1N73C

Fibrin d-dimer, lamprey complexed with the peptide ligand: gly-his-arg-pro-amide
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
322
structure length
322
Chain Sequence
KTVQKILEEVRILEQIGVSHDAQIQELSEMWRVNQQFVTRLQQQLVDIRQTCSRSCQDTTANKISPITGKDCQQVVDNGGKDSGLYYIKPLKAKQPFLVFCEIENGNGWTVIQHRHDGSVNFTRDWVSYREGFGYLAPTLTTEFWLGNEKIHLLTGQQAYRLRIDLTDWENTHRYADYGHFKLTPESDEYRLFYSMYLDGDAGNAFDGFDFGDDPQDKFYTTHLGMLFSTPERDNDKYEGSCAEQDGSGWWMNRCHAGHLNGKYYFGGNYRKTDVEFPYDDGIIWATWHDRWYSLKMTTMKLLPMGRDLSGHGGQQQSKGNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Blood clotting
molecule keywords Fibrin alpha-1 chain
publication title The Crystal structure of fragment double-D from cross-linked lamprey fibrin reveals isopeptide linkages across an unexpected D-D interface
pubmed doi rcsb
total genus 92
structure length 322
sequence length 322
chains with identical sequence F
ec nomenclature
pdb deposition date 2002-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1n73C03
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 1n73C01
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 1n73C02
4R9JA 1JY3N 2J3OA 2J64A 1JC9A 1RE4B 2Z4EA 2JHLF 1LTJA 2J0GA 2J2PA 1FZGC 1RE4C 1JY2P 3GHGC 4EPUA 2J0HA 1M1JC 3E1IA 1LT9C 2XNXA 1LWUA 1RE3B 1JY2N 1FZGA 1FZDA 3BVHC 1FZEB 2HLOB 2JHKF 2J1GA 1FICA 2Q9IB 1N73B 3GHGA 2OYHC 3HUSB 1FZBB 2FFDB 1RF1B 1M1JA 2A45H 1LT9A 1FZBC 2J3UA 2J0YA 2H43A 1LTJB 2HODA 2J61A 1Z3UA 2WNPF 1FIBA 2OYHA 1FIDA 1T3UA 2HPCB 4R9TA 3E1IB 1RF0B 1N86B 2XNXB 2OYIB 1FZAB 1RE4A 1JY3O 3H32B 1FZCB 1RE3C 2OYIC 1FZFB 3H32C 1FZEC 2HLOC 2JHHC 2Q9IC 2A45I 1N73C 3HUSC 3FIBA 2FFDC 1RF1C 2Z4EB 4JYOX 3BVHA 1RE3A 2J5ZA 2GY7A 2HODB 1LTJC 1W2EA 2HLOA 1JY2O 2Q9IA 1N73A 4JZCA 4ZFGA 3HUSA 2J3GA 1FZBA 1RF1A 1LWUB 2FFDA 1Z3SA 2HPCC 3E1IC 1RF0C 1N86C 1FZGB 2XNXC 1FZAC 1LWUC 1FZCC 2JHMF 2J3FA 3GHGB 1FZFC 4NYTA 1M1JB 1LT9B 1JY3P 2HPCA 2J3FD 2A45G 4M7FA 1RF0A 1N86A 2H43B 2Z4EC 1FZAA 2OYIA 2J61B 3BVHB 2D39A 3H32A 2FIBA 1FZEA 1FZCA 2J60A 2JHIF 2H43C 2HODC 2OYHB 1FZFA 4M7HA
chains in the Genus database with same CATH superfamily
1SQPJ 2ZT9B 3IFMA 2D2CC 4EIJA 2KIKA 2RN0A 4L75A 1AQ5A 3P32A 1DIPA 2H89C 1SQPD 1LTSC 2W27A 1PGJA 3G3ZA 3CX5I 5DJUB 1OX3A 2OYHC 3CCSP 1EXJA 2W90A 3LIEA 5APWA 3CCQP 1VQ5P 1URQA 3MIWA 3H1LE 1LTBC 3A0HH 3Q1MA 2WNPF 4N6JA 4AQRD 2XDJA 3E1IB 1KD1Q 4TT3H 3VMXA 3U1AA 1P84D 1NKNA 3L74J 1FS0E 4WBAA 3GG2A 3PP5A 1KB9I 5E79E 1KILA 3L74D 5KAFH 1JNMA 3WUVA 1JY2O 1OIPA 1GL2A 2HPCC 2M3EA 3RK2D 3W67A 2KNCB 1FDMA 4H44D 3NXSA 1FZFC 2BEQD 2XKMA 1L4AB 4NPFX 1W2BO 4H0LD 1OXZA 1U7MA 4EDFA 1KYOH 2R32A 5H2FH 3S4RA 2P67A 4IFMA 1L0NE 4R9JA 2OYOA 1YBKA 1MZ9A 1VF5D 2M5AA 1M1KQ 1KQFB 3MHVA 1DEBA 1FC2C 2E76C 2QM7A 1SQQJ 3V2RA 2QSIA 2FY8A 5APSA 3N7NA 2LR2A 3JSVC 4RKUJ 3BVHC 1RHZB 1EZVG 4IFDK 2Q9IB 1SFCD 5AVQB 3BASA 1SQQD 1OZHA 1IFIA 2I1KA 2J0YA 5M1BA 4L74A 1OVRA 2N1TD 1PPJE 4DT0A 1BSNA 3H1KJ 1FIBA 4RO0A 1ZLLA 4R9TA 1JOCA 3L70J 2A06D 3CCRP 3M0AA 3CXHD 3WUUA 3AE3C 5KAIE 3NTNA 1NGMB 1DH3A 2YXQB 4ZKUA 1T2KC 1NU1E 3L70D 3RL0g 3KZIE 4OGQC 1IO4A 3HUSA 1LWUB 1Z3SA 1LTGC 1AVYA 4EOTA 1RF0C 1PFIA 2W6BA 1SQVK 1L0LD 1HWTC 1EDLA 3EWKA 3GF7A 1NO4A 1A02J 3G6EP 3P8MC 3O6QB 4W7ZA 2J61B 2K9JB 4YPCA 4HKZH 2OTKE 2AEJA 3S1KA 3Q5RA 1VQPP 3L71E 5AW2B 1NOHA 1NYHA 2WQYC 1JY2P 3CPWO 1Y9BA 3RL0B 4EYYQ 2KLUA 2B9BA 2FYUJ 3H6PA 3D71A 2ZFCA 4C46A 1QX8A 2M0BA 2ZVOB 1VQNP 2O01N 1JEKA 3HD7A 1KB9E 1S4XA 2AXCA 1BCCJ 4WY4B 1LT9A 1NKZB 2FYUK 3B5NA 1GMJA 2QJYB 3PH0A 4C7NA 2OGUA 5CBNA 1BCCD 2WSFJ 2OYIB 3AEGC 4JF7A 1KV4A 1LTTC 1JO5A 5CHXA 1KILC 1FZCB 1XTCC 2ZT9D 3H32C 2WPQA 1EDKA 2W6AA 1S5LH 1RQVA 1GL2C 3TGUE 3CLQA 2J5ZA 5GTHH 3CMEP 1J1EB 3CXHH 1RF1A 4LGDE 2R44A 1NTKJ 1NAFA 2XNXC 1YYCA 2K1AA 2JHMF 1Q86Q 1S1CX 2W6JH 4JQ0D 2N1TC 2A45G 3B8EB 2H43B 1NTKK 1HH0A 3E7KA 1QEXA 2O01J 2QRXA 4M3LA 2E43A 4PJ0E 3CC2P 1WMKA 4ASWA 3AEBC 1J1DC 2RKLA 2R5DA 1IZNB 3SWYA 1P84E 3H1IG 2Y9YA 3L73G 3FXDA 5TISE 1CSBA 2ZJSE 4GOFA 3MGNA 1FICA 3GHGA 1VQLP 2WSEJ 2KS1A 3AE7C 4WVZA 2O3JA 1KORA 1HVVA 4H13B 2J3UA 2ZYGA 2YIUB 1L4AD 4BWNA 2JR8A 4HH2A 1L0NJ 2WITA 2FYZA 5AW3B 2I1JA 2BCCG 2IYPA 3UIAA 1AQTA 2QJKB 3WUTA 2YXRB 3PRJA 2JHHC 3L36A 1L0ND 2P58A 3VOPA 3HUSC 3WU2E 1EZVI 3PTZA 1LTJC 3AE1C 4LLHA 1VQ8P 5GTIE 1TU3F 3VP8A 2HR3A 3N4XA 2KXPB 1MUUA 1DX7A 1VQKP 1G2CA 1VF5B 4JYCA 2NPSA 4C7RA 4NYTA 1NTMJ 2QJPC 2NRGA 3JCUE 2J3FD 4M7FA 3M0DA 1WT6A 5AW8B 3TDKA 2B87A 1PPJD 2LXBA 4IL6E 