1N73C

Fibrin d-dimer, lamprey complexed with the peptide ligand: gly-his-arg-pro-amide
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
322
structure length
322
Chain Sequence
b'KTVQKILEEVRILEQIGVSHDAQIQELSEMWRVNQQFVTRLQQQLVDIRQTCSRSCQDTTANKISPITGKDCQQVVDNGGKDSGLYYIKPLKAKQPFLVFCEIENGNGWTVIQHRHDGSVNFTRDWVSYREGFGYLAPTLTTEFWLGNEKIHLLTGQQAYRLRIDLTDWENTHRYADYGHFKLTPESDEYRLFYSMYLDGDAGNAFDGFDFGDDPQDKFYTTHLGMLFSTPERDNDKYEGSCAEQDGSGWWMNRCHAGHLNGKYYFGGNYRKTDVEFPYDDGIIWATWHDRWYSLKMTTMKLLPMGRDLSGHGGQQQSKGNS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibrin alpha-1 chain
publication title The Crystal structure of fragment double-D from cross-linked lamprey fibrin reveals isopeptide linkages across an unexpected D-D interface
pubmed doi rcsb
molecule tags Blood clotting
total genus 92
structure length 322
sequence length 322
chains with identical sequence F
ec nomenclature
pdb deposition date 2002-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1n73C03
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 1n73C01
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 1n73C02
1FZBB 3BVHA 3GHGC 2Q9IB 2OYHB 2J60A 2Z4EA 2XNXA 1RF0B 2J3FA 1FZAC 1FZBA 4NYTA 2J0HA 4JZCA 1LTJC 1RE3C 1RF1A 1RF0A 2FIBA 2JHKF 1Z3SA 1LT9A 2H43B 1RE4B 1JY2O 2HLOA 2HODC 3BVHB 1FZCA 3FIBA 2XNXB 3H32A 1M1JC 1FZFA 1JY3P 2HPCA 1FICA 2J0GA 3E1IC 1LWUC 1FIDA 1RF1B 2OYIC 2JHIF 1LT9B 2J3GA 1FZEA 1N73A 1JY3N 3HUSC 2GY7A 2J2PA 1FZGC 2HLOB 4ZFGA 2H43C 1RE4C 1N86C 1FZCB 4R9TA 2A45H 2FFDC 3BVHC 3H32B 2Z4EC 1FZFB 2HPCB 2J1GA 2A45G 2D39A 1FZBC 2Q9IC 2WNPF 2HODA 2OYHC 1FZEB 2J3OA 2JHLF 1N73B 4EPUA 1RF0C 4JYOX 1JY2P 1M1JA 1FZAB 4R9JA 3GHGA 2J64A 2J3UA 1T3UA 1JY3O 1LTJB 1LWUA 1RE3B 3H32C 1FZAA 1JC9A 1FZGA 2HODB 1LTJA 1RE3A 2XNXC 2FFDA 1FZEC 1N73C 2J0YA 1M1JB 4M7HA 3GHGB 1RF1C 1FIBA 3E1IB 1LT9C 2JHHC 1LWUB 2Q9IA 2OYIB 2J3FD 2OYHA 2HLOC 1W2EA 2J61B 1FZCC 3HUSB 1FZGB 3E1IA 2A45I 1N86B 2OYIA 1JY2N 2FFDB 2JHMF 2J5ZA 1FZFC 2J61A 2HPCC 3HUSA 2H43A 4M7FA 2Z4EB 1RE4A 1N86A 1Z3UA 1FZDA
chains in the Genus database with same CATH superfamily
1VQPP 1SQVJ 4PV1D 1SP4A 2P10A 3PJSK 1SQPD 2OYHB 3LIDA 3G3ZA 1KV4A 2L5GB 3CMAP 2CK3H 2ZJSE 2O1JA 3RK2D 4JZCA 3MIWA 1OFCX 1EXIA 5AW6B 4H13B 1L4AB 2HPCA 1FICA 3KYQA 1LWUC 1NKZB 1FJKA 1FBMA 2WZ7A 1L4AA 4KJMA 3W67A 2HLOB 3RL0C 4IFFA 1HTLC 1M57D 1OIPA 1JM0A 3L73J 2J1GA 5KLIB 5C39A 1DD3A 2QJPC 1NOHA 2WPRA 4B86A 2QJYC 5KKZC 2XU6A 2YO3A 5KLVJ 2KOGA 1KQGB 1GZLA 1M1JA 2IFMA 4M3LA 4D6TE 5APTA 3MD0A 2W83C 4PJ0E 5CMZA 1EZVE 3LIEA 3GF3A 2WSEJ 2WQYC 2C9NY 2Q9IA 3AE4C 1BDDA 2B87B 4O9BA 4PV1C 2A45I 1JY2N 2QVAA 3U59A 2B87A 4D6TG 5KAIH 2R44A 3CX5H 3RK2C 1PGOA 5DJTB 1LNQA 2J60A 4HKZH 2P67A 1EZVG 2IBZD 1AV1A 2D2CD 1NTKE 3L36A 1GL2D 2Q5UA 2WSCJ 1RF1A 3D70A 1OW6A 2JHKF 1NKNA 4N6JA 1PPJE 1W5CE 3U1AA 2Q6QA 1DEBA 1SQBD 2RKLA 3A0BE 3H1LE 2W6BA 1N86C 3U1CA 1RQVA 2IFNA 1NTKG 3CWBJ 1EQ7A 1KB9E 1IFIA 5B5EH 1FZFB 2C9LY 1OXZA 2WNPF 1FJPA 4R4LA 1BSHA 3AE2C 3FWLA 1Y47A 4R9JA 3B71A 2J3UA 1LWUA 1N7SD 2KSJA 3NXSA 4L74A 1SVFA 3H1HE 3L75G 5BVZA 1RHZB 2JO1A 3A3YB 4IFDK 1BDCA 2FYNC 3ITKA 1P84D 1IFPA 2AEJA 4XFJA 1NU1D 3BRVB 1LTBC 3Q5RA 2D2CC 2ZYDA 2ZVOB 1NGMB 1GL2C 2RN0A 2O01H 2LXCB 1SS1A 1PV3A 4K3AA 5AW1B 4N78D 3H1HG 2PGDA 1HH0A 3LW5J 4KHXA 1QLED 3AE5C 2YKOA 1FIDA 1NTME 3F89A 2V4HA 3M06A 1NH4A 4ZFGA 1H0TB 1FZCB 1P84I 1SQQK 2FFDC 1SFCD 1NAYA 4LLHA 1HGZA 3TGUE 1H0TA 3AE1C 3B5NB 2KI7B 1N2DC 1KYOI 2JHLF 1N7SC 1RF0C 2OTLP 3CCLP 1OVVA 1S3JA 3HRNA 1KQLA 3IR9A 1RY3A 4D6TJ 3AECC 3FGAD 1K05A 4JYBA 2K9JB 5KAIE 3CX5E 4K35A 5APWA 2L91A 2Q3EA 2Q7CA 2HR3A 3TGUG 1ZMEC 1J1EC 1IO4A 4HJGH 1AQ5A 4EIJA 1SQVD 1HJ0A 3L70E 2E74D 4OGQB 2KIKA 2MKVA 2ZYGA 1M1KQ 1L0LE 2HFED 4JQ0D 1FDIA 1URQB 3D6YA 1GU5A 2LXBA 3HD7B 1SQXD 1NTKJ 1YIJP 1VQMP 2N1TB 3HD7A 1USEA 4DT0A 1JY2O 3BVHB 5B5EE 1NTMK 3HTKB 3B8EB 3H32A 2K88A 2YKPA 3HTKA 2FBWC 1YITP 1SFCC 1IC2A 1VL2A 3L70G 1GL2A 4I2LC 3P8MC 1VF5D 1L0LG 2H43C 3D6ZA 4WB4A 1RE4C 3H1LJ 3QH9A 1FE6A 1KFNA 1QVGO 2WPQA 3WUUA 4Z1MH 3HE5B 3RK3E 3A5TA 1UIXA 3H1JE 2PFXA 3HE5A 2I1KA 1CI6A 2J58A 1FDOA 2P2UA 3GG2A 1BCCD 4NPEA 1J2JB 2FFDA 3L71D 1VQ7P 1L0NK 2Y9ZA 3VTPC 3NMDA 2QRXA 5KLVE 2KNCA 3H1HJ 2WSSH 1XTGB 2E74C 2IYPA 3H1JG 1L0LK 3KXDA 5AVWB 2B88A 4IL6H 4GDOA 2KLVA 2N9BA 1RQUA 1Q90D 2QJKC 2Z4EB 5CCGA 1Z3UA 1VQ4P 1NTZE 2Z4EA 3O6QA 4NPDA 3JCUH 2KSEA 2J0HA 4DJGA 1HVVA 2XDJA 4UB6H 1GDTA 4EDFA 3NFQA 3V5BA 2FY8A 3EFGA 