 B;  1LTJ A;  1T3U A;  1M1J C;  2XNX C;  2J0H A;  1N86 B;  4JZC A;  2H43 A;  1RF1 A;  1RE3 A;  2XNX B;  4M7F A;  2JHL F;  1LWU A;  2J3F A;  2OYI C;  3BVH C;  2H43 C;  2J3O A;  2XNX A;  1FIC A;  1RE4 B;  1JY2 O;  2JHK F;  3FIB A;  2HPC B;  2OYH A;  2D39 A;  1LT9 C;  2J60 A;  1FIB A;  1FZD A;  3E1I A;  2OYI A;  1FZC B;  2HOD C;  1FZG C;  1FID A;  2OYH C;  1FZA A;  4R9J A;  2J3F D;  1FZF B;  1JY3 P;  1JY2 N;  3GHG B;  2HLO C;  2FIB A;  4M7H A;  1N86 C;  2HOD B;  2A45 H;  1FZC A;  1LTJ B;  3H32 A;  2HOD A;  2J1G A;  4NYT A;  2FFD A;  4ZFG A;  2Z4E A;  2A45 G;  1RF0 C;  2JHH C;  3BVH A;  3BVH B;  1JY3 N;  2J64 A;  1LTJ C;  2WNP F;  1RF1 B;  1FZB C;  1JC9 A;  2J2P A;  1Z3U A;  1Z3S A;  2OYH B;  2GY7 A;  1LWU C;  1RF1 C;  1N73 C;  2Q9I C;  2J61 A;  4R9T A;  1FZB A;  1W2E A;  3E1I B;  1LWU B;  2J3U A;  1N86 A;  1RF0 B;  1FZF C; 
#chains in the Genus database with same CATH topology
 3UIA A;  3L75 D;  4ASW A;  3AE7 C;  2JHI F;  3TGU D;  3A5T A;  1FJK A;  2FFD C;  1RHZ B;  2KNC B;  3LID A;  2K9J B;  4L75 A;  3CWB G;  4BXL A;  4H0L B;  5KAI H;  2KS1 B;  2Q9I A;  1L2P A;  4M3L A;  3RL0 B;  1M1J B;  3CC4 P;  5APU A;  3P32 A;  5AVS B;  4JPZ B;  3W68 A;  2Q3I A;  1UII A;  1X79 B;  3USS A;  2P7J A;  2AEM A;  1QVG O;  1IFM A;  2JHK F;  3W67 A;  5AVZ B;  5GTI H;  1P84 D;  1HBW A;  5KKZ B;  1BE3 G;  1JNM A;  2ZYG A;  2JDI H;  1HVV A;  2IDB A;  1JOC A;  1SQX G;  3L71 J;  2J3F D;  4N3Y B;  1LTJ B;  4GDO A;  2E74 D;  1LJ2 A;  1YTZ I;  2HOD A;  2FFD A;  4XA4 A;  2Y0D A;  1SVF A;  1FJP A;  4WY4 B;  1L0N E;  1VF5 D;  5CCG D;  2RN0 A;  3HE5 B;  2HFE D;  3EQ2 A;  5H2F E;  1LT1 A;  3H1J J;  2MKV A;  4O9B A;  2YKP A;  1RF1 C;  1IFN A;  4ZKU A;  2M0B A;  1FZB A;  3CCU P;  1NTM G;  1LWU B;  2J3U A;  3F89 A;  1FZF C;  1JTH A;  3E1R A;  2WSE J;  5GTI E;  1BGY D;  1S9K E;  3G3Z A;  3H1K J;  2HLO A;  1LTA C;  2ZXE B;  1KV4 A;  2YXQ B;  4EPU A;  2OYO A;  4H13 B;  5KJ7 A;  2WWW A;  3B4S A;  3AEG C;  1LTG C;  1Z56 A;  3O8Z A;  3BRV B;  1EDL A;  1URQ D;  3SSU A;  2B89 A;  2J0Y A;  2PP6 A;  1KMI Z;  3ZDM A;  3PRJ A;  2BEZ F;  1OVV A;  4ZMD A;  2LXB A;  2YIU C;  4W80 A;  4H0L C;  1T2K C;  1ZR4 A;  3M0A A;  2H43 C;  4KT0 J;  3VMX A;  2J3O A;  1NTZ J;  2KLU A;  1ZOY C;  3L70 E;  1JB0 J;  1NTM J;  2P1J A;  3E1I A;  2NRG A;  3L71 E;  2Z5H A;  4M7H A;  2H88 C;  2WSF J;  3MUD A;  4IL6 X;  1SQX K;  3H32 A;  3H1K G;  1WMK A;  1G2C B;  2JWD A;  1X0T A;  4H13 C;  2W83 C;  4LC1 A;  3OA7 A;  1Z3U