1NTZG 1NTMK 2YNYA 3Q5PA 2ZT9C 1NU1J 3IR9A 1YHQP 1LNQA 2WT7B 2C0XA 2C0WA 3AEAC 1K8AQ 2JJLA 1LT1A 3VYIA 4R4MA 2A06E 1LT9C 3A0BE 1YIJP 1LTAC 1SQPG 1NU1D 1FZGA 3TYYA 3H1KE 5KKZC 1EDIA 5KJ7A 1IFNA 3IF4A 1R8EA 4I6MC 1MV8A 3II6A 2PRRA 3PJSK 1KQLA 5E79H 1EXIA 5CCGA 3L71J 1BGYE 1SQVE 2K3RA 3L72J 2M3BA 2KLVA 4Z1MH 1UIXA 3AE8C 4LC1A 1SQXK 1RF1C 3L71D 5AVUB 1S5LX 2WSEH 4GT1A 3BVHA 1SQBJ 3RL0D 1DEEG 2IBZG 2WZ7A 3L72D 1SS1A 1FU1A 3L74G 2I8DA 4L76A 5KLVK 1H0TB 2YMKA 1JB0J 1SQBD 4GKGA 4WY4D 3A7OA 1WRGA 1KB9D 1Y8AA 1N7SA 3F5HA 4GODA 2JHIF 5AW5B 2HODC 2ZAEB 4UB8E 2J3OA 2J64A 4IOIH 2OQQA 2FYUE 4Y99B 1VQOP 1RE4B 2Z4EA 2Q5UA 4U3FG 3ZDMA 2WPRA 3MZWB 3GHGC 2H88C 2MJZA 1Q81Q 4I2LC 3TGUD 4QMAA 3RK3E 2HLOB 4IFFA 2YKPA 3RK3B 4RESB 2E74B 1KZUB 3AEDC 2A45H 5KAIH 1R5LA 1SQQG 2JKVA 1QVGO 1S9KE 5AVYB 1N86B 4ASVA 1PIXA 3KZIH 1JY3O 3V2PA 5APYA 4KJMA 3Q3DA 4AYCA 1NTKE 4JYBA 3CCMP 1RE3A 2XZRA 2NPSC 3L70G 4XFJA 3ABVC 1N7LA 1KQSO 4A7PA 2KI7B 3PHLA 1LWUC 3BATA 3M0DC 3L75E 3P8CD 3HRNA 4H13D 1M1JB 1L0LG 3B4SA 5AVSB 4YTPC 3H32A 1ZOYC 2KOGA 2YO3A 1Q82Q 2IZ0A 1KB9H 3CWBE 1FZGC 2SPZA 3HE5A 3TK1A 2KSEA 1FE6A 1QL2A 5KJ7C 4D6TE 1HUCA 2Q1KA 1URQD 4OWFA 1KYOI 3RL0C 2XNXA 1G1IA 1E79H 1SFCA 2HFED 1BE3G 2J59M 1FZDA 5AVXB 1GW4A 1N73B 1E5WA 2FFDB 1IJDB 2N1TA 5CCGC 2AXTH 1FOSE 2WPVB 5BU8B 3T97B 2FBWC 1AV1A 4L73A 1JTHA 2KUBA 1PZQA 4JBZA 1BCCG 1GK6A 2OYIC 1H89A 1EQ7A 3HTKB 1FZEC 1NH4A 1VQ4P 1HF9A 1GU5A 3HE4B 2L5GB 2GA1A 1NTME 1J1EC 2D2CB 1N7SC 1OW6A 3AE9C 4PJ0H 3H1KD 5AVRB 2N9BA 1X79B 3GF3A 1BGYJ 1Z56A 1JY3P 2Z4EC 4PD4I 1FZAA 1SQVJ 1RY3A 1P84H 2H43C 1FDOA 2OYHB 4M7HA 5TISH 3H1LG 2CPBA 1BGYD 4B86A 2IBZI 1OW8A 3RGUA 1LTJA 1SQVD 1JCCA 2AEMA 2WSSH 5AW7B 3BCCE 5APQA 1PP9E 3VP9A 3MTUE 3MD0A 2QVAA 4EPUA 5CCHD 1FJPA 3CX5E 5CJ4A 1JY2N 1VQ6P 2E42A 1A02F 3CC7P 1CI6A 1SQXE 1FZBB 3G9RA 4BRYA 4K3AA 3A0HE 3QH9A 3V2NA 3L72E 3CCUP 2YMYA 2H8PD 3WU2H 1ZV8A 5KLVE 2N9YB 1LTIC 2HPCB 2FXMA 1SQBE 2Y0EA 4KHXA 2VRSA 1RE3C 5GTIH 3TF5A 1LJ2A 1FZFB 3IN6A 2OTJP 3C1LA 4WWIA 3RK2C 1Q7YQ 5KLIC 4W7YA 3WMM0 4H44C 1L0NG 2FYUD 1VQ9P 1D7MA 1JMBA 4H0LC 3G4SP 3JCUH 2V7QJ 3H1JE 4IL6H 3CCJP 3VMZA 1SLQA 2JEEA 3RK3D 1IFDA 2E74D 2E76B 1VF5C 1CW5A 3TNUB 3D6ZA 3AE4C 4I1LA 1X0TA 1EZVD 3BVHB 1IC2A 3A0BH 1NVOA 1S9KD 1LP1B 1PPJG 1Y47A 1SFCC 1K05A 3JC22 2RMZA 2HG5D 2YKQA 1H88A 1NTKD 3L75J 1GTWA 2KNCA 2J1GA 4I7ZC 2ZVNB 3H1HE 1NU1G 1L4AA 2R5BA 4PV1B 2YKOA 2Y0DA 3KHUA 2IYOA 5B66E 1PL5A 2HODA 1Z3UA 1IFJA 2NZ2A 3L75D 4OGQB 1YJWP 1HBWA 3C8VA 1T3JA 1RF0B 1IK9A 1N2DC 2POHA 3P8CE 3CWBJ 3RBZA 1EDJA 4R4LA 3M9BA 4D6TJ 2E75B 2C9NY 3BRTB 4PD4E 1XTGB 3H25A 3KYQA 1W5CE 3CWBD 3NMDA 3L71G 4O9BA 5CCHC 2KSJA 2Q9IA 3OJAB 4D6TD 5DJTB 1HGVA 1RH5B 1KMIZ 4UB8H 1FZAC 4GDOA 2J3FA 2WVRA 3CCVP 1KTMA 3GLMA 1KFMA 2LKMA 3LW5J 1FOSF 3R4YA 1URQB 1HTLC 1SVFA 2GM4A 1QLED 2QM8A 1R5SA 2KZJA 1NHLA 3SWFA 4ZKPA 5KTBA 4JPZB 3D6YA 2WSFH 2J0GA 1RE4C 1H8AA 1FBMA 1KILE 1PGPA 1IK7A 3FXEA 2W83C 1LWUA 3L37A 1KILB 3FWLA 1U7JA 2FYNC 1ZMEC 3MP7B 4AUWA 3TGUG 3Q2YA 2QEXP 2D2CD 1NTMD 3BRVB 4UB6E 1GL2B 1VPCA 2G8YA 1S3JA 3RK3C 2PGDA 3O6QA 5EFWB 1EC5A 2J61A 2K9JA 4BXLA 4WB4A 3Q5SA 1OMIA 4HB1A 4N78D 5CJ0A 2P2UA 2XNXB 3CL3D 1BSHA 1FAVA 1S5LE 3BCCJ 1PP9J 5B5EE 2O01H 1JCDA 3M06A 4XE5B 5L8RJ 3CCLP 1BDDA 2M5AB 1W2EA 1AJYA 1VQ7P 3BCCD 1PP9D 1SQXJ 3H1IJ 3RBXA 3O8ZA 2CK3H 4WY4A 1K04A 3E1IC 3CX5D 4IL6X 5KLVJ 1J1DB 1VL2A 1DD4A 1SQXD 1NWQA 1ZP0C 2J58A 2OYIA 4NPEA 1FZEA 1FZCA 5KLVD 3V6IA 1MKMA 3AE5C 3V5BA 3SWKA 4DCKA 3GMAA 1L4AC 2YO2A 3H1JJ 2WSCJ 2Q7CA 3LW5H 2JHKF 3VMAA 1YQ4C 3HUSB 3CCEP 3H1JD 5BVZA 2E76D 2ZYAA 3LIDA 3AE2C 2H43A 1LTJB 2JO1A 2PFXA 4DJGA 2L91A 1FIDA 1CZQA 1M8OB 5AVVB 4XA4A 4TLFA 2Q9IC 2A45I 1M7LA 1EZVE 2LXCB 3OW2O 1NTZK 2G3AA 5AW1B 3H1HJ 4ZFGA 2MKVA 4W80A 5TJHA 2XV5A 1J2JB 5APXA 5AVZB 2A06G 4KT0J 3M9QA 4PV1D 2Z5IA 3HD7B 1T2KD 1HJ0A 2AEFA 3H1HD 2GUSA 1LT9B 1SQPK 1AVOA 3H1KG 2DW3A 3EQ2A 3B5NB 4OGQD 3V2QA 5KKZB 4C7NB 3CX5H 3I5CA 3KXDA 2BASA 1BGYG 2E75D 3FGAD 2Q6QA 1SQVG 2KYVA 1PGQA 3AECC 3P7KA 2ZYDA 3V4QA 4PD4D 1MFZA 1RF1B 2O1KA 2KZIA 1FZBC 1NJIQ 2IBZD 1YJ9P 1U57A 1KQGB 1AA0A 1JMMA 1KFNA 2ITAA 2ZXEB 2WSCH 2WT7A 4HJGH 3ITKA 2Y9ZA 2IDBA 2KP8A 4WY4C 4U3FJ 2QE7H 1YI2P 3U1CA 2HODB 2P10A 3L35A 2QJYC 2FYUG 1KILD 1M56D 1KN7A 4U3FD 3A3YB 1FZCC 1GL2D 1YTZI 3GHGB 5BU5A 1YQ3C 3AE6C 2KS1B 4HYTB 1YITP 1GZLA 2IZ1A 4ZMDA 2KK7A 4MN4C 2J60A 1ZR2A 3KDPB 1MFTA 1JY3N 1LGHB 3I55P 1SQQK 1JC9A 3KPEA 2JHLF 3AEEC 2J2PA 2JDIH 3S9OA 5CCHA 