1VF5C 4Y99B 2E43A 3CMEP 2C0WA 2C0XA 1QEXA 1LGHB 3L74E 1N73A 1JY3N 1E5WA 1NTZG 2ZYAA 2H89C 2A45H 1OVUA 2PRRA 2A06E 3V6IA 2WVRA 3AEDC 5KJ7D 2OTJP 5AVZB 1X22A 3H1KD 1IFNA 3TGUJ 5GTHH 2YMKA 3TF5A 2AXCA 1JY2P 1K8AQ 3CXHD 3AEBC 3OW2O 3M9HA 4WY4B 3Q2YA 2JWAA 4ZKUA 2NRGA 5KLVK 3KQGA 3L74G 3N7NA 1X79B 3K5BA 4HH2A 4RO0A 3VMZA 2A06G 4YXDC 2HYNA 3GHGB 3M0AA 3E1IB 1XTCC 5AW4B 3P8CE 4OWFA 1OVRA 2QM8A 3E1IA 3V4QA 1YI2P 2CPBA 3L72E 3L70J 3VMXA 1L0LJ 1GW4A 1OMIA 2K3RA 2B89A 1LTGC 1PZQA 4H44D 3RK3B 2QM7A 1CSBA 1AFOA 5AW9B 5CJ0A 1QVFO 3P7KA 1U7JA 2J0GA 4PD4H 3L72G 2OARA 4BRYB 2BCCD 2OYIC 5KJ7C 1FZEA 2M8RA 3HUSC 1BGYD 2M3EA 2YIUB 2LR2A 3L37A 4BRYA 3MUDC 2ZXXA 1ZRTD 3TNUA 2LKMA 1GU4A 5APYA 2FXMA 2HPCB 1LTAC 1QL2A 1VQOP 2J3OA 5AW7B 1HJBA 3MGNA 2YO2A 3H1JJ 3RGUA 5TJHA 2WPVB 1FDMA 2JDIH 1NVOA 4IL6E 2E75B 3AEEC 3PRJA 2J0YA 1M1JB 1DD4A 3BASA 2O01J 2PP6A 3JCUE 1LJ2A 4L76A 4UB6E 3FX0A 2ZXEB 3BCCD 2JWDA 2NZ2A 2KLUA 1ZV8A 4WWIA 4A7PA 2H8PD 3VOPA 1FZBB 1N7LA 1BE3G 2Q9IB 2R3CA 1FC2C 4H44C 2FKWB 1NTZJ 1FZBA 2IX7C 2QA4P 4LC1A 1SQPG 1H89A 5B66H 1PPJD 2HODC 1SLQA 3UIAA 5GTHE 4ZMDA 1RF1B 3R4YA 5APSA 5EFWB 3H1LD 4YTPC 3V2PA 3H1ID 3L74J 1GTWA 4H0LD 1KB9D 1HWTC 3S4RA 2A45G 1SQQD 5AW8B 2GA1A 4EPUA 4WBAA 1H88A 3I56P 1S5LH 5AVTB 4RKUJ 1JY3O 5DJUB 1K73Q 3M9QA 5KJ7A 2K37A 4AQRD 1MFZA 3L75E 4NPFX 3H1HD 4KT0J 3EWKA 3GF7A 1VQKP 2XV5A 1YBKA 1LWUB 2IBZE 4XE5B 3JC22 1LP1A 2J3FD 3GMAA 1BSNA 3RL0B 2NPSD 3NTNA 1KB9I 2KP8A 1PGJA 3L72J 4PD4E 3CC4P 1VQ6P 1EDLA 1YJNP 1FOSF 1SQBE 3BATA 2FIBA 1AQTA 2IBZG 1K04A 2R32A 2QEXP 1NTKK 3VP8A 1KYOD 2KYVA 4H0LC 4HB1A 1NTMD 1OX3A 1JCCA 1A02F 3Q5SA 1ZP0C 4RESB 4U3FE 1PP9E 3BVHC 2FYUD 1SQBG 1GD2E 1KILD 3G6EP 3AE9C 4JF7A 2HODA 1YJWP 2XZRA 3KHUA 2E5TA 2AXTH 1JO5A 1KFMA 1HF9A 3CX5D 1USDA 3Q5PA 3HE4A 4U3FG 1PP9G 1T2KD 3OAKA 1ZR4A 2NPSC 5AVUB 1LT9C 1DX7A 1GK6A 1L0ND 1EDJA 2XKMA 4YXWH 4N78E 5AVVB 2IZ1A 2JP3A 5B66E 1YQ3C 1N86B 4GODA 2POHA 1N86A 1NU1G 1KN7A 2R3SA 2IZ0A 1GMJA 3M0DC 2WITA 1FZAC 3W68A 3TK1A 1JB0J 2KS1B 1HGVA 1T3JA 2KS1A 3CX5I 5CCHD 3FIBA 1MKMA 2YXQB 4CPGA 3CCRP 1QX8A 2ZT9D 4R4MA 1YHQP 5CBOA 1S5LE 1S2EA 1KILC 4TT3H 1X8YA 3E7KA 2Q1KA 3H32B 3PHLA 3II6A 2D2CB 3P32A 1GL2B 1M7LA 2PAJA 1PFIA 1OW8A 2J64A 4L73A 2K9YA 3CXHH 1JUNA 4I7ZC 3L73D 1T2KC 2KZJA 4BWNA 2IYOA 2XNXC 3L75J 1YQ4C 3SWFA 2YMYA 5KLVD 3Q1MA 1CI6B 2Y9YA 3R2PA 1JCDA 1VDFA 1JTHA 5APQA 1ZR2A 1W2EA 4H13D 1L4AD 1SQXE 1JEKA 3VMYA 2M0BA 1MV8A 3OA7A 2J5UA 2CPSA 2FFDB 2J5ZA 3PTZA 4OH8B 3FWNA 4IL6X 2KNCB 1PGQA 1IK7A 1LTSC 3GHGC 3OJAB 2E76B 3CCSP 1N7SB 1RF0B 2J3FA 3AEFC 4L75A 3CLQA 1VQNP 4C7NB 3I55P 5CCHC 1LTJC 1RE3C 1N7SA 1RF0A 1SQBJ 3C8VA 2NPSA 1LT9A 2ZT9C 1MZ9A 3T97A 2KK7A 4C7NA 1Q7YQ 4LGDE 1SQXG 1Z56A 3O6QB 1G1JA 3S9OA 3O8ZA 2ITAA 3I5CA 4U7JA 1YTZI 4EOTA 2AXTE 4ZKPA 2Y0EA 2O01N 1FZGC 4YPCA 2P58A 1VQ5P 3M0DA 1J1EB 2RH0A 4U3FJ 4W7ZA 2K1AA 1PP9J 3PH0A 1BCCE 3L71E 2E42A 2OYHC 2AEMA 1KORA 1N73B 1Y9BA 2G8YA 2YIUC 1YYCA 3CWBD 1NHLA 1NWQA 2G3AA 4OVNF 1ZLLA 4H13C 1L4AC 3SWKA 3V2NA 1FIBA 2WSFH 1BCCG 4C46A 3L71G 2HLOC 1SFCA 2IPPA 1KD1Q 4Y28J 3CCEP 4ZNCA 5KLIC 2H43A 1KTMA 3SFEC 1RE4A 1T6AA 2FXPA 1U57A 1Q86Q 2XNXA 2V7QH 1S9KD 2MJZA 5TISH 2OTKE 3MP7B 3B4SA 1JNMA 3KPEA 1NTZK 3WMM0 3H1KE 2JR8A 2UWJE 2FYZA 3TSIA 2W6JH 1J1DB 2XNDH 2E74B 3CXHE 1EC5A 2JKVA 4R9TA 2E5YA 1YJ9P 1Q82Q 3G9RA 2QJKB 1DIPA 2D39A 1FZEB 2J59M 3H1KG 3TNUB 1T3UA 3VP9A 1H8AA 3CCUP 1FZGA 1FOSE 2QE7H 2WWWA 3E1RA 1QGKB 2ZAEB 4IFMA 1VF5B 5APXA 4M7HA 4GKGA 1KQFB 3IN6A 3USSA 5AVRB 5GTIH 3N4XA 4D6TD 2OYHA 1SQXJ 1IK9A 1BE3E 4GOEA 3SWYA 1EZVD 1FZFC 1M90Q 1YTZT 1EDKA 5KAFH 5H2FH 4DOJA 1SQPE 3B5ND 4NYTA 2BCCE 3IFMA 1CW5A 3AEAC 1BGYE 5AW3B 1P84H 1ZRTE 2HLOA 1S72P 3ABVC 3MHVA 2QSIA 3CL3D 1KZUB 1KYOH 3VN0A 1NTKD 2H88C 3V2QA 2W90A 3QWOC 4W80A 2Q3IA 2Y0CA 4W7YA 1IFMA 2BEZF 2BCCG 1IFDA 3D71A 4QMAA 1DH3A 1BGYG 3L35A 1EZVI 1GK4A 2ZVNB 1BCCJ 3F5HA 4ASVA 1MFTA 3L71J 4OGQD 1R5LA 2KXPB 1S5LX 3BCCE 3GLMA 1URQD 3L75D 1WMKA 3HD7D 1OW7A 3G71P 2N1TD 3S1KA 2O1KA 5APUA 3MTUE 2WMMA 2JHHC 2KZIA 2OYIB 2HG5D 5TISE 2AEFA 1HBWA 1FZCC 3HUSB 2IDBA 1VQ9P 3PP5A 2OYIA 5AW5B 1SQPK 3HUSA 3B5NC 4GOFA 3CCJP 4PD4D 3BCCG 1L2PA 3MUDA 4C7RA 1LP1B 3AEGC 1LTTC 1OWAA 1NYHA 3WUVA 1M56D 2QG4A 1WRGA 3VMAA 3H1IE 2YKQA 2FXOA 2OGUA 1AVYA 3SFDC 1FAVA 4XA4A 3PLNA 3CC2P 2W6AA 1SQQE 1KQSO 1PPJG 1Q2NA 1FZFA 3RBZA 3H1KJ 2QJPB 2QIWA 2QJYB 5KKZB 2JHIF 2IBZI 1GW3A 4U3FD 3CCMP 1PP9D 2E76D 5AVSB 1S4XA 3H1LG 3KZIH 2ZFCA 4OGQC 1IJDB 