A;  1YQ3 C;  1Z3S A;  3CPW O;  3H25 A;  3D6Z A;  1N73 C;  1PFI A;  3PP5 A;  3AEF C;  1DD4 A;  3WU2 E;  1J1D B;  1W5C E;  2W27 A;  1LT9 A;  4U3F G;  1BDD A;  2QJP C;  1EZV D;  2WIT A;  1YHQ P;  1L4A B;  5AW8 B;  1FZF A;  2J5Z A;  1PZQ A;  5KJ7 D;  2HLO B;  2FXP A;  1L4A D;  1L4A A;  3BRT B;  1NTZ D;  2I1J A;  2Q7C A;  1FZA B;  1LP1 B;  1OW6 A;  3M9Q A;  1EXI A;  1S1C X;  1GZL A;  3H1I J;  4U3F J;  2BCC E;  1P84 I;  1NYH A;  3OW2 O;  3MZW B;  2KP8 A;  4AYC A;  2JJL A;  4C7R A;  1KD1 Q;  1JO5 A;  2VRS A;  1PP9 E;  1NU1 D;  2XNX A;  1SQV E;  3V2R A;  2FKW B;  1P84 H;  1JMM A;  1FIB A;  5KAF H;  3H1J D;  2AXT E;  4YXW H;  1PGJ A;  4ZNC A;  2XKM A;  2QJK C;  5KLV J;  1N86 C;  5AVQ B;  3CWB J;  1OW8 A;  3N4X A;  3CX5 I;  2V7Q J;  1H0T B;  1KIL C;  2N1T B;  1FDI A;  3Q3D A;  4XFJ A;  3T97 A;  3OJA B;  1RF1 B;  5AVY B;  2IFM A;  2GY7 A;  3HE4 A;  3RK3 C;  3BCC J;  3RK2 B;  1OZH A;  3MUD C;  1EZV G;  2V7Q H;  1SQQ J;  5APW A;  1LTS C;  1RE3 B;  2L5G B;  2OYI B;  1VQM P;  2YO3 A;  5AW6 B;  5KKZ C;  2B88 A;  3G71 P;  1KIL E;  1MZ9 A;  1DIP A;  2Y9Y A;  4OGQ B;  1QL2 A;  4GOD A;  1K9M Q;  5CCG A;  1BGY G;  1FZG A;  2FY8 A;  5TJH A;  3RL0 C;  4I1L A;  1Y9B A;  3EWK A;  4JYB A;  1NTM D;  3IFM A;  1RE3 A;  4MN4 C;  4DCK A;  2O01 H;  3WU2 H;  4I6M C;  1X8Y A;  1UIX A;  3RK3 B;  2QEX P;  2Q5U A;  4OWF A;  1YIJ P;  3H1J G;  1RQV A;  1FIC A;  1RE4 B;  1T8Z A;  1URQ B;  1LT9 C;  3H1I G;  1KN7 A;  5AW4 B;  1N7S B;  2KXP B;  3BAT A;  4IL6 E;  1SQX E;  4I7Z C;  1KTM A;  2JR8 A;  4RES B;  4CPG A;  3JC2 2;  3LW5 H;  1Q90 D;  1AFO A;  3CCL P;  1JEK A;  1ZV8 A;  1MFZ A;  3BVH A;  3T97 B;  2J2P A;  1NOH A;  3A0B E;  4U3F E;  2OYH B;  2JWA A;  1S5L X;  2E76 C;  4HB1 A;  3A3Y B;  5KLI C;  3D71 A;  2HG5 D;  4R4M A;  1KYO I;  2Q3E A;  2OAR A;  1VQ9 P;  3VMZ A;  1JY2 P;  1CZQ A;  1GW4 A;  2WTY A;  4H44 D;  3WUV A;  1LNQ A;  1E5W A;  2FYU E;  1VQO P;  3H1H J;  4IL6 H;  3CD6 P;  1FZE A;  1N73 A;  2E42 A;  1NKN A;  2E75 C;  2PAJ A;  4W7Y A;  1S2E A;  5CCH D;  1LGH B;  3B5N A;  3G9R A;  3AE5 C;  3TGU G;  5CCH C;  4GKG A;  3CLQ A;  1PPJ E;  1SQV K;  2GA1 A;  4HYT B;  2Q6Q A;  1AQ5 A;  3P8C E;  1KB9 D;  3A0B H;  1LWU A;  5KLI B;  2C9L Y;  5AVU B;  3M9H A;  2H8P D;  2OTK E;  1E79 H;  1Q86 Q;  1FZG C;  1CW5 A;  1FZA A;  1GU5 A;  1NTK E;  3L75 J;  2D2C C;  2KNC A;  5CJ0 A;  2K1A A;  2RKL A;  2NPS D;  1VF5 C;  5CCG C;  1HUC A;  1SQB K;  4NYT A;  2Z4E A;  2IPP A;  3ABV C;  1J1E C;  4LGD E;  