1JUNA 5B66H 4N78E 2P1JA 1ZRTE 1H0TA 3K5BA 4NPDA 1P84I 1ZXGA 2BEZF 1NTKG 3QWOC 4GOEA 5APTA 1G1JA 1QL1A 3CD6P 3M91A 4PV1C 1G2CB 2NPSB 4PD4H 1L0LJ 2Y0CA 3L75G 2JWDA 1RE4A 1GK4A 2B87B 3H1IE 1L0LK 3L73E 1K9MQ 3OAKA 2RH0A 5CBOA 2E75C 2WTYA 4H13C 2YIUC 2HLOA 3CWBG 1HJBA 1BE3J 2QJKC 3VN0A 3I56P 5APVA 1FZGB 2W8ZA 1FJKA 2BCCE 4D6TG 5AW9B 3EFFK 3L4FA 3TSIA 2Z5HA 5KAFE 1BE3D 1N86A 5CMZA 1URQC 3D70A 3W68A 2B89A 2IX7C 4CPGA 4UB6H 5AVTB 1HGZA 1PGOA 3OA7A 1KYOE 5H2FE 2J0HA 2OTLP 3EFGA 1YJNP 3IAOA 3E1IA 3G71P 2M8RA 1ZR4A 1OFCX 4ZNCA 3CXHI 3MUDA 2QA4P 1FZEB 4GIFA 1NAYA 2AXTE 1USEA 1M1JA 3CC4P 4OVNF 1NTMG 1GU4A 1NTZE 3KQGA 1USDA 4YXWH 5B5EH 3HD7D 3E1RA 3V4WA 2HYNA 4K35A 3B5ND 2IPPA 1N7SB 2XU6A 3H1LJ 1KC8Q 1X9VA 1SQPE 2GUVA 3FIBA 2Z4EB 2GY7A 1IFMA 1FDIA 3M9HA 3H1LD 1T8ZA 1N73A 2H7HA 2FFDA 3BCCG 1PP9G 3SFDC 3T97A 5AW6B 1GDTA 5K5GB 1OVVA 1QVFO 1BDCA 3SSUA 1SQXG 1L2PA 2D39A 3B71A 2FIBA 3HTKA 2QIWA 3L72G 2IBZE 1PV3A 1GD2E 2CPSA 2R3CA 3SFEC 5KLVG 3L74E 4U7JA 1VDFA 3HE4A 4Y28J 4DOJA 1T6AA 1SQBG 3FX0A 3USSA 1JM0A 1RE3B 1VQMP 3RK2B 1S72P 5KLIB 2P7JA 1QGKB 1ZW0A 3C9IA 4H44B 1L0NK 2B88A 2V7QH 2WWWA 4Y99C 4H0LB 3H1JG 2O1JA 2OYHA 2E5YA 1ZN5A 1IFPA 4U3FE 1SP4A 2FKWB 4N3YB 3H32B 4YXDC 1K73Q 3F89A 2HLOC 2E74C 5AVWB 2JWAA 4JYOX 3HE5B 1X8YA 1SQQE 1FZBA 1AFOA 1ZRTD 1SFCB 1Q2NA 1X22A 1N86C 1S2EA 2V4HA 2C9LY 2ZXXA 2OARA 2N1TB 4OH8B 3VMYA 3HD7C 5GTHE 2IFNA 2HPCA 2NPSD 3H1HG 3R2PA 3CXHE 1NU1K 4I7ZB 3B5NC 1FZFA 1JTHB 2J5UA 3L73J 2Q3IA 2QG4A 5AW4B 3A2AA 2XNDH 3L70E 1M57D 1DD3A 2K37A 3MUDC 1N8RQ 2PAJA 5APUA 1UIIA 3H1ID 3L73D 3PLNA 3NFQA 1M1JC 2PP6A 3VTPC 2BCCJ 1L0LE 3CMAP 2K88A 2KB7P 3TNUA 4RJTA 1OVUA 1OW7A 2Q3EA 2FXOA 5KJ7D 2BCCD 2R3SA 3U59A 1T3UA 1OWAA 1LP1A 1FZAB 2IFMA 5CCGD 5C39A 1SQBK 2FXPA 4EI2A 2E5TA 1BE3E 1N73C 2WPSA 2FFDC 1GW3A 1RQUA 2UWJE 3AEFC 2JP3A 1KYOD 1Q90D 4JZCA 2J3GA 3GW6A 1NTZJ 3TGUJ 5AW0B 3CI9A 1CI6B 2QJPB 2WMMA 2K9YA 3FWNA 4BRYB 1BCCE 1M90Q 4DZOA 1RF0A 1YTZT 2FYNB 1NTZD 3A5TA 1N7SD
chains in the Genus database with same CATH topology
1JY3N 1NTMK 1LGHB 1S9KD 3IFMA 1SQQK 1JC9A 2YNYA 1SFCC 3IR9A 3KPEA 2JHLF 4EIJA 2WT7B 2C0XA 2J2PA 2C0WA 1AQ5A 5CCHA 3P32A 1JUNA 2JJLA 4N78E 3VYIA 2P1JA 2HG5D 2YKQA 1LT9C 1H88A 1LTAC 1LTSC 2W27A 3G3ZA 1FZGA 3TYYA 1GTWA 2J1GA 5KJ7A 2OYHC 1L4AA 1IFNA 5APTA 3LIEA 2R5BA 1G1JA 1QL1A 2YKOA 4I6MC 5APWA 1MV8A 3M91A 1URQA 3MIWA 3II6A 1G2CB 1LTBC 2HODA 1Z3UA 1IFJA 2NPSB 2WNPF 1KQLA 4N6JA 1HBWA 4AQRD 5CCGA 2XDJA 3E1IB 1T3JA 1RF0B 1IK9A 1N2DC 3VMXA 3U1AA 2POHA 1RE4A 1NKNA 3P8CE 1GK4A 2M3BA 4WBAA 1L0LK 2KLVA 3PP5A 3OAKA 3M9BA 4LC1A 1SQXK 1RF1C 2C9NY 3BRTB 5AVUB 2WSEH 2WTYA 1XTGB 4GT1A 3BVHA 1KILA 3KYQA 3RL0D 3NMDA 1JNMA 4O9BA 2WZ7A 2HLOA 1FU1A 5CCHC 2KSJA 1JY2O 2Q9IA 3OJAB 5KLVK 1HJBA 1GL2A 2HPCC 1HGVA 3VN0A 3RK2D 5APVA 1FZGB 1FJKA 1FZAC 1FDMA 4GKGA 5AW9B 3L4FA 2J3FA 3TSIA 4WY4D 3A7OA 2Z5HA 3NXSA 1FZFC 2XKMA 1L4AB 1WRGA 1KFMA 1OXZA 2LKMA 1FOSF 1URQB 2R32A 1HTLC 1N7SA 1N86A 1SVFA 2GM4A 2QM8A 5CMZA 1URQC 2JHIF 5AW5B 2HODC 2P67A 4IFMA 4R9JA 2J3OA 2J64A 1NHLA 1MZ9A 2IX7C 3SWFA 4ZKPA 5KTBA 4Y99B 1RE4B 2Z4EA 2Q5UA 2WSFH 5AVTB 1HGZA 2J0GA 1RE4C 1H8AA 1DEBA 3OA7A 2WPRA 1FBMA 3GHGC 2QM7A 3V2RA 2J0HA 2MJZA 3EFGA 3E1IA 5APSA 3N7NA 3L37A 1LWUA 2M8RA 4I2LC 1ZR4A 1KILB 3MUDA 3BVHC 1FZEB 4IFFA 4AUWA 2HLOB 4IFDK 4GIFA 2Q9IB 2YKPA 1SFCD 4RESB 3RK3B 3BRVB 5AVQB 1KZUB 3BASA 1GL2B 1VPCA 1M1JA 2A45H 3RK3C 1IFIA 2I1KA 1GU4A 3KQGA 2J0YA 3HD7D 2N1TD 2J61A 3V4WA 2HYNA 1FIBA 4WB4A 1S9KE 3B5ND 2IPPA 4N78D 1ZLLA 5AVYB 1N7SB 2XU6A 5CJ0A 4R9TA 1N86B 2P2UA 2XNXB 1JOCA 1JY3O 3M0AA 3CL3D 3V2PA 5APYA 1FAVA 1X9VA 3NTNA 2O01H 1JCDA 3M06A 4XE5B 4AYCA 2GUVA 1DH3A 3FIBA 4JYBA 2Z4EB 4ZKUA 1T2KC 1RE3A 2GY7A 1IFMA 2XZRA 3M9HA 1W2EA 1T8ZA 2NPSC 1N73A 2H7HA 1IO4A 3HUSA 1N7LA 3O8ZA 1LWUB 2FFDA 1Z3SA 1LTGC 4WY4A 4EOTA 3E1IC 1RF0C 1LWUC 3BATA 1PFIA 3M0DC 2W6BA 1SQVK 3T97A 3P8CD 5AW6B 1GDTA 1HWTC 1J1DB 3HRNA 1NO4A 1A02J 1M1JB 1NWQA 5AVSB 3P8MC 2J58A 2OYIA 4W7ZA 2J61B 2D39A 3H32A 2FIBA 1FZEA 1FZCA 3HTKA 2KOGA 2YO3A 1GD2E 5AW2B 2CPSA 2R3CA 1VDFA 3HE4A 1NOHA 1FZGC 1JY2P 3HE5A 3V5BA 4DOJA 3TK1A 1QL2A 5KJ7C 3RL0B 1L4AC 2YO2A 1HUCA 1URQD 3RL0C 2XNXA 1G1IA 2HFED 1SFCA 2Q7CA 1RE3B 3H6PA 2J59M 2ZFCA 4C46A 3LW5H 1FZDA 2JHKF 5AVXB 3RK2B 1GW4A 1N73B 2P7JA 3HD7A 1E5WA 3HUSB 2FFDB 1IJDB 2N1TA 1L0NK 3C9IA 4WY4B 5CCGC 1LT9A 1NKZB 2WWWA 5BVZA 3LIDA 1FOSE 4Y99C 2H43A 2FYUK 5BU8B 3B5NA 1LTJB 2O1JA 4C7NA 2OYHA 1JTHA 1FIDA 