3H1IG 2M3BA 4UB8H 1E79H 3CPWO 5CCGD 4PD4I 1PIXA 1URQC 4H44B 5GTIE 3HD7C 4TLFA 4EI2A 1SQQG 1KMIZ 2O3JA 2N1TC 3M9BA 3H32C 4PV1B 3A0HH 3TGUD 2HODB 1X9VA 2B9BA 5M1BA 3RBXA 5KAFE 3V4WA 3RK2B 5H2FE 1N8RQ 2JJLA 1OZHA 5AW2B 1D7MA 3RL0g 1JMMA 1MUUA 2Z5HA 2J61B 1G1IA 4MN4C 1HUCA 3HE4B 1P84E 3JSVC 3CCVP 1VPCA 1NU1E 2JHMF 3SSUA 2J61A 1A02J 1BE3J 5AVYB 2H7HA 2OQQA 1KYOE 2WSEH 1NAFA 1UIIA 2DW3A 1KC8Q 1SQPJ 2BCCJ 3WU2H 1Y8AA 1PGPA 2Z5IA 1Z3SA 3CI9A 2N9YB 1BGYJ 2FYUE 3L70D 1FZCA 1KILE 3A7OA 3BRTB 1SQBK 4WY4D 1L0LD 2E76C 3ZDMA 1JY3P 3B5NA 2WSCH 4JBZA 3V2RA 5CCGC 4IOIH 1NTMG 1JOCA 2Z4EC 3KDPB 1R5SA 3H6PA 2K9JA 1X0TA 1S1CX 4HYTB 2FYUG 1U7MA 3TDKA 2WSFJ 5APVA 2VRSA 2I8DA 2FYNB 1L0NE 1LTIC 2W8ZA 3BCCJ 4GIFA 4Y99C 1N73C 4EYYQ 3RK3D 3H1JD 4H0LB 1NU1K 2V7QJ 3MZWB 5AW0B 2KUBA 3FXEA 1URQA 3CD6P 2R5BA 2W27A 1JMBA 1T8ZA 1L0NG 1AVOA 2N1TA 4DCKA 1SQVE 2R5DA 3BVHA 1JTHB 1Q81Q 3G4SP 5CBNA 2FYUK 5BU8B 2KB7P 4WY4C 3M91A 3H1IJ 5E79H 3KZIE 1G2CB 1TU3F 5K5GB 4UB8E 1CZQA 2SPZA 4AYCA 3EFFK 1G2CA 1NTZD 2E75D 1SQQJ 3AE8C 3E1IC 1IFJA 1SQVG 5AVQB 1M8OB 2NPSB 1LT1A 1LT9B 2J3GA 3T97B 2GY7A 3LW5H 1DEEG 3A0HE 3IAOA 3L73E 3WUTA 3AE6C 3EQ2A 4ASWA 1J1DC 4JYOX 3L74D 1FZAB 1ZN5A 5AVXB 3Q3DA 3RK3C 2RMZA 3GW6A 1FZAA 2A06D 1W2BO 1JC9A 2GUSA 4BXLA 4WVZA 2M5AB 1FZEC 2WTYA 3L73G 1EDIA 2P7JA 2M5AA 3WU2E 1SQVK 1KILB 2Y0DA 5KLVG 2GM4A 1R8EA 1KILA 4PJ0H 2HPCC 1PL5A 1NO4A 1NU1J 1AJYA 4JYCA 1K9MQ 2BEQD 1FZDA 2OYOA 1SQXK 3C1LA 1IZNB 5CJ4A 5KTBA 3P8CD 1SFCB 1NTMJ 1ZW0A 3TYYA 3L4FA 4I6MC 2H43B 1AA0A 2E75C 1RE4B 4I7ZB 2P1JA 3L72D 2YNYA 2FYUJ 1FU1A 2XNXB 1M1JC 1WT6A 4N3YB 3IF4A 2J2PA 2BASA 3AE3C 3CWBE 4JPZB 2JEEA 5BU5A 1ZXGA 4WY4A 3CCQP 1FZBC 4RJTA 3RL0D 2Q9IC 2I1JA 2WT7B 2WPSA 3GHGA 2WT7A 3VYIA 4GT1A 3A0BH 3C9IA 3H25A 1LTJB 1RE3B 1L0NJ 5CHXA 2ZT9B 3AE7C 4AUWA 5CCHA 1LTJA 1RE3A 1KB9H 1VQ8P 3CC7P 3CWBG 1EXJA 1RH5B 4DZOA 1NJIQ 3A2AA 1RF1C 4I1LA 1S9KE 1VQLP 3CXHI 2GUVA 1FZGB 1BE3D 5E79E 2YXRB 1QL1A 1ZOYC 3FXDA 5L8RJ 1FS0E 4M7FA
chains in the Genus database with same CATH topology
4C7RA 1SP4A 2OYHB 1LTTC 1OWAA 3LIDA 2Z4EA 3G3ZA 3M0DC 2WITA 1FZAC 2L5GB 2O1JA 3RK2D 2J0HA 4JZCA 1HVVA 1WRGA 2XDJA 3TK1A 3MIWA 1HGVA 2YKQA 1GDTA 1T3JA 3NFQA 3V5BA 1FAVA 4XA4A 5CCHD 3EFGA 5AW6B 3FIBA 2W6AA 4Y99B 2E43A 1L4AB 1FZFA 2HPCA 2C0WA 1FICA 2C0XA 3KYQA 1LGHB 1LWUC 1NKZB 2JHIF 1FJKA 1FBMA 1GW3A 1KILC 1L4AA 2WZ7A 1N73A 1JY3N 1E5WA 2HLOB 3RL0C 1X8YA 4IFFA 1HTLC 2A45H 5AVSB 3H32B 5KJ7D 3II6A 2ZFCA 2J1GA 5AVZB 1IJDB 2M3BA 1IFNA 3P32A 1GL2B 5CCGD 1NOHA 2WPRA 1M7LA 4B86A 1URQC 2XU6A 2YO3A 2KOGA 1JY2P 3HD7C 1GZLA 1M1JA 2IFMA 2PAJA 1PFIA 2J64A 4M3LA 5APTA 3MD0A 2N1TC 3M9HA 3M9BA 4WY4B 1JUNA 3H32C 1T2KC 4ZKUA 5KLVK 5CMZA 3KQGA 3N7NA 2HODB 1X79B 1X9VA 2XNXC 4HH2A 3LIEA 3SWFA 2YMYA 3V4WA 3RK2B 3VMZA 2HYNA 3GHGB 2C9NY 2JJLA 3M0AA 3E1IB 1CI6B 1XTCC 3R2PA 1JCDA 5AW2B 5AW4B 2Q9IA 1VDFA 1JTHA 1JMMA 3P8CE 5APQA 1MUUA 1ZR2A 2QM8A 1W2EA 2Z5HA 2J61B 1L4AD 1G1IA 4O9BA 1HUCA 3VMYA 3HE4B 3E1IA 1MV8A 3OA7A 2A45I 2CPSA 3V4QA 1JY2N 1VPCA 2FFDB 2JHMF 2CPBA 2J5ZA 2J61A 3U59A 1A02J 4OH8B 5AVYB 2H7HA 3RK2C 1LTSC 3GHGC 2WSEH 3VMXA 3OJAB 1NAFA 2J60A 1N7SB 2P67A 1RF0B 2J3FA 1GW4A 3L36A 3CLQA 1GL2D 2Q5UA 4C7NB 5CCHC 1LTJC 1RE3C 1RF1A 1N7SA 1RF0A 2Z5IA 2JHKF 2NPSA 1Z3SA 1LT9A 3CI9A 1LTGC 1MZ9A 1NKNA 3RK3B 3T97A 2QM7A 4C7NA 4N6JA 1CSBA 4LGDE 1AFOA 5AW9B 1FZCA 5CJ0A 1Z56A 3U1AA 3A7OA 3BRTB 1SQBK 1G1JA 3P7KA 4WY4D 1JY3P 2J0GA 3B5NA 3O8ZA 2OARA 3I5CA 1DEBA 2OYIC 1YTZI 4EOTA 5KJ7C 1FZEA 2M8RA 4ZKPA 2WSCH 3HUSC 1FZGC 3V2RA 2W6BA 3L37A 1N86C 3M0DA 1J1EB 5CCGC 3U1CA 2IFNA 3TNUA 2LKMA 4W7ZA 1GU4A 5APYA 1EQ7A 1JOCA 2FXMA 2Z4EC 1IFIA 3KDPB 2HPCB 1FZFB 1LTAC 2C9LY 1QL2A 1OXZA 2WNPF 3H6PA 2E42A 2OYHC 1FJPA 4HYTB 2J3OA 5AW7B 1N73B 1HJBA 3MGNA 2YO2A 5APVA 2VRSA 4R9JA 2J3UA 1YYCA 1FDMA 1LTIC 1LWUA 1NHLA 1N7SD 1NWQA 4GIFA 2KSJA 3NXSA 1ZLLA 4Y99C 1L4AC 1N73C 3RK3D 2J0YA 1M1JB 1SVFA 5BVZA 3BASA 2PP6A 3V2NA 1NU1K 1FIBA 2WSFH 3A3YB 4IFDK 4C46A 5AW0B 2HLOC 2ZXEB 1URQA 1SFCA 2IPPA 3BRVB 2R5BA 2W27A 1ZV8A 1LTBC 1T8ZA 2N1TA 2H43A 2H8PD 1RE4A 1GL2C 3VOPA 2R5DA 1FZBB 3BVHA 1N7LA 2Q9IB 1JTHB 2O01H 2R3CA 2XNXA 2FKWB 2FYUK 1S9KD 1FZBA 2IX7C 2MJZA 5AW1B 4N78D 4LC1A 5BU8B 2KB7P 4WY4C 1JNMA 3M91A 1H89A 1HH0A 3KPEA 1NTZK 1G2CB 2HODC 1SLQA 3WMM0 4KHXA 3UIAA 1CZQA 4AYCA 1G2CA 2FYZA 2YKOA 3TSIA 3E1IC 1FIDA 1IFJA 1RF1B 5AVQB 1J1DB 2NPSB 5APSA 1LT9B 2J3GA 3M06A 1NH4A 3V2PA 2GY7A 4ZFGA 1FZCB 4R9TA 1GTWA 2FFDC 1SQQK 3LW5H 1SFCD 1HWTC 4LLHA 1HGZA 2A45G 3B5NB 2D39A 5AW8B 1N2DC 3EQ2A 1FZEB 2JHLF 4EPUA 1N7SC 1RF0C 4WBAA 1H88A 1J1DC 4JYOX 5AVTB 2J59M 1FZAB 3HRNA 1KQLA 3TNUB 3IR9A 1ZN5A 5AVXB 1T3UA 1JY3O 1RY3A 3RK3C 3VP9A 1H8AA 3M9QA 1FZAA 5KJ7A 1JC9A 2GUSA 4JYBA 4AQRD 1FZGA 1FOSE 1MFZA 2WWWA 5APWA 1FZEC 4IFMA 5APXA 2WTYA 4M7HA 4GKGA 2Q7CA 2P7JA 2XV5A 1LWUB 4XE5B 5AVRB 2J3FD 3N4XA 2OYHA 1SQVK 1KILB 1J1EC 1IO4A 2GM4A 3RL0B 1AQ5A 1IK9A 2NPSD 1KILA 3SWYA 3NTNA 4EIJA 2HPCC 1FZFC 1NO4A 2KP8A 1YTZT 4JYCA 1FZDA 1SQXK 2HFED 4DOJA 5CJ4A 5KTBA 1URQB 3P8CD 1SFCB 3B5ND 1GU5A 3IFMA 3HD7B 1FOSF 1CW5A 4NYTA 3TYYA 3L4FA 4I6MC 3BATA 2FIBA 2N1TB 2H43B 5AW3B 1RE4B 3HD7A 2P1JA 1JY2O 2HLOA 2R32A 3BVHB 2YNYA 1NTMK 3HTKB 1NTKK 1FU1A 3VP8A 2XNXB 3B8EB 3H32A 1M1JC 1WT6A 2KYVA 2YKPA 3HTKA 1KZUB 3CL3D 3VN0A 1JCCA 1SFCC 1IC2A 1GL2A 4I2LC 3V2QA 1A02F 3P8MC 4N3YB 4W80A 2J2PA 4RESB 2H43C 2Q3IA 4WB4A 1RE4C 2BASA 4W7YA 3BVHC 1IFMA 1IFDA 1KFNA 1GD2E 2JEEA 5BU5A 1DH3A 1KILD 4WY4A 2WPQA 3L35A 1FZBC 1GK4A 3RL0D 2Q9IC 2I1JA 4JF7A 2HODA 2WT7B 2XZRA 3HE5B 3A5TA 2WPSA 3GHGA 2WT7A 3HE5A 3VYIA 4GT1A 1JO5A 2I1KA 3C9IA 1KFMA 1LTJB 1RE3B 1CI6A 2J58A 5CHXA 2P2UA 1URQD 3HD7D 4AUWA 5CCHA 3HE4A 1LTJA 1RE3A 1J2JB 2FFDA 2N1TD 1L0NK 3VTPC 2O1KA 3NMDA 5APUA 4DZOA 1T2KD 3OAKA 3A2AA 3MTUE 1RF1C 1ZR4A 2NPSC 5AVUB 1LT9C 4I1LA 1DX7A 2JHHC 1XTGB 1GK6A 2OYIB 1S9KE 2HG5D 2XKMA 1HBWA 4N78E 3HUSB 5AVVB 1FZCC 2GUVA 1FZGB 3PP5A 1N86B 1L0LK 2OYIA 1QL1A 5AVWB 5AW5B 2KLVA 2N9BA 1SQPK 3HUSA 2POHA 3B5NC 4M7FA 2Z4EB 1N86A 5CCGA 3MUDA 1Z3UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FZB B;  3BVH A;  3GHG C;  2Q9I B;  2OYH B;  2J60 A;  2Z4E A;  2XNX A;  1RF0 B;  2J3F A;  1FZA C;  1FZB A;  4NYT A;  2J0H A;  4JZC A;  1LTJ C;  1RE3 C;  1RF1 A;  1RF0 A;  2FIB A;  2JHK F;  1Z3S A;  1LT9 A;  2H43 B;  1RE4 B;  1JY2 O;  2HLO A;  2HOD C;  3BVH B;  1FZC A;  3FIB A;  2XNX B;  3H32 A;  1M1J C;  1FZF A;  1JY3 P;  2HPC A;  1FIC A;  2J0G A;  3E1I C;  1LWU C;  1FID A;  1RF1 B;  2OYI C;  2JHI F;  1LT9 B;  2J3G A;  1FZE A;  1N73 A;  1JY3 N;  3HUS C;  2GY7 A;  2J2P A;  1FZG C;  2HLO B;  4ZFG A;  2H43 C;  1RE4 C;  1N86 C;  1FZC B;  4R9T A;  2A45 H;  2FFD C;  3BVH C;  3H32 B;  2Z4E C;  1FZF B;  2HPC B;  2J1G A;  2A45 G;  2D39 A;  1FZB C;  2Q9I C;  2WNP F;  2HOD A;  2OYH C;  1FZE B;  2J3O A;  2JHL F;  1N73 B;  4EPU A;  1RF0 C;  4JYO X;  1JY2 P;  1M1J A;  1FZA B;  4R9J A;  3GHG A;  2J64 A;  2J3U A;  1T3U A;  1JY3 O;  1LTJ B;  1LWU A;  1RE3 B;  3H32 C;  1FZA A;  1JC9 A;  1FZG A;  2HOD B;  1LTJ A;  1RE3 A;  2XNX C;  2FFD A;  1FZE C;  1N73 C;  2J0Y A;  1M1J B;  4M7H A;  3GHG B;  1RF1 C;  1FIB A;  3E1I B;  1LT9 C;  2JHH C;  1LWU B;  2Q9I A;  2OYI B;  2J3F D;  2OYH A;  2HLO C;  1W2E A;  2J61 B;  1FZC C;  3HUS B;  1FZG B;  3E1I A;  2A45 I;  1N86 B;  2OYI A;  1JY2 N;  2FFD B;  2JHM F;  2J5Z A;  1FZF C;  2J61 A;  2HPC C;  3HUS A;  2H43 A;  4M7F A;  2Z4E B;  1RE4 A;  1N86 A;  1Z3U A;  1FZD A; 
#chains in the Genus database with same CATH topology
 1VQP P;  1SQV J;  4PV1 D;  1SP4 A;  2P10 A;  3PJS K;  1SQP D;  2OYH B;  3LID A;  3G3Z A;  1KV4 A;  2L5G B;  3CMA P;  2CK3 H;  2ZJS E;  2O1J A;  3RK2 D;  4JZC A;  3MIW A;  1OFC X;  1EXI A;  5AW6 B;  4H13 B;  1L4A B;  2HPC A;  1FIC A;  3KYQ A;  1LWU C;  1NKZ B;  1FJK A;  1FBM A;  2WZ7 A;  1L4A A;  4KJM A;  3W67 A;  2HLO B;  3RL0 C;  4IFF A;  1HTL C;  1M57 D;  1OIP A;  1JM0 A;  3L73 J;  2J1G A;  5KLI B;  5C39 A;  1DD3 A;  2QJP C;  1NOH A;  2WPR A;  4B86 A;  2QJY C;  5KKZ C;  2XU6 A;  2YO3 A;  5KLV J;  2KOG A;  1KQG B;  1GZL A;  1M1J A;  2IFM A;  4M3L A;  4D6T E;  5APT A;  3MD0 A;  2W83 C;  4PJ0 E;  5CMZ A;  1EZV E;  3LIE A;  3GF3 A;  2WSE J;  2WQY C;  2C9N Y;  2Q9I A;  3AE4 C;  1BDD A;  2B87 B;  4O9B A;  4PV1 C;  2A45 I;  1JY2 N;  2QVA A;  3U59 A;  2B87 A;  4D6T G;  5KAI H;  2R44 A;  3CX5 H;  3RK2 C;  1PGO A;  5DJT B;  1LNQ A;  2J60 A;  4HKZ H;  2P67 A;  1EZV G;  2IBZ D;  1AV1 A;  2D2C D;  1NTK E;  3L36 A;  1GL2 D;  2Q5U A;  2WSC J;  1RF1 A;  3D70 A;  1OW6 A;  2JHK F;  1NKN A;  4N6J A;  1PPJ E;  1W5C E;  3U1A A;  2Q6Q A;  1DEB A;  1SQB D;  2RKL A;  3A0B E;  3H1L E;  2W6B A;  1N86 C;  3U1C A;  1RQV A;  2IFN A;  1NTK G;  3CWB J;  1EQ7 A;  1KB9 E;  1IFI A;  5B5E H;  1FZF B;  2C9L Y;  1OXZ A;  2WNP F;  1FJP A;  4R4L A;  1BSH A;  3AE2 C;  3FWL A;  1Y47 A;  4R9J A;  3B71 A;  2J3U A;  1LWU A;  1N7S D;  2KSJ A;  3NXS