3KZI E;  4OGQ D;  2J61 A;  1PL5 A;  2YKQ A;  3M0D A;  1BCC D;  2IBZ D;  3TF5 A;  1J1D C;  3CX5 E;  1NH4 A;  2YMK A;  2FBW C;  4ASV A;  2GM4 A;  1SQX J;  3BCC D;  3HUS B;  2P2U A;  2HPC A;  2W6B A;  1FZC C;  5APQ A;  1L0L D;  1KYO D;  1EC5 A;  4UB6 H;  1H0T A;  1H89 A;  3GHG A;  2WPR A;  1BSH A;  4A7P A;  2QSI A;  1JMB A;  1IC2 A;  3L72 J;  1URQ C;  1FOS E;  2FXO A;  1YI2 P;  2O01 J;  4M7F A;  3RBX A;  2ZVO B;  3U1C A;  1PV3 A;  1AVO A;  3H1L D;  3HTK B;  3L73 D;  1SQP J;  5L8R J;  4IFF A;  3H6P A;  1DEB A;  5AVR B;  1BSN A;  2P67 A;  3L75 G;  1ZLL A;  4LLH A;  2ITA A;  3MD0 A;  2W6J H;  2CPB A;  3GHG B;  1SQP G;  1KOR A;  1HGZ A;  3RGU A;  2E76 B;  1LP1 A;  3PHL A;  1QVF O;  5AVT B;  3HE5 A;  3P8M C;  2WNP F;  1GU4 A;  3AED C;  1USD A;  2E74 C;  1LWU C;  1OX3 A;  3NXS A;  3PLN A;  3V6I A;  2Q9I C;  3A0H H;  2O3J A;  2YXR B;  5KTB A;  1GL2 B;  1WRG A;  4JYO X;  1YIT P;  2O01 N;  2FYU D;  2J58 A;  3VP8 A;  2Y0E A;  4IFM A;  1RE3 C;  2PGD A;  1IFI A;  3AE1 C;  4Y99 B;  2YKO A;  1GK4 A;  2ZFC A;  1FDM A;  3E7K A;  2H43 B;  3E1I C;  3KXD A;  5B5E E;  1MKM A;  2YIU B;  4JZC A;  1N86 B;  3NTN A;  1KIL B;  2IFN A;  1PGQ A;  4WY4 A;  2J3F A;  3D70 A;  2P10 A;  2QJP B;  3GF3 A;  4PD4 D;  1JTH B;  1OFC X;  5CBN A;  3HTK A;  1SFC C;  2L91 A;  2HR3 A;  3U1A A;  3NFQ A;  1NU1 G;  2Y9Z A;  1T3J A;  2R32 A;  3CXH D;  5APS A;  2ZXX A;  4UB6 E;  1FZC A;  3CCV P;  4RJT A;  5CJ4 A;  1K04 A;  2JHH C;  2R44 A;  2W8Z A;  1NAY A;  3CI9 A;  3C8V A;  2V4H A;  3CXH I;  1LTI C;  2QA4 P;  2WSS H;  3SFD C;  1OW7 A;  3H1K E;  2FYU K;  3TYY A;  4R9T A;  2FXM A;  4WY4 C;  2NPS B;  2UWJ E;  1Q2N A;  3M9B A;  1BGY E;  3AEE C;  2LKM A;  4DZO A;  1IZN B;  3TNU B;  3VTP C;  3L70 D;  1SFC B;  1OWA A;  1MFT A;  1NKZ B;  1NTM K;  4UB8 H;  2WPV B;  1XTG B;  3CWB E;  1K73 Q;  3WUU A;  2R3S A;  1NJI Q;  4I7Z B;  1SQB D;  3CMA P;  3FXD A;  3LW5 J;  4PD4 H;  4C7N A;  3VP9 A;  4N78 D;  2AEF A;  1NU1 E;  3L75 E;  2OYI C;  2KLV A;  3GLM A;  4WB4 A;  1SQP E;  5CHX A;  3SWY A;  2K88 A;  3H1I E;  1KYO H;  2G8Y A;  3B5N C;  1YYC A;  2FIB A;  1PGP A;  1SLQ A;  3D6Y A;  1Y8A A;  1KQL A;  5TIS H;  4W7Z A;  3BAS A;  3V5B A;  2J1G A;  1ZR2 A;  2OQQ A;  1G1I A;  1SQV J;  3V2P A;  3HD7 C;  1HF9 A;  3KHU A;  1CI6 A;  1YTZ T;  1KZU B;  3S1K A;  1L0N J;  5DJT B;  2FYN B;  1JY3 N;  3KQG A;  3P8C D;  1L0N G;  2B87 B;  3AE4 C;  5KLV G;  2QRX A;  2JO1 A;  2I1K A;  1QEX A;  2WT7 A;  1P84 E;  1OVU A;  1OMI A;  4EIJ A;  2I8D A;  1QX8 A;  2B9B A;  5KAF E;  3CL3 D;  3GMA A;  4D6T E;  2PFX A;  5AW1 B;  2WT7 B;  1NTK K;  2A45 I;  2ZYA A;  3V2Q A;  1NTK G;  2XU6 A;  4L74 A;  4KJM A;  4Y99 C;  2GUS A;  3GHG C;  2KS1 A;  1JY3 O;  1EDK A;  3CCM P;  4B86 A;  5BU8 B;  2HPC C;  1BE3 D;  1VQN P;  1FAV A;  1FZG B;  1VQ7 P;  1J2J B;  1U57 A;  1LTJ A;  3C9I A;  2ZT9 C;  4GT1 A;  3A7O A;  2A06 D;  1VQP P;  3EFF K;  1PPJ G;  1EDI A;  2XNX B;  1LTT C;  1M7L A;  2N9Y B;  1EQ7 A;  3VMA A;  3FIB A;  3M0D C;  1QGK B;  2E5T A;  2R5D A;  1GW3 A;  3H1H E;  3MHV A;  1KB9 I;  1BDC A;  1X22 A;  1JY2 N;  2E75 B;  2CK3 H;  2JP3 A;  1ZRT D;  2HOD B;  5AW5 B;  1HJB A;  1S3J A;  1M8O B;  4YPC A;  1FC2 C;  1SQB J;  2IYP A;  3CCJ P;  2LXC B;  2ZVN B;  3QH9 A;  1BCC G;  3H1K D;  1SFC D;  1L0L G;  4WY4 D;  3FWN A;  1FDO A;  4NPD A;  1DD3 A;  4WVZ A;  4NPE A;  2FYZ A;  2QM7 A;  2E74 B;  1RE4 C;  4Z1M H;  1MV8 A;  3JCU H;  4XE5 B;  1RE4 A;  2O1K A;  3L36 A;  3CWB D;  2KIK A;  5CCH A;  4JQ0 D;  3U59 A;  1N73 B;  1DX7 A;  1EDJ A;  4ZKP A;  2DW3 A;  1NTZ E;  2QJY C;  1SQV G;  1AVY A;  2Z4E B;  3SFE C;  1NTM E;  1KB9 E;  3I56 P;  1XTC C;  1SQQ K;  3V2N A;  2C0X A;  2C0W A;  3V4Q A;  1HJ0 A;  1SQP K;  3JSV C;  2SPZ A;  4RO0 A;  4C46 A;  3FWL A;  2OYH A;  1YJN P;  3TGU J;  4Y28 J;  1ZN5 A;  3G6E P;  3IF4 A;  1SP4 A;  1NU1 K;  1JCC A;  3CX5 H;  3I5C A;  3PTZ A;  3TNU A;  4EYY Q;  1JY3 P;  3GW6 A;  3TK1 A;  5AW3 B;  1KC8 Q;  1N2D C;  4KHX A;  2BAS A;  1GL2 C;  1L0N D;  5APT A;  2A45 G;  1FE6 A;  5AW9 B;  4PV1 C;  3VN0 A;  1QL1 A;  3Q5P A;  4TT3 H;  1LTJ C;  3AEA C;  1VQ8 P;  3RK3 D;  1CI6 B;  5CBO A;  1JUN A;  5CMZ A;  1PP9 D;  4PD4 E;  3HE4 B;  2J59 M;  3II6 A;  3E1I B;  3L74 G;  1SQQ E;  1RH5 B;  1OXZ A;  1GD2 E;  2NPS C;  3S9O A;  4IFD K;  2JHM F;  4HJG H;  2OTL P;  5GTH H;  3M91 A;  3F5H A;  2D2C B;  2J3G A;  2K9J A;  1EZV I;  5TIS E;  1EXJ A;  2IBZ G;  4U7J A;  1YBK A;  4U3F D;  2WPQ A;  3MGN A;  1A02 J;  2WSF H;  2BCC G;  1H8A A;  3CCQ P;  4OGQ C;  3AE3 C;  2N9B A;  3GG2 A;  3K5B A;  2N1T D;  3OAK A;  3Q5S A;  2WQY C;  3L70 J;  1N7S A;  1MUU A;  2KZI A;  5APX A;  3Q2Y A;  4R9J A;  2M8R A;  2IZ0 A;  1YJ9 P;  3BCC E;  4H44 C;  1FS0 E;  5KJ7 C;  2M5A A;  3PH0 A;  3AE6 C;  3CCS P;  2XV5 A;  2IZ1 A;  3L74 D;  3QWO C;  2ZAE B;  3CC2 P;  3MP7 B;  1VF5 B;  2HYN A;  1FOS F;  1SS1 A;  3GF7 A;  3O6Q A;  4JYC A;  1SQP D;  1IK7 A;  4BRY A;  2XZR A;  1FU1 A;  1GL2 A;  1FZB B;  3AE8 C;  3AEB C;  2QM8 A;  2QVA A;  