1ZN5A 1SP4A 1CZQA 2OYIB 2FKWB 4JF7A 5AVVB 1LTTC 1JO5A 4N3YB 3H32B 5CHXA 1KILC 1GK6A 1FZCB 4XA4A 2OYIC 1H89A 1XTCC 1EQ7A 3HTKB 3H32C 2WPQA 1FZEC 2HLOC 1NH4A 2Q9IC 2A45I 2W6AA 1M7LA 1GL2C 5AVWB 4JYOX 1GU5A 3HE4B 2L5GB 3CLQA 2J5ZA 3HE5B 1NTZK 5AW1B 1J1EB 1X8YA 1J1EC 4ZFGA 1FZBA 4W80A 1RF1A 1AFOA 1SFCB 2XV5A 4LGDE 1N7SC 1N86C 1J2JB 1NAFA 2XNXC 1YYCA 5APXA 5AVZB 2C9LY 2JHMF 3M9QA 2OARA 2Z5IA 3HD7B 1T2KD 5AVRB 2N9BA 2N1TB 2GUSA 1X79B 4OH8B 1LT9B 3HD7C 3VMYA 1SQPK 1Z56A 2IFNA 1JY3P 2HPCA 2N1TC 2NPSD 3EQ2A 2A45G 3B8EB 3R2PA 2H43B 2Z4EC 1FZAA 3B5NB 1NTKK 3V2QA 1RY3A 1NU1K 1HH0A 4C7NB 2H43C 3B5NC 2OYHB 1FZFA 4M7HA 1JTHB 3I5CA 4M3LA 2CPBA 2BASA 2Q3IA 2E43A 5AW4B 3A2AA 4B86A 1LTJA 1JCCA 2PAJA 5APUA 5AW7B 5APQA 3VP9A 3MTUE 2KYVA 1J1DC 3MD0A 2R5DA 4EPUA 3SWYA 3NFQA 1M1JC 5CCHD 2PP6A 3VTPC 3P7KA 3V4QA 1FJPA 5CJ4A 1JY2N 1CSBA 2E42A 1A02F 3MGNA 1MFZA 1FICA 1CI6A 3GHGA 1FZBB 1RF1B 2O1KA 2KB7P 3TNUA 1HVVA 1FZBC 2J3UA 5KJ7D 3V2NA 1L4AD 2YMYA 2H8PD 1ZV8A 4HH2A 3U59A 2WITA 5AW3B 2FYZA 2I1JA 1LTIC 1JMMA 1T3UA 3UIAA 2HPCB 2FXMA 1OWAA 1KFNA 1FZAB 4KHXA 2VRSA 1RE3C 2IFMA 5CCGD 2ZXEB 2WSCH 2WT7A 1FZFB 1SQBK 2JHHC 3RK2C 3L36A 1N73C 3VOPA 2WPSA 4W7YA 3HUSC 2KP8A 3WMM0 2FFDC 1GW3A 4WY4C 3U1CA 2HODB 1LTJC 3L35A 4LLHA 1KILD 4JZCA 2J3GA 3VP8A 3VMZA 1SLQA 3N4XA 1MUUA 2JEEA 3RK3D 1IFDA 5AW0B 1DX7A 3A3YB 1G2CA 3CI9A 1FZCC 1GL2D 1CI6B 1YTZI 3GHGB 4JYCA 2NPSA 4C7RA 5BU5A 4NYTA 4HYTB 1CW5A 1GZLA 3TNUB 4I1LA 2J3FD 4DZOA 4M7FA 1RF0A 1YTZT 3BVHB 3M0DA 1IC2A 1WT6A 5AW8B 2J60A 1ZR2A 3A5TA 3KDPB 1N7SD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R9J A;  1JY3 N;  2J3O A;  2J64 A;  1JC9 A;  1RE4 B;  2Z4E A;  2JHL F;  1LTJ A;  2J0G A;  2J2P A;  1FZG C;  1RE4 C;  1JY2 P;  3GHG C;  4EPU A;  2J0H A;  1M1J C;  3E1I A;  1LT9 C;  2XNX A;  1LWU A;  1RE3 B;  1JY2 N;  1FZG A;  1FZD A;  3BVH C;  1FZE B;  2HLO B;  2JHK F;  2J1G A;  1FIC A;  2Q9I B;  1N73 B;  3GHG A;  2OYH C;  3HUS B;  1FZB B;  2FFD B;  1RF1 B;  1M1J A;  2A45 H;  1LT9 A;  1FZB C;  2J3U A;  2J0Y A;  2H43 A;  1LTJ B;  2HOD A;  2J61 A;  1Z3U A;  2WNP F;  1FIB A;  2OYH A;  1FID A;  1T3U A;  2HPC B;  4R9T A;  3E1I B;  1RF0 B;  1N86 B;  2XNX B;  2OYI B;  1FZA B;  1RE4 A;  1JY3 O;  3H32 B;  1FZC B;  1RE3 C;  2OYI C;  1FZF B;  3H32 C;  1FZE C;  2HLO C;  2JHH C;  2Q9I C;  2A45 I;  1N73 C;  3HUS C;  3FIB A;  2FFD C;  1RF1 C;  2Z4E B;  4JYO X;  3BVH A;  1RE3 A;  2J5Z A;  2GY7 A;  2HOD B;  1LTJ C;  1W2E A;  2HLO A;  1JY2 O;  2Q9I A;  1N73 A;  4JZC A;  4ZFG A;  3HUS A;  2J3G A;  1FZB A;  1RF1 A;  1LWU B;  2FFD A;  1Z3S A;  2HPC C;  3E1I C;  1RF0 C;  1N86 C;  1FZG B;  2XNX C;  1FZA C;  1LWU C;  1FZC C;  2JHM F;  2J3F A;  3GHG B;  1FZF C;  4NYT A;  1M1J B;  1LT9 B;  1JY3 P;  2HPC A;  2J3F D;  2A45 G;  4M7F A;  1RF0 A;  1N86 A;  2H43 B;  2Z4E C;  1FZA A;  2OYI A;  2J61 B;  3BVH B;  2D39 A;  3H32 A;  2FIB A;  1FZE A;  1FZC A;  2J60 A;  2JHI F;  2H43 C;  2HOD C;  2OYH B;  1FZF A;  4M7H A; 
#chains in the Genus database with same CATH topology
 1SQP J;  2ZT9 B;  3IFM A;  2D2C C;  4EIJ A;  2KIK A;  2RN0 A;  4L75 A;  1AQ5 A;  3P32 A;  1DIP A;  2H89 C;  1SQP D;  1LTS C;  2W27 A;  1PGJ A;  3G3Z A;  3CX5 I;  5DJU B;  1OX3 A;  2OYH C;  3CCS P;  1EXJ A;  2W90 A;  3LIE A;  5APW A;  3CCQ P;  1VQ5 P;  1URQ A;  3MIW A;  3H1L E;  1LTB C;  3A0H H;  3Q1M A;  2WNP F;  4N6J A;  4AQR D;  2XDJ A;  3E1I B;  1KD1 Q;  4TT3 H;  3VMX A;  3U1A A;  1P84 D;  1NKN A;  3L74 J;  1FS0 E;  4WBA A;  3GG2 A;  3PP5 A;  1KB9 I;  5E79 E;  1KIL A;  3L74 D;  5KAF H;  1JNM A;  3WUV A;  1JY2 O;  1OIP A;  1GL2 A;  2HPC C;  2M3E A;  3RK2 D;  3W67 A;  2KNC B;  1FDM A;  4H44 D;  3NXS A;  1FZF C;  2BEQ D;  2XKM A;  1L4A B;  4NPF X;  1W2B O;  4H0L D;  1OXZ A;  1U7M A;  4EDF A;  1KYO H;  2R32 A;  5H2F H;  3S4R A;  2P67 A;  4IFM A;  1L0N E;  4R9J A;  2OYO A;  1YBK A;  1MZ9 A;  1VF5 D;  2M5A A;  1M1K Q;  1KQF B;  3MHV A;  1DEB A;  1FC2 C;  2E76 C;  2QM7 A;  1SQQ J;  3V2R A;  2QSI A;  2FY8 A;  5APS A;  3N7N A;  2LR2 A;  3JSV C;  4RKU J;  3BVH C;  1RHZ B;  1EZV G;  4IFD K;  2Q9I B;  1SFC D;  5AVQ B;  3BAS A;  1SQQ D;  1OZH A;  1IFI A;  2I1K A;  2J0Y A;  5M1B A;  4L74 A;  1OVR A;  2N1T D;  1PPJ E;  4DT0 A;  1BSN A;  3H1K J;  1FIB A;  4RO0 A;  1ZLL A;  4R9T A;  1JOC A;  3L70 J;  2A06 D;  3CCR P;  3M0A A;  3CXH D;  3WUU A;  3AE3 C;  5KAI E;  3NTN A;  1NGM B;  1DH3 A;  2YXQ B;  4ZKU A;  1T2K C;  1NU1 