A;  4L74 A;  1SVF A;  3H1H E;  3L75 G;  5BVZ A;  1RHZ B;  2JO1 A;  3A3Y B;  4IFD K;  1BDC A;  2FYN C;  3ITK A;  1P84 D;  1IFP A;  2AEJ A;  4XFJ A;  1NU1 D;  3BRV B;  1LTB C;  3Q5R A;  2D2C C;  2ZYD A;  2ZVO B;  1NGM B;  1GL2 C;  2RN0 A;  2O01 H;  2LXC B;  1SS1 A;  1PV3 A;  4K3A A;  5AW1 B;  4N78 D;  3H1H G;  2PGD A;  1HH0 A;  3LW5 J;  4KHX A;  1QLE D;  3AE5 C;  2YKO A;  1FID A;  1NTM E;  3F89 A;  2V4H A;  3M06 A;  1NH4 A;  4ZFG A;  1H0T B;  1FZC B;  1P84 I;  1SQQ K;  2FFD C;  1SFC D;  1NAY A;  4LLH A;  1HGZ A;  3TGU E;  1H0T A;  3AE1 C;  3B5N B;  2KI7 B;  1N2D C;  1KYO I;  2JHL F;  1N7S C;  1RF0 C;  2OTL P;  3CCL P;  1OVV A;  1S3J A;  3HRN A;  1KQL A;  3IR9 A;  1RY3 A;  4D6T J;  3AEC C;  3FGA D;  1K05 A;  4JYB A;  2K9J B;  5KAI E;  3CX5 E;  4K35 A;  5APW A;  2L91 A;  2Q3E A;  2Q7C A;  2HR3 A;  3TGU G;  1ZME C;  1J1E C;  1IO4 A;  4HJG H;  1AQ5 A;  4EIJ A;  1SQV D;  1HJ0 A;  3L70 E;  2E74 D;  4OGQ B;  2KIK A;  2MKV A;  2ZYG A;  1M1K Q;  1L0L E;  2HFE D;  4JQ0 D;  1FDI A;  1URQ B;  3D6Y A;  1GU5 A;  2LXB A;  3HD7 B;  1SQX D;  1NTK J;  1YIJ P;  1VQM P;  2N1T B;  3HD7 A;  1USE A;  4DT0 A;  1JY2 O;  3BVH B;  5B5E E;  1NTM K;  3HTK B;  3B8E B;  3H32 A;  2K88 A;  2YKP A;  3HTK A;  2FBW C;  1YIT P;  1SFC C;  1IC2 A;  1VL2 A;  3L70 G;  1GL2 A;  4I2L C;  3P8M C;  1VF5 D;  1L0L G;  2H43 C;  3D6Z A;  4WB4 A;  1RE4 C;  3H1L J;  3QH9 A;  1FE6 A;  1KFN A;  1QVG O;  2WPQ A;  3WUU A;  4Z1M H;  3HE5 B;  3RK3 E;  3A5T A;  1UIX A;  3H1J E;  2PFX A;  3HE5 A;  2I1K A;  1CI6 A;  2J58 A;  1FDO A;  2P2U A;  3GG2 A;  1BCC D;  4NPE A;  1J2J B;  2FFD A;  3L71 D;  1VQ7 P;  1L0N K;  2Y9Z A;  3VTP C;  3NMD A;  2QRX A;  5KLV E;  2KNC A;  3H1H J;  2WSS H;  1XTG B;  2E74 C;  2IYP A;  3H1J G;  1L0L K;  3KXD A;  5AVW B;  2B88 A;  4IL6 H;  4GDO A;  2KLV A;  2N9B A;  1RQU A;  1Q90 D;  2QJK C;  2Z4E B;  5CCG A;  1Z3U A;  1VQ4 P;  1NTZ E;  2Z4E A;  3O6Q A;  4NPD A;  3JCU H;  2KSE A;  2J0H A;  4DJG A;  1HVV A;  2XDJ A;  4UB6 H;  1GDT A;  4EDF A;  3NFQ A;  3V5B A;  2FY8 A;  3EFG A;  1VF5 C;  4Y99 B;  2E43 A;  3CME P;  2C0W A;  2C0X A;  1QEX A;  1LGH B;  3L74 E;  1N73 A;  1JY3 N;  1E5W A;  1NTZ G;  2ZYA A;  2H89 C;  2A45 H;  1OVU A;  2PRR A;  2A06 E;  3V6I A;  2WVR A;  3AED C;  5KJ7 D;  2OTJ P;  5AVZ B;  1X22 A;  3H1K D;  1IFN A;  3TGU J;  5GTH H;  2YMK A;  3TF5 A;  2AXC A;  1JY2 P;  1K8A Q;  3CXH D;  3AEB C;  3OW2 O;  3M9H A;  4WY4 B;  3Q2Y A;  2JWA A;  4ZKU A;  2NRG A;  5KLV K;  3KQG A;  3L74 G;  3N7N A;  1X79 B;  3K5B A;  4HH2 A;  4RO0 A;  3VMZ A;  2A06 G;  4YXD C;  2HYN A;  3GHG B;  3M0A A;  3E1I B;  1XTC C;  5AW4 B;  3P8C E;  4OWF A;  1OVR A;  2QM8 A;  3E1I A;  3V4Q A;  1YI2 P;  2CPB A;  3L72 E;  3L70 J;  3VMX A;  1L0L J;  1GW4 A;  1OMI A;  2K3R A;  2B89 A;  1LTG C;  1PZQ A;  4H44 D;  3RK3 B;  2QM7 A;  1CSB A;  1AFO A;  5AW9 B;  5CJ0 A;  1QVF O;  3P7K A;  1U7J A;  2J0G A;  4PD4 H;  3L72 G;  2OAR A;  4BRY B;  2BCC D;  2OYI C;  5KJ7 C;  1FZE A;  2M8R A;  3HUS C;  1BGY D;  2M3E A;  2YIU B;  2LR2 A;  3L37 A;  4BRY A;  3MUD C;  2ZXX A;  1ZRT D;  3TNU A;  2LKM A;  1GU4 A;  5APY A;  2FXM A;  2HPC B;  1LTA C;  1QL2 A;  1VQO P;  2J3O A;  5AW7 B;  1HJB A;  3MGN A;  2YO2 A;  3H1J J;  3RGU A;  5TJH A;  2WPV B;  1FDM A;  2JDI H;  1NVO A;  4IL6 E;  2E75 B;  3AEE C;  3PRJ A;  2J0Y A;  1M1J B;  1DD4 A;  3BAS A;  2O01 J;  2PP6 A;  3JCU E;  1LJ2 A;  4L76 A;  4UB6 E;  3FX0 A;  2ZXE B;  3BCC D;  2JWD A;  2NZ2 A;  2KLU A;  1ZV8 A;  4WWI A;  4A7P A;  2H8P D;  3VOP A;  1FZB B;  1N7L A;  1BE3 G;  2Q9I B;  2R3C A;  1FC2 C;  4H44 C;  2FKW B;  1NTZ J;  1FZB A;  2IX7 C;  2QA4 P;  4LC1 A;  1SQP G;  1H89 A;  5B66 H;  1PPJ D;  2HOD C;  1SLQ A;  3UIA A;  5GTH E;  4ZMD A;  1RF1 B;  3R4Y A;  5APS A;  5EFW B;  3H1L D;  4YTP C;  3V2P A;  3H1I D;  3L74 J;  1GTW A;  4H0L D;  1KB9 D;  1HWT C;  3S4R A;  2A45 G;  1SQQ D;  5AW8 B;  2GA1 A;  4EPU A;  4WBA A;  1H88 A;  3I56 P;  1S5L H;  5AVT B;  4RKU J;  1JY3 O;  5DJU B;  1K73 Q;  3M9Q A;  5KJ7 A;  2K37 A;  4AQR D;  1MFZ A;  3L75 E;  4NPF X;  3H1H D;  4KT0 J;  3EWK A;  3GF7 A;  1VQK P;  2XV5 A;  1YBK A;  1LWU B;  2IBZ E;  4XE5 B;  3JC2 2;  1LP1 A;  2J3F D;  3GMA A;  1BSN A;  3RL0 B;  2NPS D;  3NTN A;  1KB9 I;  2KP8 A;  1PGJ A;  3L72 J;  4PD4 E;  3CC4 P;  1VQ6 P;  1EDL A;  1YJN P;  1FOS F;  1SQB E;  3BAT A;  2FIB A;  1AQT A;  2IBZ G;  1K04 A;  2R32 A;  2QEX P;  1NTK K;  3VP8 A;  