4AQR D;  5AVV B;  4D6T G;  2Z4E C;  2KYV A;  3TGU E;  2E43 A;  1NTZ K;  2QJY B;  1NAF A;  2J0G A;  2RMZ A;  1N7S D;  3P7K A;  1OIP A;  1L0L J;  2D2C D;  3L71 D;  3S4R A;  3BCC G;  3M06 A;  3B5N B;  3O6Q B;  4WWI A;  1M1J C;  1M90 Q;  2BCC J;  1IO4 A;  4TLF A;  1HGV A;  2K3R A;  3H1H G;  3FX0 A;  4QMA A;  1S4X A;  1PPJ D;  5AW2 B;  3RL0 D;  3WUT A;  1URQ A;  2E76 D;  2IBZ E;  1BE3 J;  3CX5 D;  1Q7Y Q;  1VQ5 P;  3AEC C;  3H1L G;  2E75 D;  5DJU B;  2KSJ A;  4IOI H;  2KZJ A;  2Q1K A;  1NO4 A;  2QG4 A;  1ZME C;  2PRR A;  4GOE A;  2H89 C;  1GK6 A;  2N1T A;  1A02 F;  5K5G B;  2IYO A;  1JC9 A;  2NZ2 A;  1G2C A;  2FYU J;  1Q81 Q;  3R2P A;  4NPF X;  3FXE A;  5M1B A;  2R3C A;  3KYQ A;  1KIL D;  4JF7 A;  1SQV D;  2N1T C;  3PJS K;  1LT9 B;  3VOP A;  3H1J E;  1FZA C;  1VQL P;  3LIE A;  1AQT A;  1N8R Q;  5KLV D;  1S5L E;  3HRN A;  1LTB C;  3H32 B;  5AW0 B;  1K8A Q;  1IJD B;  1OVR A;  1FZE B;  2G3A A;  5H2F H;  1GL2 D;  1T3U A;  1PIX A;  3KZI H;  2J0H A;  2YNY A;  4HH2 A;  3VMY A;  2JEE A;  2P58 A;  1KFN A;  2OGU A;  1DH3 A;  2WPS A;  4RKU J;  2WSE H;  3SWF A;  3H1I D;  3L72 E;  2J60 A;  2ZT9 B;  1FZD A;  1SFC A;  3IAO A;  4D6T J;  1FZC B;  3CME P;  1L0L E;  2OYH C;  1TU3 F;  5E79 H;  1DEE G;  1PP9 J;  4L76 A;  5GTH E;  1YQ4 C;  3L70 G;  4BWN A;  5APY A;  1PP9 G;  1RY3 A;  1G1J A;  1S5L H;  1KFM A;  5KAI E;  3L74 E;  4ZFG A;  1L0N K;  1Q82 Q;  1J1E B;  1GTW A;  4C7N B;  1N7L A;  3Q1M A;  1U7J A;  1S72 P;  1SQB E;  3NMD A;  1YJW P;  3L73 E;  1BCC J;  2H7H A;  3KPE A;  3CCR P;  4H13 D;  4N78 E;  4D6T D;  1RF0 B;  4HKZ H;  1VQK P;  4BRY B;  1AJY A;  2YMY A;  1RF0 A;  5BU5 A;  2AXT H;  3HUS C;  2QE7 H;  2WMM A;  3B71 A;  2O1J A;  1WT6 A;  1VQ6 P;  4PJ0 H;  2Q9I B;  2WZ7 A;  3HUS A;  1M1K Q;  3IN6 A;  3L4F A;  5AVX B;  1W2B O;  3L37 A;  3CC7 P;  5AVW B;  3N7N A;  4I2L C;  3RK3 E;  3RL0 g;  2R5B A;  3Q5R A;  2B87 A;  4H0L D;  1HWT C;  2XNX C;  2AXC A;  3A0H E;  1RF1 A;  2BCC D;  2JHL F;  3RK2 C;  2KOG A;  1SQQ D;  1N7S C;  1SQB G;  5B66 E;  1RQU A;  2D39 A;  1D7M A;  1M57 D;  4GOF A;  2HOD C;  1FID A;  1NTK J;  4GIF A;  2KSE A;  1R5L A;  1L4A C;  1IK9 A;  3VYI A;  1USE A;  3HD7 D;  2Y0C A;  1PGO A;  2E5Y A;  3FGA D;  2IBZ I;  4OH8 B;  3G4S P;  5C39 A;  4JBZ A;  2YO2 A;  1H88 A;  2FYN C;  3L73 J;  1BCC E;  1W2E A;  2NPS A;  3RBZ A;  1N86 A;  3AE9 C;  2Z5I A;  3H1L E;  4K3A A;  2XND H;  1VPC A;  1JCD A;  4EOT A;  3L73 G;  5KLV E;  1FZE C;  2W90 A;  1KYO E;  2KI7 B;  4DJG