E;  3L70 D;  3RL0 g;  3KZI E;  4OGQ C;  1IO4 A;  3HUS A;  1LWU B;  1Z3S A;  1LTG C;  1AVY A;  4EOT A;  1RF0 C;  1PFI A;  2W6B A;  1SQV K;  1L0L D;  1HWT C;  1EDL A;  3EWK A;  3GF7 A;  1NO4 A;  1A02 J;  3G6E P;  3P8M C;  3O6Q B;  4W7Z A;  2J61 B;  2K9J B;  4YPC A;  4HKZ H;  2OTK E;  2AEJ A;  3S1K A;  3Q5R A;  1VQP P;  3L71 E;  5AW2 B;  1NOH A;  1NYH A;  2WQY C;  1JY2 P;  3CPW O;  1Y9B A;  3RL0 B;  4EYY Q;  2KLU A;  2B9B A;  2FYU J;  3H6P A;  3D71 A;  2ZFC A;  4C46 A;  1QX8 A;  2M0B A;  2ZVO B;  1VQN P;  2O01 N;  1JEK A;  3HD7 A;  1KB9 E;  1S4X A;  2AXC A;  1BCC J;  4WY4 B;  1LT9 A;  1NKZ B;  2FYU K;  3B5N A;  1GMJ A;  2QJY B;  3PH0 A;  4C7N A;  2OGU A;  5CBN A;  1BCC D;  2WSF J;  2OYI B;  3AEG C;  4JF7 A;  1KV4 A;  1LTT C;  1JO5 A;  5CHX A;  1KIL C;  1FZC B;  1XTC C;  2ZT9 D;  3H32 C;  2WPQ A;  1EDK A;  2W6A A;  1S5L H;  1RQV A;  1GL2 C;  3TGU E;  3CLQ A;  2J5Z A;  5GTH H;  3CME P;  1J1E B;  3CXH H;  1RF1 A;  4LGD E;  2R44 A;  1NTK J;  1NAF A;  2XNX C;  1YYC A;  2K1A A;  2JHM F;  1Q86 Q;  1S1C X;  2W6J H;  4JQ0 D;  2N1T C;  2A45 G;  3B8E B;  2H43 B;  1NTK K;  1HH0 A;  3E7K A;  1QEX A;  2O01 J;  2QRX A;  4M3L A;  2E43 A;  4PJ0 E;  3CC2 P;  1WMK A;  4ASW A;  3AEB C;  1J1D C;  2RKL A;  2R5D A;  1IZN B;  3SWY A;  1P84 E;  3H1I G;  2Y9Y A;  3L73 G;  3FXD A;  5TIS E;  1CSB A;  2ZJS E;  4GOF A;  3MGN A;  1FIC A;  3GHG A;  1VQL P;  2WSE J;  2KS1 A;  3AE7 C;  4WVZ A;  2O3J A;  1KOR A;  1HVV A;  4H13 B;  2J3U A;  2ZYG A;  2YIU B;  1L4A D;  4BWN A;  2JR8 A;  4HH2 A;  1L0N J;  2WIT A;  2FYZ A;  5AW3 B;  2I1J A;  2BCC G;  2IYP A;  3UIA A;  1AQT A;  2QJK B;  3WUT A;  2YXR B;  3PRJ A;  2JHH C;  3L36 A;  1L0N D;  2P58 A;  3VOP A;  3HUS C;  3WU2 E;  1EZV I;  3PTZ A;  1LTJ C;  3AE1 C;  4LLH A;  1VQ8 P;  5GTI E;  1TU3 F;  3VP8 A;  2HR3 A;  3N4X A;  2KXP B;  1MUU A;  1DX7 A;  1VQK P;  1G2C A;  1VF5 B;  4JYC A;  2NPS A;  4C7R A;  4NYT A;  1NTM J;  2QJP C;  2NRG A;  3JCU E;  2J3F D;  4M7F A;  3M0D A;  1WT6 A;  5AW8 B;  3TDK A;  2B87 A;  1PPJ D;  2LXB A;  4IL6 E;  1NTZ G;  1NTM K;  2YNY A;  3Q5P A;  2ZT9 C;  1NU1 J;  3IR9 A;  1YHQ P;  1LNQ A;  2WT7 B;  2C0X A;  2C0W A;  3AEA C;  1K8A Q;  2JJL A;  1LT1 A;  3VYI A;  4R4M A;  2A06 E;  1LT9 C;  3A0B E;  1YIJ P;  1LTA C;  1SQP G;  1NU1 D;  1FZG A;  3TYY A;  3H1K E;  5KKZ C;  1EDI A;  5KJ7 A;  1IFN A;  3IF4 A;  1R8E A;  4I6M C;  1MV8 A;  3II6 A;  2PRR A;  3PJS K;  1KQL A;  5E79 H;  1EXI A;  5CCG A;  3L71 J;  1BGY E;  1SQV E;  2K3R A;  3L72 J;  2M3B A;  2KLV A;  4Z1M H;  1UIX A;  3AE8 C;  4LC1 A;  1SQX K;  1RF1 C;  3L71 D;  5AVU B;  1S5L X;  2WSE H;  4GT1 A;  3BVH A;  1SQB J;  3RL0 D;  1DEE G;  2IBZ G;  2WZ7 A;  3L72 D;  1SS1 A;  1FU1 A;  3L74 G;  2I8D A;  4L76 A;  5KLV K;  1H0T B;  2YMK A;  1JB0 J;  1SQB D;  4GKG A;  4WY4 D;  3A7O A;  1WRG A;  1KB9 D;  1Y8A A;  1N7S A;  3F5H A;  4GOD A;  2JHI F;  5AW5 B;  2HOD C;  2ZAE B;  4UB8 E;  2J3O A;  2J64 A;  4IOI H;  2OQQ A;  2FYU E;  4Y99 B;  1VQO P;  1RE4 B;  2Z4E A;  2Q5U A;  4U3F G;  3ZDM A;  2WPR A;  3MZW B;  3GHG C;  2H88 C;  2MJZ A;  1Q81 Q;  4I2L C;  3TGU D;  4QMA A;  3RK3 E;  2HLO B;  4IFF A;  2YKP A;  3RK3 B;  4RES B;  2E74 B;  1KZU B;  3AED C;  2A45 H;  5KAI H;  1R5L A;  1SQQ G;  2JKV A;  1QVG O;  1S9K E;  5AVY B;  1N86 B;  4ASV A;  1PIX A;  3KZI H;  1JY3 O;  3V2P A;  5APY A;  4KJM A;  3Q3D A;  4AYC A;  1NTK E;  4JYB A;  3CCM P;  1RE3 A;  2XZR A;  2NPS C;  3L70 G;  4XFJ A;  3ABV C;  1N7L A;  1KQS O;  4A7P A;  2KI7 B;  3PHL A;  1LWU C;  3BAT A;  3M0D C;  3L75 E;  3P8C D;  3HRN A;  4H13 D;  1M1J B;  1L0L G;  3B4S A;  5AVS B;  4YTP C;  3H32 A;  1ZOY C;  2KOG A;  2YO3 A;  1Q82 Q;  2IZ0 A;  1KB9 H;  3CWB E;  1FZG C;  2SPZ A;  3HE5 A;  3TK1 A;  2KSE A;  1FE6 A;  1QL2 A;  5KJ7 C;  4D6T E;  1HUC A;  2Q1K A;  1URQ D;  4OWF A;  1KYO I;  3RL0 C;  2XNX A;  1G1I A;  1E79 H;  1SFC A;  2HFE D;  1BE3 G;  2J59 M;  1FZD A;  5AVX B;  1GW4 A;  1N73 B;  1E5W A;  2FFD B;  1IJD B;  2N1T A;  5CCG C;  2AXT H;  1FOS E;  2WPV B;  5BU8 B;  3T97 B;  2FBW C;  1AV1 A;  4L73 A;  1JTH A;  2KUB A;  1PZQ A;  4JBZ A;  1BCC G;  1GK6 A;  2OYI C;  1H89 A;  1EQ7 A;  3HTK B;  1FZE C;  1NH4 A;  1VQ4 P;  1HF9 A;  1GU5 A;  3HE4 B;  2L5G B;  2GA1 A;  1NTM E;  1J1E C;  2D2C B;  1N7S C;  1OW6 A;  3AE9 C;  4PJ0 H;  3H1K D;  5AVR B;  2N9B A;  1X79 B;  3GF3 A;  1BGY J;  1Z56 A;  1JY3 P;  2Z4E C;  4PD4 I;  1FZA A;  1SQV J;  