1KYO D;  2KYV A;  4H0L C;  4HB1 A;  1NTM D;  1OX3 A;  1JCC A;  1A02 F;  3Q5S A;  1ZP0 C;  4RES B;  4U3F E;  1PP9 E;  3BVH C;  2FYU D;  1SQB G;  1GD2 E;  1KIL D;  3G6E P;  3AE9 C;  4JF7 A;  2HOD A;  1YJW P;  2XZR A;  3KHU A;  2E5T A;  2AXT H;  1JO5 A;  1KFM A;  1HF9 A;  3CX5 D;  1USD A;  3Q5P A;  3HE4 A;  4U3F G;  1PP9 G;  1T2K D;  3OAK A;  1ZR4 A;  2NPS C;  5AVU B;  1LT9 C;  1DX7 A;  1GK6 A;  1L0N D;  1EDJ A;  2XKM A;  4YXW H;  4N78 E;  5AVV B;  2IZ1 A;  2JP3 A;  5B66 E;  1YQ3 C;  1N86 B;  4GOD A;  2POH A;  1N86 A;  1NU1 G;  1KN7 A;  2R3S A;  2IZ0 A;  1GMJ A;  3M0D C;  2WIT A;  1FZA C;  3W68 A;  3TK1 A;  1JB0 J;  2KS1 B;  1HGV A;  1T3J A;  2KS1 A;  3CX5 I;  5CCH D;  3FIB A;  1MKM A;  2YXQ B;  4CPG A;  3CCR P;  1QX8 A;  2ZT9 D;  4R4M A;  1YHQ P;  5CBO A;  1S5L E;  1S2E A;  1KIL C;  4TT3 H;  1X8Y A;  3E7K A;  2Q1K A;  3H32 B;  3PHL A;  3II6 A;  2D2C B;  3P32 A;  1GL2 B;  1M7L A;  2PAJ A;  1PFI A;  1OW8 A;  2J64 A;  4L73 A;  2K9Y A;  3CXH H;  1JUN A;  4I7Z C;  3L73 D;  1T2K C;  2KZJ A;  4BWN A;  2IYO A;  2XNX C;  3L75 J;  1YQ4 C;  3SWF A;  2YMY A;  5KLV D;  3Q1M A;  1CI6 B;  2Y9Y A;  3R2P A;  1JCD A;  1VDF A;  1JTH A;  5APQ A;  1ZR2 A;  1W2E A;  4H13 D;  1L4A D;  1SQX E;  1JEK A;  3VMY A;  2M0B A;  1MV8 A;  3OA7 A;  2J5U A;  2CPS A;  2FFD B;  2J5Z A;  3PTZ A;  4OH8 B;  3FWN A;  4IL6 X;  2KNC B;  1PGQ A;  1IK7 A;  1LTS C;  3GHG C;  3OJA B;  2E76 B;  3CCS P;  1N7S B;  1RF0 B;  2J3F A;  3AEF C;  4L75 A;  3CLQ A;  1VQN P;  4C7N B;  3I55 P;  5CCH C;  1LTJ C;  1RE3 C;  1N7S A;  1RF0 A;  1SQB J;  3C8V A;  2NPS A;  1LT9 A;  2ZT9 C;  1MZ9 A;  3T97 A;  2KK7 A;  4C7N A;  1Q7Y Q;  4LGD E;  1SQX G;  1Z56 A;  3O6Q B;  1G1J A;  3S9O A;  3O8Z A;  2ITA A;  3I5C A;  4U7J A;  1YTZ I;  4EOT A;  2AXT E;  4ZKP A;  2Y0E A;  2O01 N;  1FZG C;  4YPC A;  2P58 A;  1VQ5 P;  3M0D A;  1J1E B;  2RH0 A;  4U3F J;  4W7Z A;  2K1A A;  1PP9 J;  3PH0 A;  1BCC E;  3L71 E;  2E42 A;  2OYH C;  2AEM A;  1KOR A;  1N73 B;  1Y9B A;  2G8Y A;  2YIU C;  1YYC A;  3CWB D;  1NHL A;  1NWQ A;  2G3A A;  4OVN F;  1ZLL A;  4H13 C;  1L4A C;  3SWK A;  3V2N A;  1FIB A;  2WSF H;  1BCC G;  4C46 A;  3L71 G;  2HLO C;  1SFC A;  2IPP A;  1KD1 Q;  4Y28 J;  3CCE P;  4ZNC A;  5KLI C;  2H43 A;  1KTM A;  3SFE C;  1RE4 A;  1T6A A;  2FXP A;  1U57 A;  1Q86 Q;  2XNX A;  2V7Q H;  1S9K D;  2MJZ A;  5TIS H;  2OTK E;  3MP7 B;  3B4S A;  1JNM A;  3KPE A;  1NTZ K;  3WMM 0;  3H1K E;  2JR8 A;  2UWJ E;  2FYZ A;  3TSI A;  2W6J H;  1J1D B;  2XND H;  2E74 B;  3CXH E;  1EC5 A;  2JKV A;  4R9T A;  2E5Y A;  1YJ9 P;  1Q82 Q;  3G9R A;  2QJK B;  1DIP A;  2D39 A;  1FZE B;  2J59 M;  3H1K G;  3TNU B;  1T3U A;  3VP9 A;  1H8A A;  3CCU P;  1FZG A;  1FOS E;  2QE7 H;  2WWW A;  3E1R A;  1QGK B;  2ZAE B;  4IFM A;  1VF5 B;  5APX A;  4M7H A;  4GKG A;  1KQF B;  3IN6 A;  3USS A;  5AVR B;  5GTI H;  3N4X A;  4D6T D;  2OYH A;  1SQX J;  1IK9 A;  1BE3 E;  4GOE A;  3SWY A;  1EZV D;  1FZF C;  1M90 Q;  1YTZ T;  1EDK A;  5KAF H;  5H2F H;  4DOJ A;  1SQP E;  3B5N D;  4NYT A;  2BCC E;  3IFM A;  1CW5 A;  3AEA C;  1BGY E;  5AW3 B;  1P84 H;  1ZRT E;  2HLO A;  1S72 P;  3ABV C;  3MHV A;  2QSI A;  3CL3 D;  1KZU B;  1KYO H;  3VN0 A;  1NTK D;  2H88 C;  3V2Q A;  2W90 A;  3QWO C;  4W80 A;  2Q3I A;  2Y0C A;  4W7Y A;  1IFM A;  2BEZ F;  2BCC G;  1IFD A;  3D71 A;  4QMA A;  1DH3 A;  1BGY G;  3L35 A;  1EZV I;  1GK4 A;  2ZVN B;  1BCC J;  3F5H A;  4ASV A;  1MFT A;  3L71 J;  4OGQ D;  1R5L A;  2KXP B;  1S5L X;  3BCC E;  3GLM A;  1URQ D;  3L75 D;  1WMK A;  3HD7 D;  1OW7 A;  3G71 P;  2N1T D;  3S1K A;  2O1K A;  5APU A;  3MTU E;  2WMM A;  2JHH C;  2KZI A;  2OYI B;  2HG5 D;  5TIS E;  2AEF A;  1HBW A;  1FZC C;  3HUS B;  2IDB A;  1VQ9 P;  3PP5 A;  2OYI A;  5AW5 B;  1SQP K;  3HUS A;  3B5N C;  4GOF A;  3CCJ P;  4PD4 D;  3BCC G;  1L2P A;  3MUD A;  4C7R A;  1LP1 B;  3AEG C;  1LTT C;  1OWA A;  1NYH A;  3WUV A;  1M56 D;  2QG4 A;  1WRG A;  3VMA A;  3H1I E;  2YKQ A;  2FXO A;  2OGU A;  1AVY A;  3SFD C;  1FAV A;  4XA4 A;  3PLN A;  3CC2 P;  2W6A A;  1SQQ E;  1KQS O;  1PPJ G;  1Q2N A;  1FZF A;  3RBZ A;  3H1K J;  2QJP B;  2QIW A;  2QJY B;  5KKZ B;  2JHI F;  2IBZ I;  1GW3 A;  4U3F D;  3CCM P;  1PP9 D;  2E76 D;  5AVS B;  1S4X A;  3H1L G;  3KZI H;  2ZFC A;  4OGQ C;  1IJD B;  3H1I G;  2M3B A;  4UB8 H;  1E79 H;  3CPW O;  5CCG D;  4PD4 I;  1PIX A;  1URQ C;  4H44 B;  5GTI E;  3HD7 C;  4TLF A;  4EI2 A;  1SQQ G;  