A;  1NTZ G;  3H32 C;  1M56 D;  2LR2 A;  2M5A B;  2FFD B;  1M1J A;  5AW7 B;  2CPS A;  4PD4 I;  1GMJ A;  4K35 A;  2IX7 C;  2ZT9 D;  4H44 B;  3TDK A;  1X9V A;  1SQQ G;  2QJK B;  2H43 A;  1T2K D;  4OVN F;  1FBM A;  1ZP0 C;  3B5N D;  1NHL A;  1IFD A;  2WSC H;  2OTJ P;  2KUB A;  4L73 A;  3L72 D;  1JY2 O;  4YXD C;  1VQ4 P;  1K05 A;  1L0L K;  3L71 G;  4UB8 E;  1FZF B;  1EZV E;  3V4W A;  1ZW0 A;  5KLV K;  2C9N Y;  5EFW B;  2JKV A;  1SQX D;  1IFJ A;  4PV1 B;  3L74 J;  2WVR A;  4DT0 A;  1RF0 C;  3BVH B;  4PV1 D;  1GDT A;  2J64 A;  1IFP A;  1NWQ A;  3B8E B;  5B5E H;  1AA0 A;  1VDF A;  5B66 H;  1CSB A;  2FYU G;  2J5U A;  3L35 A;  5APV A;  1QLE D;  2AEJ A;  2WSC J;  4N6J A;  1KQG B;  2K37 A;  3CXH H;  1R8E A;  1NVO A;  4WBA A;  1ZXG A;  3ITK A;  1S9K D;  3A2A A;  1NU1 J;  2K9Y A;  5E79 E;  2RH0 A;  3MTU E;  2BEQ D;  3HD7 B;  1BGY J;  2ZJS E;  1KQF B;  4EDF A;  1U7M A;  3HD7 A;  2QIW A;  3SWK A;  2J61 B;  3L72 G;  1T6A A;  1JM0 A;  2MJZ A;  1AV1 A;  3RK2 D;  1KIL A;  2A06 E;  2KB7 P;  3BVH C;  3KDP B;  2XDJ A;  1R5S A;  2POH A;  4YTP C;  3MIW A;  2HPC B;  4DOJ A;  2KK7 A;  3H1L J;  3CXH E;  2OYI A;  1Y47 A;  3R4Y A;  3CCE P;  1VL2 A;  1HH0 A;  3AE2 C;  2HLO C;  3IR9 A;  3JCU E;  3H1H D;  2A45 H;  1BE3 E;  3WMM 0;  2M3B A;  1HTL C;  4AUW A;  1NTK D;  3C1L A;  4EI2 A;  1ZRT E;  2GUV A;  4PJ0 E;  2ZYD A;  1KQS O;  1NGM B;  3TSI A;  5BVZ A;  1FZB C;  3I55 P;  2M3E A;  2W6A A;  1KB9 H;  3EFG A;  2A06 G;  4R4L A; 
#chains in the Genus database with same CATH homology
 3UIA A;  3CL3 D;  3VMZ A;  2JHI F;  3A5T A;  1FJK A;  1KIL D;  2FFD C;  1JY2 P;  1CZQ A;  5AW1 B;  1NTK K;  4JF7 A;  2WT7 B;  1GW4 A;  2WTY A;  2A45 I;  2N1T C;  3V2Q A;  2XU6 A;  1LT9 B;  4Y99 C;  3VOP A;  2GUS A;  3GHG C;  1FZA C;  1E5W A;  1JY3 O;  3LIE A;  3HRN A;  3LID A;  1LTB C;  1FZE A;  4B86 A;  3H32 B;  1N73 A;  5BU8 B;  2Q9I A;  2E42 A;  5AW0 B;  1NKN A;  2HPC C;  4M3L A;  1IJD B;  2PAJ A;  1FAV A;  4W7Y A;  1FZG B;  5CCH D;  1FZE B;  1LGH B;  3RL0 B;  3B5N A;  1J2J B;  1GL2 D;  1M1J B;  1LTJ A;  1T3U A;  3C9I A;  5APU A;  5CCH C;  4GKG A;  3CLQ A;  4GT1 A;  1SQV K;  3A7O A;  3P32 A;  2J0H A;  2YNY A;  4HYT B;  4HH2 A;  5AVS B;  1AQ5 A;  2Q3I A;  3P8C E;  2XNX B;  1X79 B;  3VMY A;  2JEE A;  2P7J A;  1LWU A;  1LTT C;  2C9L Y;  1KFN A;  5AVU B;  3M9H A;  1M7L A;  1DH3 A;  1EQ7 A;  2WPS A;  1IFM A;  2WSE H;  3SWF A;  2JHK F;  2H8P D;  5AVZ B;  3FIB A;  3M0D C;  1HBW A;  2J60 A;  1FZD A;  2R5D A;  