1RY3 A;  1P84 H;  2H43 C;  1FDO A;  2OYH B;  4M7H A;  5TIS H;  3H1L G;  2CPB A;  1BGY D;  4B86 A;  2IBZ I;  1OW8 A;  3RGU A;  1LTJ A;  1SQV D;  1JCC A;  2AEM A;  2WSS H;  5AW7 B;  3BCC E;  5APQ A;  1PP9 E;  3VP9 A;  3MTU E;  3MD0 A;  2QVA A;  4EPU A;  5CCH D;  1FJP A;  3CX5 E;  5CJ4 A;  1JY2 N;  1VQ6 P;  2E42 A;  1A02 F;  3CC7 P;  1CI6 A;  1SQX E;  1FZB B;  3G9R A;  4BRY A;  4K3A A;  3A0H E;  3QH9 A;  3V2N A;  3L72 E;  3CCU P;  2YMY A;  2H8P D;  3WU2 H;  1ZV8 A;  5KLV E;  2N9Y B;  1LTI C;  2HPC B;  2FXM A;  1SQB E;  2Y0E A;  4KHX A;  2VRS A;  1RE3 C;  5GTI H;  3TF5 A;  1LJ2 A;  1FZF B;  3IN6 A;  2OTJ P;  3C1L A;  4WWI A;  3RK2 C;  1Q7Y Q;  5KLI C;  4W7Y A;  3WMM 0;  4H44 C;  1L0N G;  2FYU D;  1VQ9 P;  1D7M A;  1JMB A;  4H0L C;  3G4S P;  3JCU H;  2V7Q J;  3H1J E;  4IL6 H;  3CCJ P;  3VMZ A;  1SLQ A;  2JEE A;  3RK3 D;  1IFD A;  2E74 D;  2E76 B;  1VF5 C;  1CW5 A;  3TNU B;  3D6Z A;  3AE4 C;  4I1L A;  1X0T A;  1EZV D;  3BVH B;  1IC2 A;  3A0B H;  1NVO A;  1S9K D;  1LP1 B;  1PPJ G;  1Y47 A;  1SFC C;  1K05 A;  3JC2 2;  2RMZ A;  2HG5 D;  2YKQ A;  1H88 A;  1NTK D;  3L75 J;  1GTW A;  2KNC A;  2J1G A;  4I7Z C;  2ZVN B;  3H1H E;  1NU1 G;  1L4A A;  2R5B A;  4PV1 B;  2YKO A;  2Y0D A;  3KHU A;  2IYO A;  5B66 E;  1PL5 A;  2HOD A;  1Z3U A;  1IFJ A;  2NZ2 A;  3L75 D;  4OGQ B;  1YJW P;  1HBW A;  3C8V A;  1T3J A;  1RF0 B;  1IK9 A;  1N2D C;  2POH A;  3P8C E;  3CWB J;  3RBZ A;  1EDJ A;  4R4L A;  3M9B A;  4D6T J;  2E75 B;  2C9N Y;  3BRT B;  4PD4 E;  1XTG B;  3H25 A;  3KYQ A;  1W5C E;  3CWB D;  3NMD A;  3L71 G;  4O9B A;  5CCH C;  2KSJ A;  2Q9I A;  3OJA B;  4D6T D;  5DJT B;  1HGV A;  1RH5 B;  1KMI Z;  4UB8 H;  1FZA C;  4GDO A;  2J3F A;  2WVR A;  3CCV P;  1KTM A;  3GLM A;  1KFM A;  2LKM A;  3LW5 J;  1FOS F;  3R4Y A;  1URQ B;  1HTL C;  1SVF A;  2GM4 A;  1QLE D;  2QM8 A;  1R5S A;  2KZJ A;  1NHL A;  3SWF A;  4ZKP A;  5KTB A;  4JPZ B;  3D6Y A;  2WSF H;  2J0G A;  1RE4 C;  1H8A A;  1FBM A;  1KIL E;  1PGP A;  1IK7 A;  3FXE A;  2W83 C;  1LWU A;  3L37 A;  1KIL B;  3FWL A;  1U7J A;  2FYN C;  1ZME C;  3MP7 B;  4AUW A;  3TGU G;  3Q2Y A;  2QEX P;  2D2C D;  1NTM D;  3BRV B;  4UB6 E;  1GL2 B;  1VPC A;  2G8Y A;  1S3J A;  3RK3 C;  2PGD A;  3O6Q A;  5EFW B;  1EC5 A;  2J61 A;  2K9J A;  4BXL A;  4WB4 A;  3Q5S A;  1OMI A;  4HB1 A;  4N78 D;  5CJ0 A;  2P2U A;  2XNX B;  3CL3 D;  1BSH A;  1FAV A;  1S5L E;  3BCC J;  1PP9 J;  5B5E E;  2O01 H;  1JCD A;  3M06 A;  4XE5 B;  5L8R J;  3CCL P;  1BDD A;  2M5A B;  1W2E A;  1AJY A;  1VQ7 P;  3BCC D;  1PP9 D;  1SQX J;  3H1I J;  3RBX A;  3O8Z A;  2CK3 H;  4WY4 A;  1K04 A;  3E1I C;  3CX5 D;  4IL6 X;  5KLV J;  1J1D B;  1VL2 A;  1DD4 A;  1SQX D;  1NWQ A;  1ZP0 C;  2J58 A;  2OYI A;  4NPE A;  1FZE A;  1FZC A;  5KLV D;  3V6I A;  1MKM A;  3AE5 C;  3V5B A;  3SWK A;  4DCK A;  3GMA A;  1L4A C;  2YO2 A;  3H1J J;  2WSC J;  2Q7C A;  3LW5 H;  2JHK F;  3VMA A;  1YQ4 C;  3HUS B;  3CCE P;  3H1J D;  5BVZ A;  2E76 D;  2ZYA A;  3LID A;  3AE2 C;  2H43 A;  1LTJ B;  2JO1 A;  2PFX A;  4DJG A;  2L91 A;  1FID A;  1CZQ A;  1M8O B;  5AVV B;  4XA4 A;  4TLF A;  2Q9I C;  2A45 I;  1M7L A;  1EZV E;  2LXC B;  3OW2 O;  1NTZ K;  2G3A A;  5AW1 B;  3H1H J;  4ZFG A;  2MKV A;  4W80 A;  5TJH A;  2XV5 A;  1J2J B;  5APX A;  5AVZ B;  2A06 G;  4KT0 J;  3M9Q A;  4PV1 D;  2Z5I A;  3HD7 B;  1T2K D;  1HJ0 A;  2AEF A;  3H1H D;  2GUS A;  1LT9 B;  1SQP K;  1AVO A;  3H1K G;  2DW3 A;  3EQ2 A;  3B5N B;  4OGQ D;  3V2Q A;  5KKZ B;  4C7N B;  3CX5 H;  3I5C A;  3KXD A;  2BAS A;  1BGY G;  2E75 D;  3FGA D;  2Q6Q A;  1SQV G;  2KYV A;  1PGQ A;  3AEC C;  3P7K A;  2ZYD A;  3V4Q A;  4PD4 D;  1MFZ A;  1RF1 B;  2O1K A;  2KZI A;  1FZB C;  1NJI Q;  2IBZ D;  1YJ9 P;  1U57 A;  1KQG B;  1AA0 A;  1JMM A;  1KFN A;  2ITA A;  2ZXE B;  2WSC H;  2WT7 A;  4HJG H;  3ITK A;  2Y9Z A;  2IDB A;  2KP8 A;  4WY4 C;  4U3F J;  2QE7 H;  1YI2 P;  3U1C A;  2HOD B;  2P10 A;  3L35 A;  2QJY C;  2FYU G;  1KIL D;  1M56 D;  1KN7 A;  4U3F D;  3A3Y B;  1FZC C;  1GL2 D;  1YTZ I;  3GHG B;  5BU5 A;  1YQ3 C;  3AE6 C;  2KS1 B;  4HYT B;  1YIT P;  1GZL A;  2IZ1 A;  4ZMD A;  2KK7 A;  4MN4 C;  2J60 A;  1ZR2 A;  3KDP B;  1MFT A;  1JY3 N;  1LGH B;  3I55 P;  1SQQ K;  1JC9 A;  3KPE A;  2JHL F;  3AEE C;  2J2P A;  2JDI H;  3S9O A;  5CCH A;  1JUN A;  5B66 H;  4N78 E;  2P1J A;  1ZRT E;  1H0T A;  3K5B A;  4NPD A;  1P84 I;  1ZXG A;  2BEZ F;  1NTK G;  3QWO C;  4GOE A;  5APT A;  1G1J