1KMI Z;  2O3J A;  2N1T C;  3M9B A;  3H32 C;  4PV1 B;  3A0H H;  3TGU D;  2HOD B;  1X9V A;  2B9B A;  5M1B A;  3RBX A;  5KAF E;  3V4W A;  3RK2 B;  5H2F E;  1N8R Q;  2JJL A;  1OZH A;  5AW2 B;  1D7M A;  3RL0 g;  1JMM A;  1MUU A;  2Z5H A;  2J61 B;  1G1I A;  4MN4 C;  1HUC A;  3HE4 B;  1P84 E;  3JSV C;  3CCV P;  1VPC A;  1NU1 E;  2JHM F;  3SSU A;  2J61 A;  1A02 J;  1BE3 J;  5AVY B;  2H7H A;  2OQQ A;  1KYO E;  2WSE H;  1NAF A;  1UII A;  2DW3 A;  1KC8 Q;  1SQP J;  2BCC J;  3WU2 H;  1Y8A A;  1PGP A;  2Z5I A;  1Z3S A;  3CI9 A;  2N9Y B;  1BGY J;  2FYU E;  3L70 D;  1FZC A;  1KIL E;  3A7O A;  3BRT B;  1SQB K;  4WY4 D;  1L0L D;  2E76 C;  3ZDM A;  1JY3 P;  3B5N A;  2WSC H;  4JBZ A;  3V2R A;  5CCG C;  4IOI H;  1NTM G;  1JOC A;  2Z4E C;  3KDP B;  1R5S A;  3H6P A;  2K9J A;  1X0T A;  1S1C X;  4HYT B;  2FYU G;  1U7M A;  3TDK A;  2WSF J;  5APV A;  2VRS A;  2I8D A;  2FYN B;  1L0N E;  1LTI C;  2W8Z A;  3BCC J;  4GIF A;  4Y99 C;  1N73 C;  4EYY Q;  3RK3 D;  3H1J D;  4H0L B;  1NU1 K;  2V7Q J;  3MZW B;  5AW0 B;  2KUB A;  3FXE A;  1URQ A;  3CD6 P;  2R5B A;  2W27 A;  1JMB A;  1T8Z A;  1L0N G;  1AVO A;  2N1T A;  4DCK A;  1SQV E;  2R5D A;  3BVH A;  1JTH B;  1Q81 Q;  3G4S P;  5CBN A;  2FYU K;  5BU8 B;  2KB7 P;  4WY4 C;  3M91 A;  3H1I J;  5E79 H;  3KZI E;  1G2C B;  1TU3 F;  5K5G B;  4UB8 E;  1CZQ A;  2SPZ A;  4AYC A;  3EFF K;  1G2C A;  1NTZ D;  2E75 D;  1SQQ J;  3AE8 C;  3E1I C;  1IFJ A;  1SQV G;  5AVQ B;  1M8O B;  2NPS B;  1LT1 A;  1LT9 B;  2J3G A;  3T97 B;  2GY7 A;  3LW5 H;  1DEE G;  3A0H E;  3IAO A;  3L73 E;  3WUT A;  3AE6 C;  3EQ2 A;  4ASW A;  1J1D C;  4JYO X;  3L74 D;  1FZA B;  1ZN5 A;  5AVX B;  3Q3D A;  3RK3 C;  2RMZ A;  3GW6 A;  1FZA A;  2A06 D;  1W2B O;  1JC9 A;  2GUS A;  4BXL A;  4WVZ A;  2M5A B;  1FZE C;  2WTY A;  3L73 G;  1EDI A;  2P7J A;  2M5A A;  3WU2 E;  1SQV K;  1KIL B;  2Y0D A;  5KLV G;  2GM4 A;  1R8E A;  1KIL A;  4PJ0 H;  2HPC C;  1PL5 A;  1NO4 A;  1NU1 J;  1AJY A;  4JYC A;  1K9M Q;  2BEQ D;  1FZD A;  2OYO A;  1SQX K;  3C1L A;  1IZN B;  5CJ4 A;  5KTB A;  3P8C D;  1SFC B;  1NTM J;  1ZW0 A;  3TYY A;  3L4F A;  4I6M C;  2H43 B;  1AA0 A;  2E75 C;  1RE4 B;  4I7Z B;  2P1J A;  3L72 D;  2YNY A;  2FYU J;  1FU1 A;  2XNX B;  1M1J C;  1WT6 A;  4N3Y B;  3IF4 A;  2J2P A;  2BAS A;  3AE3 C;  3CWB E;  4JPZ B;  2JEE A;  5BU5 A;  1ZXG A;  4WY4 A;  3CCQ P;  1FZB C;  4RJT A;  3RL0 D;  2Q9I C;  2I1J A;  2WT7 B;  2WPS A;  3GHG A;  2WT7 A;  3VYI A;  4GT1 A;  3A0B H;  3C9I A;  3H25 A;  1LTJ B;  1RE3 B;  1L0N J;  5CHX A;  2ZT9 B;  3AE7 C;  4AUW A;  5CCH A;  1LTJ A;  1RE3 A;  1KB9 H;  1VQ8 P;  3CC7 P;  3CWB G;  1EXJ A;  1RH5 B;  4DZO A;  1NJI Q;  3A2A A;  1RF1 C;  4I1L A;  1S9K E;  1VQL P;  3CXH I;  2GUV A;  1FZG B;  1BE3 D;  5E79 E;  2YXR B;  1QL1 A;  1ZOY C;  3FXD A;  5L8R J;  1FS0 E;  4M7F A; 
#chains in the Genus database with same CATH homology
 4C7R A;  1SP4 A;  2OYH B;  1LTT C;  1OWA A;  3LID A;  2Z4E A;  3G3Z A;  3M0D C;  2WIT A;  1FZA C;  2L5G B;  2O1J A;  3RK2 D;  2J0H A;  4JZC A;  1HVV A;  1WRG A;  2XDJ A;  3TK1 A;  3MIW A;  1HGV A;  2YKQ A;  1GDT A;  1T3J A;  3NFQ A;  3V5B A;  1FAV A;  4XA4 A;  5CCH D;  3EFG A;  5AW6 B;  3FIB A;  2W6A A;  4Y99 B;  2E43 A;  1L4A B;  1FZF A;  2HPC A;  2C0W A;  1FIC A;  2C0X A;  3KYQ A;  1LGH B;  1LWU C;  1NKZ B;  2JHI F;  1FJK A;  1FBM A;  1GW3 A;  1KIL C;  1L4A A;  2WZ7 A;  1N73 A;  1JY3 N;  1E5W A;  2HLO B;  3RL0 C;  1X8Y A;  4IFF A;  1HTL C;  2A45 H;  5AVS B;  3H32 B;  5KJ7 D;  3II6 A;  2ZFC A;  2J1G A;  5AVZ B;  1IJD B;  2M3B A;  1IFN A;  3P32 A;  1GL2 B;  5CCG D;  1NOH A;  2WPR A;  1M7L A;  4B86 A;  1URQ C;  2XU6 A;  2YO3 A;  2KOG A;  1JY2 P;  3HD7 C;  1GZL A;  1M1J A;  2IFM A;  2PAJ A;  1PFI A;  2J64 A;  4M3L A;  5APT A;  3MD0 A;  2N1T C;  3M9H A;  3M9B A;  4WY4 B;  1JUN A;  3H32 C;  1T2K C;  4ZKU A;  5KLV K;  5CMZ A;  3KQG A;  3N7N A;  2HOD B;  1X79 B;  1X9V A;  2XNX C;  4HH2 A;  3LIE A;  3SWF A;  2YMY A;  3V4W A;  3RK2 B;  3VMZ A;  2HYN A;  3GHG B;  2C9N Y;  2JJL A;  3M0A A;  3E1I B;  1CI6 B;  1XTC C;  3R2P A;  1JCD A;  5AW2 B;  5AW4 B;  2Q9I A;  1VDF A;  1JTH A;  1JMM A;  3P8C E;  5APQ A;  1MUU A;  1ZR2 A;  2QM8 A;  1W2E A;  2Z5H A;  2J61 B;  1L4A D;  1G1I A;  4O9B A;  1HUC A;  3VMY A;  3HE4 B;  3E1I A;  1MV8 A;  3OA7 A;  2A45 I;  2CPS A;  3V4Q A;  1JY2 N;  1VPC A;  2FFD B;  2JHM F;  2CPB A;  2J5Z A;  2J61 A;  3U59 A;  1A02 J;  4OH8 B;  5AVY