1SFC A;  1JNM A;  1GW3 A;  1FZC B;  1HVV A;  1FZG C;  2OYH C;  1CW5 A;  1FZA A;  1GU5 A;  1JOC A;  2J3F D;  1JY2 N;  4N3Y B;  2HOD B;  5AW5 B;  1HJB A;  5CJ0 A;  1LTJ B;  5APY A;  1RY3 A;  1G1J A;  1KFM A;  1YTZ I;  2NPS D;  5CCG C;  1HUC A;  1SQB K;  2HOD A;  4NYT A;  2FFD A;  4XA4 A;  4ZFG A;  2Z4E A;  1SVF A;  2IPP A;  1L0N K;  1FJP A;  1J1E B;  4WY4 B;  1GTW A;  5CCG D;  1J1E C;  4LGD E;  3HE5 B;  2HFE D;  3EQ2 A;  4C7N B;  1SFC D;  1N7L A;  4O9B A;  4WY4 D;  2YKP A;  1RF1 C;  1IFN A;  4ZKU A;  3NMD A;  2J61 A;  1FZB A;  2H7H A;  3KPE A;  2FYZ A;  2QM7 A;  1LWU B;  4N78 E;  2YKQ A;  2J3U A;  1RF0 B;  3M0D A;  1FZF C;  1JTH A;  1RE4 C;  1J1D C;  1NH4 A;  1RF0 A;  2YMY A;  1S9K E;  2GM4 A;  5BU5 A;  3G3Z A;  1MV8 A;  2HLO A;  4XE5 B;  1RE4 A;  3HUS C;  2O1K A;  1LTA C;  3HUS B;  2P2U A;  2ZXE B;  2HPC A;  3L36 A;  2O1J A;  2W6B A;  1FZC C;  5APQ A;  5CCH A;  4EPU A;  1WT6 A;  3U59 A;  1N73 B;  5KJ7 A;  2WWW A;  1DX7 A;  2WZ7 A;  2Q9I B;  3HUS A;  1LTG C;  1Z56 A;  1H89 A;  3O8Z A;  3BRV B;  1URQ D;  3L4F A;  4ZKP A;  3GHG A;  5AVX B;  2WPR A;  3L37 A;  2J0Y A;  5AVW B;  2Z4E B;  3N7N A;  2PP6 A;  4I2L C;  2R5B A;  1IC2 A;  1HWT C;  1URQ C;  1FOS E;  2XNX C;  1XTC C;  1RF1 A;  1SQQ K;  4W80 A;  3V2N A;  2JHL F;  3RK2 C;  4M7F A;  3U1C A;  2KOG A;  2C0X A;  2C0W A;  1N7S C;  1T2K C;  1ZR4 A;  3M0A A;  3V4Q A;  2H43 C;  1SQP K;  3VMX A;  2J3O A;  3HTK B;  4C46 A;  4IFF A;  2OYH A;  2D39 A;  3H6P A;  1ZN5 A;  1DEB A;  5AVR B;  2P1J A;  1SP4 A;  2P67 A;  3E1I A;  1NU1 K;  1JCC A;  1ZLL A;  4LLH A;  2HOD C;  3I5C A;  1FID A;  3MD0 A;  3TNU A;  1JY3 P;  2CPB A;  4GIF A;  3GHG B;  2Z5H A;  4M7H A;  3MUD A;  1SQX K;  1L4A C;  3H32 A;  3TK1 A;  1HGZ A;  5AW3 B;  1IK9 A;  1N2D C;  4KHX A;  2BAS A;  3VYI A;  1GL2 C;  5APT A;  3HD7 D;  2A45 G;  5AW9 B;  3VN0 A;  1G2C B;  1QL1 A;  5AVT B;  3HE5 A;  1LTJ C;  4LC1 A;  3P8M C;  2WNP F;  3OA7 A;  3RK3 D;  1Z3U A;  1CI6 B;  4OH8 B;  1GU4 A;  1Z3S A;  5CMZ A;  1JUN A;  1LWU C;  2YO2 A;  3HE4 B;  3NXS A;  1N73 C;  2Q9I C;  1PFI A;  3PP5 A;  1H88 A;  2J59 M;  1W2E A;  2NPS A;  3II6 A;  3E1I B;  1J1D B;  1N86 A;  2W27 A;  1LT9 A;  2Z5I A;  1OXZ A;  1GL2 B;  1WRG A;  5KTB A;  1GD2 E;  4JYO X;  2NPS C;  4IFD K;  1VPC A;  1JCD A;  2WIT A;  1L4A B;  5AW8 B;  2JHM F;  2J58 A;  4EOT A;  1FZF A;  3VP8 A;  4IFM A;  1RE3 C;  2J5Z A;  1FZE C;  5KJ7 D;  2HLO B;  1IFI A;  1L4A D;  1L4A A;  4Y99 B;  3H32 C;  2YKO A;  1GK4 A;  