A;  1QL1 A;  3CD6 P;  3M91 A;  4PV1 C;  1G2C B;  2NPS B;  4PD4 H;  1L0L J;  2Y0C A;  3L75 G;  2JWD A;  1RE4 A;  1GK4 A;  2B87 B;  3H1I E;  1L0L K;  3L73 E;  1K9M Q;  3OAK A;  2RH0 A;  5CBO A;  2E75 C;  2WTY A;  4H13 C;  2YIU C;  2HLO A;  3CWB G;  1HJB A;  1BE3 J;  2QJK C;  3VN0 A;  3I56 P;  5APV A;  1FZG B;  2W8Z A;  1FJK A;  2BCC E;  4D6T G;  5AW9 B;  3EFF K;  3L4F A;  3TSI A;  2Z5H A;  5KAF E;  1BE3 D;  1N86 A;  5CMZ A;  1URQ C;  3D70 A;  3W68 A;  2B89 A;  2IX7 C;  4CPG A;  4UB6 H;  5AVT B;  1HGZ A;  1PGO A;  3OA7 A;  1KYO E;  5H2F E;  2J0H A;  2OTL P;  3EFG A;  1YJN P;  3IAO A;  3E1I A;  3G71 P;  2M8R A;  1ZR4 A;  1OFC X;  4ZNC A;  3CXH I;  3MUD A;  2QA4 P;  1FZE B;  4GIF A;  1NAY A;  2AXT E;  1USE A;  1M1J A;  3CC4 P;  4OVN F;  1NTM G;  1GU4 A;  1NTZ E;  3KQG A;  1USD A;  4YXW H;  5B5E H;  3HD7 D;  3E1R A;  3V4W A;  2HYN A;  4K35 A;  3B5N D;  2IPP A;  1N7S B;  2XU6 A;  3H1L J;  1KC8 Q;  1X9V A;  1SQP E;  2GUV A;  3FIB A;  2Z4E B;  2GY7 A;  1IFM A;  1FDI A;  3M9H A;  3H1L D;  1T8Z A;  1N73 A;  2H7H A;  2FFD A;  3BCC G;  1PP9 G;  3SFD C;  3T97 A;  5AW6 B;  1GDT A;  5K5G B;  1OVV A;  1QVF O;  1BDC A;  3SSU A;  1SQX G;  1L2P A;  2D39 A;  3B71 A;  2FIB A;  3HTK A;  2QIW A;  3L72 G;  2IBZ E;  1PV3 A;  1GD2 E;  2CPS A;  2R3C A;  3SFE C;  5KLV G;  3L74 E;  4U7J A;  1VDF A;  3HE4 A;  4Y28 J;  4DOJ A;  1T6A A;  1SQB G;  3FX0 A;  3USS A;  1JM0 A;  1RE3 B;  1VQM P;  3RK2 B;  1S72 P;  5KLI B;  2P7J A;  1QGK B;  1ZW0 A;  3C9I A;  4H44 B;  1L0N K;  2B88 A;  2V7Q H;  2WWW A;  4Y99 C;  4H0L B;  3H1J G;  2O1J A;  2OYH A;  2E5Y A;  1ZN5 A;  1IFP A;  4U3F E;  1SP4 A;  2FKW B;  4N3Y B;  3H32 B;  4YXD C;  1K73 Q;  3F89 A;  2HLO C;  2E74 C;  5AVW B;  2JWA A;  4JYO X;  3HE5 B;  1X8Y A;  1SQQ E;  1FZB A;  1AFO A;  1ZRT D;  1SFC B;  1Q2N A;  1X22 A;  1N86 C;  1S2E A;  2V4H A;  2C9L Y;  2ZXX A;  2OAR A;  2N1T B;  4OH8 B;  3VMY A;  3HD7 C;  5GTH E;  2IFN A;  2HPC A;  2NPS D;  3H1H G;  3R2P A;  3CXH E;  1NU1 K;  4I7Z B;  3B5N C;  1FZF A;  1JTH B;  2J5U A;  3L73 J;  2Q3I A;  2QG4 A;  5AW4 B;  3A2A A;  2XND H;  3L70 E;  1M57 D;  1DD3 A;  2K37 A;  3MUD C;  1N8R Q;  2PAJ A;  5APU A;  1UII A;  3H1I D;  3L73 D;  3PLN A;  3NFQ A;  1M1J C;  2PP6 A;  3VTP C;  2BCC J;  1L0L E;  3CMA P;  2K88 A;  2KB7 P;  3TNU A;  4RJT A;  1OVU A;  1OW7 A;  2Q3E A;  2FXO A;  5KJ7 D;  2BCC D;  2R3S A;  3U59 A;  1T3U A;  1OWA A;  1LP1 A;  1FZA B;  2IFM A;  5CCG D;  5C39 A;  1SQB K;  2FXP A;  4EI2 A;  2E5T A;  1BE3 E;  1N73 C;  2WPS A;  2FFD C;  1GW3 A;  1RQU A;  2UWJ E;  3AEF C;  2JP3 A;  1KYO D;  1Q90 D;  4JZC A;  2J3G A;  3GW6 A;  1NTZ J;  3TGU J;  5AW0 B;  3CI9 A;  1CI6 B;  2QJP B;  2WMM A;  2K9Y A;  3FWN A;  4BRY B;  1BCC E;  1M90 Q;  4DZO A;  1RF0 A;  1YTZ T;  2FYN B;  1NTZ D;  3A5T A;  1N7S D; 
#chains in the Genus database with same CATH homology
 1JY3 N;  1NTM K;  1LGH B;  1S9K D;  3IFM A;  1SQQ K;  1JC9 A;  2YNY A;  1SFC C;  3IR9 A;  3KPE A;  2JHL F;  4EIJ A;  2WT7 B;  2C0X A;  2J2P A;  2C0W A;  1AQ5 A;  5CCH A;  3P32 A;  1JUN A;  2JJL A;  4N78 E;  3VYI A;  2P1J A;  2HG5 D;  2YKQ A;  1LT9 C;  1H88 A;  1LTA C;  1LTS C;  2W27 A;  3G3Z A;  1FZG A;  3TYY A;  1GTW A;  2J1G A;  5KJ7 A;  2OYH C;  1L4A A;  1IFN A;  5APT A;  3LIE A;  2R5B A;  1G1J A;  1QL1 A;  2YKO A;  4I6M C;  5APW A;  1MV8 A;  3M91 A;  1URQ A;  3MIW A;  3II6 A;  1G2C B;  1LTB C;  2HOD A;  1Z3U A;  1IFJ A;  2NPS B;  2WNP F;  1KQL A;  4N6J A;  1HBW A;  4AQR D;  5CCG A;  2XDJ A;  3E1I B;  1T3J A;  1RF0 B;  1IK9 A;  1N2D C;  3VMX A;  3U1A A;  2POH A;  1RE4 A;  1NKN A;  3P8C E;  1GK4 A;  2M3B A;  4WBA A;  1L0L K;  2KLV A;  3PP5 A;  3OAK A;  3M9B A;  4LC1 A;  1SQX K;  1RF1 C;  2C9N Y;  3BRT B;  5AVU B;  2WSE H;  2WTY A;  1XTG B;  4GT1 A;  3BVH A;  1KIL A;  3KYQ A;  3RL0 D;  3NMD A;  1JNM A;  4O9B A;  2WZ7 A;  2HLO A;  1FU1 A;  5CCH C;  2KSJ A;  1JY2 O;  2Q9I A;  3OJA B;  5KLV K;  1HJB A;  1GL2 A;  2HPC C;  1HGV A;  3VN0 A;  3RK2 D;  5APV A;  1FZG B;  1FJK A;  1FZA C;  1FDM A;  4GKG A;  5AW9 B;  3L4F A;  2J3F A;  3TSI A;  4WY4 D;  3A7O A;  2Z5H A;  3NXS A;  1FZF C;  2XKM A;  1L4A B;  1WRG A;  1KFM A;  1OXZ A;  2LKM A;  1FOS F;  1URQ B;  2R32 A;  1HTL C;  1N7S A;  1N86 A;  1SVF A;  2GM4 A;  2QM8 A;  5CMZ A;  1URQ C;  2JHI F;  5AW5 B;  2HOD C;  2P67 A;  4IFM A;  4R9J A;  2J3O A;  2J64 A;  1NHL A;  1MZ9 A;  2IX7 C;  3SWF A;  4ZKP A;  5KTB