B;  2H7H A;  3RK2 C;  1LTS C;  3GHG C;  2WSE H;  3VMX A;  3OJA B;  1NAF A;  2J60 A;  1N7S B;  2P67 A;  1RF0 B;  2J3F A;  1GW4 A;  3L36 A;  3CLQ A;  1GL2 D;  2Q5U A;  4C7N B;  5CCH C;  1LTJ C;  1RE3 C;  1RF1 A;  1N7S A;  1RF0 A;  2Z5I A;  2JHK F;  2NPS A;  1Z3S A;  1LT9 A;  3CI9 A;  1LTG C;  1MZ9 A;  1NKN A;  3RK3 B;  3T97 A;  2QM7 A;  4C7N A;  4N6J A;  1CSB A;  4LGD E;  1AFO A;  5AW9 B;  1FZC A;  5CJ0 A;  1Z56 A;  3U1A A;  3A7O A;  3BRT B;  1SQB K;  1G1J A;  3P7K A;  4WY4 D;  1JY3 P;  2J0G A;  3B5N A;  3O8Z A;  2OAR A;  3I5C A;  1DEB A;  2OYI C;  1YTZ I;  4EOT A;  5KJ7 C;  1FZE A;  2M8R A;  4ZKP A;  2WSC H;  3HUS C;  1FZG C;  3V2R A;  2W6B A;  3L37 A;  1N86 C;  3M0D A;  1J1E B;  5CCG C;  3U1C A;  2IFN A;  3TNU A;  2LKM A;  4W7Z A;  1GU4 A;  5APY A;  1EQ7 A;  1JOC A;  2FXM A;  2Z4E C;  1IFI A;  3KDP B;  2HPC B;  1FZF B;  1LTA C;  2C9L Y;  1QL2 A;  1OXZ A;  2WNP F;  3H6P A;  2E42 A;  2OYH C;  1FJP A;  4HYT B;  2J3O A;  5AW7 B;  1N73 B;  1HJB A;  3MGN A;  2YO2 A;  5APV A;  2VRS A;  4R9J A;  2J3U A;  1YYC A;  1FDM A;  1LTI C;  1LWU A;  1NHL A;  1N7S D;  1NWQ A;  4GIF A;  2KSJ A;  3NXS A;  1ZLL A;  4Y99 C;  1L4A C;  1N73 C;  3RK3 D;  2J0Y A;  1M1J B;  1SVF A;  5BVZ A;  3BAS A;  2PP6 A;  3V2N A;  1NU1 K;  1FIB A;  2WSF H;  3A3Y B;  4IFD K;  4C46 A;  5AW0 B;  2HLO C;  2ZXE B;  1URQ A;  1SFC A;  2IPP A;  3BRV B;  2R5B A;  2W27 A;  1ZV8 A;  1LTB C;  1T8Z A;  2N1T A;  2H43 A;  2H8P D;  1RE4 A;  1GL2 C;  3VOP A;  2R5D A;  1FZB B;  3BVH A;  1N7L A;  2Q9I B;  1JTH B;  2O01 H;  2R3C A;  2XNX A;  2FKW B;  2FYU K;  1S9K D;  1FZB A;  2IX7 C;  2MJZ A;  5AW1 B;  4N78 D;  4LC1 A;  5BU8 B;  2KB7 P;  4WY4 C;  1JNM A;  3M91 A;  1H89 A;  1HH0 A;  3KPE A;  1NTZ K;  1G2C B;  2HOD C;  1SLQ A;  3WMM 0;  4KHX A;  3UIA A;  1CZQ A;  4AYC A;  1G2C A;  2FYZ A;  2YKO A;  3TSI A;  3E1I C;  1FID A;  1IFJ A;  1RF1 B;  5AVQ B;  1J1D B;  2NPS B;  5APS A;  1LT9 B;  2J3G A;  3M06 A;  1NH4 A;  3V2P A;  2GY7 A;  4ZFG A;  1FZC B;  4R9T A;  1GTW A;  2FFD C;  1SQQ K;  3LW5 H;  1SFC D;  1HWT C;  4LLH A;  1HGZ A;  2A45 G;  3B5N B;  2D39 A;  5AW8 B;  1N2D C;  3EQ2 A;  1FZE B;  2JHL F;  4EPU A;  1N7S C;  1RF0 C;  4WBA A;  1H88 A;  1J1D C;  4JYO X;  5AVT B;  2J59 M;  1FZA B;  3HRN A;  1KQL A;  3TNU B;  3IR9 A;  1ZN5 A;  5AVX B;  1T3U A;  1JY3 O;  1RY3 A;  3RK3 C;  3VP9 A;  1H8A A;  3M9Q A;  1FZA A;  5KJ7 A;  1JC9 A;  2GUS A;  4JYB A;  4AQR D;  1FZG A;  1FOS E;  1MFZ A;  2WWW A;  5APW A;  1FZE C;  4IFM A;  5APX A;  2WTY A;  4M7H A;  4GKG A;  2Q7C A;  2P7J A;  2XV5 A;  1LWU B;  4XE5 B;  5AVR B;  2J3F D;  3N4X A;  2OYH A;  1SQV K;  1KIL B;  1J1E C;  1IO4 A;  2GM4 A;  3RL0 B;  1AQ5 A;  1IK9 A;  2NPS D;  1KIL A;  3SWY A;  3NTN A;  4EIJ A;  2HPC C;  1FZF C;  1NO4 A;  2KP8 A;  1YTZ T;  4JYC A;  1FZD A;  1SQX K;  2HFE D;  4DOJ A;  5CJ4 A;  5KTB A;  1URQ B;  3P8C D;  1SFC B;  3B5N D;  1GU5 A;  3IFM A;  3HD7 B;  1FOS F;  1CW5 A;  4NYT A;  3TYY A;  3L4F A;  4I6M C;  3BAT A;  2FIB A;  2N1T B;  2H43 B;  5AW3 B;  1RE4 B;  3HD7 A;  2P1J A;  1JY2 O;  2HLO A;  2R32 A;  3BVH B;  2YNY A;  1NTM K;  3HTK B;  1NTK K;  1FU1 A;  3VP8 A;  2XNX B;  3B8E B;  3H32 A;  1M1J C;  1WT6 A;  2KYV A;  2YKP A;  3HTK A;  1KZU B;  3CL3 D;  3VN0 A;  1JCC A;  1SFC C;  1IC2 A;  1GL2 A;  4I2L C;  3V2Q A;  1A02 F;  3P8M C;  4N3Y B;  4W80 A;  2J2P A;  4RES B;  2H43 C;  2Q3I A;  4WB4 A;  1RE4 C;  2BAS A;  4W7Y A;  3BVH C;  1IFM A;  1IFD A;  1KFN A;  1GD2 E;  2JEE A;  5BU5 A;  1DH3 A;  1KIL D;  4WY4 A;  2WPQ A;  3L35 A;  1FZB C;  1GK4 A;  3RL0 D;  2Q9I C;  2I1J A;  4JF7 A;  2HOD A;  2WT7 B;  2XZR A;  3HE5 B;  3A5T A;  2WPS A;  3GHG A;  2WT7 A;  3HE5 A;  3VYI A;  4GT1 A;  1JO5 A;  2I1K A;  3C9I A;  1KFM A;  1LTJ B;  1RE3 B;  1CI6 A;  2J58 A;  5CHX A;  2P2U A;  1URQ D;  3HD7 D;  4AUW A;  5CCH A;  3HE4 A;  1LTJ A;  1RE3 A;  1J2J B;  2FFD A;  2N1T D;  1L0N K;  3VTP C;  2O1K A;  3NMD A;  5APU A;  4DZO A;  1T2K D;  3OAK A;  3A2A A;  3MTU E;  1RF1 C;  1ZR4 A;  2NPS C;  5AVU B;  1LT9 C;  4I1L A;  1DX7 A;  2JHH C;  1XTG B;  1GK6 A;  2OYI B;  1S9K E;  2HG5 D;  2XKM A;  1HBW A;  4N78 E;  3HUS B;  5AVV B;  1FZC C;  2GUV A;  1FZG B;  3PP5 A;  1N86 B;  1L0L K;  2OYI A;  1QL1 A;  5AVW B;  5AW5 B;  2KLV A;  2N9B A;  1SQP K;  3HUS A;  2POH A;  3B5N C;  4M7F A;  2Z4E B;  1N86 A;  5CCG A;  3MUD A;  1Z3U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...