3M91 A;  2ZFC A;  3BRT B;  1FDM A;  2FFD B;  1M1J A;  2J3G A;  2I1J A;  5AW7 B;  2Q7C A;  1FZA B;  2CPS A;  3M9Q A;  2IX7 C;  2H43 B;  3E1I C;  1GZL A;  2WPQ A;  3MGN A;  1X9V A;  1N86 B;  1A02 J;  4JZC A;  3NTN A;  2H43 A;  2WSF H;  2KP8 A;  1T2K D;  4AYC A;  1KIL B;  1FBM A;  2IFN A;  1H8A A;  3B5N D;  1NHL A;  2JJL A;  4WY4 A;  4C7R A;  1JO5 A;  2J3F A;  1IFD A;  2WSC H;  2VRS A;  1JTH B;  2XNX A;  1JY2 O;  1SFC C;  2N9B A;  3HTK A;  3V2R A;  2FKW B;  3U1A A;  2N1T D;  1JMM A;  3OAK A;  1N7S A;  1FIB A;  3NFQ A;  1MUU A;  1T3J A;  1L0L K;  5APX A;  4R9J A;  1FZF B;  2XKM A;  2R32 A;  2M8R A;  5APS A;  1N86 C;  5AVQ B;  3V4W A;  1FZC A;  5KJ7 C;  3N4X A;  5KLV K;  2C9N Y;  1IFJ A;  1KIL C;  5CJ4 A;  1RF0 C;  2JHH C;  2N1T B;  2XV5 A;  3BVH B;  3CI9 A;  3T97 A;  3OJA B;  1GDT A;  2J64 A;  1RF1 B;  1NWQ A;  3B8E B;  1LTI C;  5AVY B;  2IFM A;  2HYN A;  1FOS F;  2GY7 A;  3TYY A;  2FYU K;  4JYC A;  3HE4 A;  3RK3 C;  4R9T A;  1VDF A;  2FXM A;  1CSB A;  3RK2 B;  2XZR A;  4WY4 C;  1FU1 A;  2NPS B;  3L35 A;  5APV A;  3M9B A;  5APW A;  4N6J A;  1GL2 A;  1LTS C;  2LKM A;  1FZB B;  1RE3 B;  2L5G B;  2QM8 A;  2OYI B;  4AQR D;  5AVV B;  2YO3 A;  5AW6 B;  4DZO A;  2Z4E C;  2KYV A;  4WBA A;  3TNU B;  2E43 A;  1NTZ K;  1NAF A;  3VTP C;  2J0G A;  1SFC B;  1MZ9 A;  1OWA A;  1N7S D;  1S9K D;  3A2A A;  1NKZ B;  3P7K A;  1NTM K;  1QL2 A;  3MTU E;  1XTG B;  3HD7 B;  3M06 A;  5CCG A;  3B5N B;  1FZG A;  3HD7 A;  2J61 B;  1M1J C;  1IO4 A;  1HGV A;  2MJZ A;  3RL0 C;  4I1L A;  4JYB A;  3RK2 D;  4C7N A;  3IFM A;  3VP9 A;  1RE3 A;  5AW2 B;  4N78 D;  1KIL A;  2O01 H;  4I6M C;  3RL0 D;  1X8Y A;  2KB7 P;  1URQ A;  3RK3 B;  2OYI C;  3BVH C;  2KLV A;  2Q5U A;  3KDP B;  4WB4 A;  2XDJ A;  1FIC A;  2POH A;  1RE4 B;  1T8Z A;  5CHX A;  3SWY A;  1URQ B;  2HPC B;  3MIW A;  1LT9 C;  4DOJ A;  5AW4 B;  1N7S B;  2OYI A;  3BAT A;  3B5N C;  1YYC A;  2KSJ A;  1HH0 A;  2HLO C;  2FIB A;  3IR9 A;  2A45 H;  3WMM 0;  2M3B A;  4RES B;  1HTL C;  1SLQ A;  1KQL A;  4AUW A;  3LW5 H;  1NO4 A;  1AFO A;  2GUV A;  4W7Z A;  3BAS A;  3V5B A;  2J1G A;  1ZR2 A;  1G1I A;  1ZV8 A;  3V2P A;  1MFZ A;  3BVH A;  3HD7 C;  3TSI A;  1CI6 A;  1GK6 A;  2N1T A;  1YTZ T;  5BVZ A;  1KZU B;  1A02 F;  1JY3 N;  3KQG A;  3P8C D;  1FZB C;  1JC9 A;  2J2P A;  1NOH A;  1G2C A;  2W6A A;  2OYH B;  3EFG A;  3A3Y B;  3R2P A;  2I1K A;  2WT7 A;  4EIJ A;  2HG5 D;  2R3C A;  3KYQ A;  2OAR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...