A;  4Y99 B;  1RE4 B;  2Z4E A;  2Q5U A;  2WSF H;  5AVT B;  1HGZ A;  2J0G A;  1RE4 C;  1H8A A;  1DEB A;  3OA7 A;  2WPR A;  1FBM A;  3GHG C;  2QM7 A;  3V2R A;  2J0H A;  2MJZ A;  3EFG A;  3E1I A;  5APS A;  3N7N A;  3L37 A;  1LWU A;  2M8R A;  4I2L C;  1ZR4 A;  1KIL B;  3MUD A;  3BVH C;  1FZE B;  4IFF A;  4AUW A;  2HLO B;  4IFD K;  4GIF A;  2Q9I B;  2YKP A;  1SFC D;  4RES B;  3RK3 B;  3BRV B;  5AVQ B;  1KZU B;  3BAS A;  1GL2 B;  1VPC A;  1M1J A;  2A45 H;  3RK3 C;  1IFI A;  2I1K A;  1GU4 A;  3KQG A;  2J0Y A;  3HD7 D;  2N1T D;  2J61 A;  3V4W A;  2HYN A;  1FIB A;  4WB4 A;  1S9K E;  3B5N D;  2IPP A;  4N78 D;  1ZLL A;  5AVY B;  1N7S B;  2XU6 A;  5CJ0 A;  4R9T A;  1N86 B;  2P2U A;  2XNX B;  1JOC A;  1JY3 O;  3M0A A;  3CL3 D;  3V2P A;  5APY A;  1FAV A;  1X9V A;  3NTN A;  2O01 H;  1JCD A;  3M06 A;  4XE5 B;  4AYC A;  2GUV A;  1DH3 A;  3FIB A;  4JYB A;  2Z4E B;  4ZKU A;  1T2K C;  1RE3 A;  2GY7 A;  1IFM A;  2XZR A;  3M9H A;  1W2E A;  1T8Z A;  2NPS C;  1N73 A;  2H7H A;  1IO4 A;  3HUS A;  1N7L A;  3O8Z A;  1LWU B;  2FFD A;  1Z3S A;  1LTG C;  4WY4 A;  4EOT A;  3E1I C;  1RF0 C;  1LWU C;  3BAT A;  1PFI A;  3M0D C;  2W6B A;  1SQV K;  3T97 A;  3P8C D;  5AW6 B;  1GDT A;  1HWT C;  1J1D B;  3HRN A;  1NO4 A;  1A02 J;  1M1J B;  1NWQ A;  5AVS B;  3P8M C;  2J58 A;  2OYI A;  4W7Z A;  2J61 B;  2D39 A;  3H32 A;  2FIB A;  1FZE A;  1FZC A;  3HTK A;  2KOG A;  2YO3 A;  1GD2 E;  5AW2 B;  2CPS A;  2R3C A;  1VDF A;  3HE4 A;  1NOH A;  1FZG C;  1JY2 P;  3HE5 A;  3V5B A;  4DOJ A;  3TK1 A;  1QL2 A;  5KJ7 C;  3RL0 B;  1L4A C;  2YO2 A;  1HUC A;  1URQ D;  3RL0 C;  2XNX A;  1G1I A;  2HFE D;  1SFC A;  2Q7C A;  1RE3 B;  3H6P A;  2J59 M;  2ZFC A;  4C46 A;  3LW5 H;  1FZD A;  2JHK F;  5AVX B;  3RK2 B;  1GW4 A;  1N73 B;  2P7J A;  3HD7 A;  1E5W A;  3HUS B;  2FFD B;  1IJD B;  2N1T A;  1L0N K;  3C9I A;  4WY4 B;  5CCG C;  1LT9 A;  1NKZ B;  2WWW A;  5BVZ A;  3LID A;  1FOS E;  4Y99 C;  2H43 A;  2FYU K;  5BU8 B;  3B5N A;  1LTJ B;  2O1J A;  4C7N A;  2OYH A;  1JTH A;  1FID A;  1ZN5 A;  1SP4 A;  1CZQ A;  2OYI B;  2FKW B;  4JF7 A;  5AVV B;  1LTT C;  1JO5 A;  4N3Y B;  3H32 B;  5CHX A;  1KIL C;  1GK6 A;  1FZC B;  4XA4 A;  2OYI C;  1H89 A;  1XTC C;  1EQ7 A;  3HTK B;  3H32 C;  2WPQ A;  1FZE C;  2HLO C;  1NH4 A;  2Q9I C;  2A45 I;  2W6A A;  1M7L A;  1GL2 C;  5AVW B;  4JYO X;  1GU5 A;  3HE4 B;  2L5G B;  3CLQ A;  2J5Z A;  3HE5 B;  1NTZ K;  5AW1 B;  1J1E B;  1X8Y A;  1J1E C;  4ZFG A;  1FZB A;  4W80 A;  1RF1 A;  1AFO A;  1SFC B;  2XV5 A;  4LGD E;  1N7S C;  1N86 C;  1J2J B;  1NAF A;  2XNX C;  1YYC A;  5APX A;  5AVZ B;  2C9L Y;  2JHM F;  3M9Q A;  2OAR A;  2Z5I A;  3HD7 B;  1T2K D;  5AVR B;  2N9B A;  2N1T B;  2GUS A;  1X79 B;  4OH8 B;  1LT9 B;  3HD7 C;  3VMY A;  1SQP K;  1Z56 A;  2IFN A;  1JY3 P;  2HPC A;  2N1T C;  2NPS D;  3EQ2 A;  2A45 G;  3B8E B;  3R2P A;  2H43 B;  2Z4E C;  1FZA A;  3B5N B;  1NTK K;  3V2Q A;  1RY3 A;  1NU1 K;  1HH0 A;  4C7N B;  2H43 C;  3B5N C;  2OYH B;  1FZF A;  4M7H A;  1JTH B;  3I5C A;  4M3L A;  2CPB A;  2BAS A;  2Q3I A;  2E43 A;  5AW4 B;  3A2A A;  4B86 A;  1LTJ A;  1JCC A;  2PAJ A;  5APU A;  5AW7 B;  5APQ A;  3VP9 A;  3MTU E;  2KYV A;  1J1D C;  3MD0 A;  2R5D A;  4EPU A;  3SWY A;  3NFQ A;  1M1J C;  5CCH D;  2PP6 A;  3VTP C;  3P7K A;  3V4Q A;  1FJP A;  5CJ4 A;  1JY2 N;  1CSB A;  2E42 A;  1A02 F;  3MGN A;  1MFZ A;  1FIC A;  1CI6 A;  3GHG A;  1FZB B;  1RF1 B;  2O1K A;  2KB7 P;  3TNU A;  1HVV A;  1FZB C;  2J3U A;  5KJ7 D;  3V2N A;  1L4A D;  2YMY A;  2H8P D;  1ZV8 A;  4HH2 A;  3U59 A;  2WIT A;  5AW3 B;  2FYZ A;  2I1J A;  1LTI C;  1JMM A;  1T3U A;  3UIA A;  2HPC B;  2FXM A;  1OWA A;  1KFN A;  1FZA B;  4KHX A;  2VRS A;  1RE3 C;  2IFM A;  5CCG D;  2ZXE B;  2WSC H;  2WT7 A;  1FZF B;  1SQB K;  2JHH C;  3RK2 C;  3L36 A;  1N73 C;  3VOP A;  2WPS A;  4W7Y A;  3HUS C;  2KP8 A;  3WMM 0;  2FFD C;  1GW3 A;  4WY4 C;  3U1C A;  2HOD B;  1LTJ C;  3L35 A;  4LLH A;  1KIL D;  4JZC A;  2J3G A;  3VP8 A;  3VMZ A;  1SLQ A;  3N4X A;  1MUU A;  2JEE A;  3RK3 D;  1IFD A;  5AW0 B;  1DX7 A;  3A3Y B;  1G2C A;  3CI9 A;  1FZC C;  1GL2 D;  1CI6 B;  1YTZ I;  3GHG B;  4JYC A;  2NPS A;  4C7R A;  5BU5 A;  4NYT A;  4HYT B;  1CW5 A;  1GZL A;  3TNU B;  4I1L A;  2J3F D;  4DZO A;  4M7F A;  1RF0 A;  1YTZ T;  3BVH B;  3M0D A;  1IC2 A;  1WT6 A;  5AW8 B;  2J60 A;  1ZR2 A;  3A5T A;  3KDP B;  1N7S D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...