1N73C

Fibrin d-dimer, lamprey complexed with the peptide ligand: gly-his-arg-pro-amide
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
322
structure length
322
Chain Sequence
KTVQKILEEVRILEQIGVSHDAQIQELSEMWRVNQQFVTRLQQQLVDIRQTCSRSCQDTTANKISPITGKDCQQVVDNGGKDSGLYYIKPLKAKQPFLVFCEIENGNGWTVIQHRHDGSVNFTRDWVSYREGFGYLAPTLTTEFWLGNEKIHLLTGQQAYRLRIDLTDWENTHRYADYGHFKLTPESDEYRLFYSMYLDGDAGNAFDGFDFGDDPQDKFYTTHLGMLFSTPERDNDKYEGSCAEQDGSGWWMNRCHAGHLNGKYYFGGNYRKTDVEFPYDDGIIWATWHDRWYSLKMTTMKLLPMGRDLSGHGGQQQSKGNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibrin alpha-1 chain
publication title The Crystal structure of fragment double-D from cross-linked lamprey fibrin reveals isopeptide linkages across an unexpected D-D interface
pubmed doi rcsb
molecule tags Blood clotting
total genus 92
structure length 322
sequence length 322
chains with identical sequence F
ec nomenclature
pdb deposition date 2002-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1n73C03
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 1n73C01
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 1n73C02
2D39A 3HUSA 1FIBA 4M7HA 1FZBC 1FZGB 1LWUA 1FZEA 1RE3C 1LT9B 1FZCC 3E1IA 1FZAC 1FZFC 3H32C 2J0GA 2J2PA 3HUSC 1JY2P 2Z4EA 1LWUC 3BVHB 1FZEC 4R9JA 2XNXB 2HPCA 2GY7A 3E1IC 2WNPF 2HODA 1M1JA 2JHIF 1RF0B 1FZGA 1LTJB 2Z4EC 2J64A 2J0HA 1JY3P 2Q9IA 2HPCC 2JHKF 1RE4B 2J1GA 1N86A 2HODC 1M1JC 1RF1A 1N73A 4M7FA 2JHHC 2OYIB 1JY2O 2HLOB 2FFDB 2J3OA 2A45G 3GHGB 2Q9IC 1Z3SA 2J61B 2H43B 1N86C 1FZBB 2J3FD 1RE3B 2J3UA 1FZCB 4EPUA 4ZFGA 1N73C 2OYHA 1RF1C 1LTJA 4JZCA 2A45I 1FZAB 1FZFB 3H32B 1LT9A 3HUSB 2FIBA 1LWUB 2J3GA 1FZEB 2OYHC 1LTJC 3E1IB 1JC9A 1W2EA 2A45H 3BVHA 1FZGC 1LT9C 2H43A 2XNXA 4R9TA 2Z4EB 1JY2N 2HPCB 1FIDA 1RF0A 2J3FA 2J60A 2HODB 3BVHC 1M1JB 4NYTA 2H43C 1T3UA 2XNXC 1JY3O 1RE4A 2Q9IB 1RF0C 1JY3N 2OYIA 1N86B 2HLOA 2FFDA 2J5ZA 2JHLF 1RF1B 1N73B 3GHGA 1FZDA 2J61A 2J0YA 1RE4C 1FZBA 1RE3A 3FIBA 1FZCA 1Z3UA 4JYOX 2OYIC 1FZAA 2HLOC 1FZFA 2FFDC 3H32A 2JHMF 1FICA 2OYHB 3GHGC
chains in the Genus database with same CATH superfamily
1VQNP 3HE4B 1KTMA 4C7NB 1VF5C 2FYUK 1ZMEC 4KHXA 3H1JD 1J2JB 3H1HG 1FZFC 3H32C 1EC5A 3AE1C 4CPGA 3Q1MA 1NTZE 1IFDA 1JY2P 3L73J 3HRNA 3H1LD 3CXHD 2BASA 1NOHA 1NU1E 1PGQA 3WUTA 4R4LA 2SPZA 4DOJA 1KYOI 1JTHA 2D2CB 2Q9IA 1SQXD 3A0HH 1EDJA 1KQGB 5KAIH 3KDPB 3LW5J 1LT9A 3RBXA 3K5BA 3L73G 2M3BA 4IL6X 2KLVA 5GTHH 5APUA 4GKGA 2A45H 1XTGB 2W83C 1JY2N 3B8EB 1RF0A 3CPWO 5B66H 3L71G 3MIWA 1S5LX 1JY3O 1RE4A 4EDFA 4B86A 3AE4C 2QM8A 2OYIA 1N86B 4Y28J 3U59A 2NPSB 2QSIA 3RK2C 3CLQA 3P8CD 2HR3A 4JYCA 2QM7A 2E74C 3L72E 3A0BH 4PJ0H 4MN4C 1UIXA 5H2FE 1L0LJ 2FYNC 3ABVC 3QH9A 1YJWP 2WWWA 1NTMJ 2QA4P 2HPCA 2P1JA 1X9VA 1L0NE 1Q86Q 3PHLA 3G4SP 4I6MC 4GOEA 3GLMA 1PL5A 3KZIE 1XTCC 2CPBA 3CCUP 1FS0E 2XNDH 2J59M 2J61B 4AYCA 1VF5B 1IC2A 1OW8A 1L0LG 1NTZJ 1FZFB 3H32B 1NTKD 4JPZB 3B4SA 3AE8C 2N1TD 1GTWA 1CSBA 1NTMG 3L70E 4PD4D 1FDIA 1NVOA 1NU1J 5CCHA 1OW6A 2P10A 5AW9B 1LP1A 3HD7A 2KNCB 3H1HD 1R5SA 5CJ4A 1MFTA 5E79H 1FOSF 1NKNA 2WPRA 1FAVA 4PV1C 2WVRA 2HLOA 3CD6P 1BGYJ 2RMZA 1NKZB 1NTZG 3GHGA 1DIPA 4WB4A 3SFDC 3PJSK 1FZAA 4QMAA 1FU1A 1NU1G 3G6EP 2RN0A 1KB9D 1SLQA 1USEA 4I1LA 4K35A 2R32A 3Q5PA 5KJ7C 5GTIE 5CCGC 4JBZA 1L4AA 2I1JA 2K9JB 4WY4D 4YXDC 4NPEA 3BATA 2WSFJ 3L73D 1BGYG 2KSJA 5KKZC 1IFJA 1P84E 1M8OB 1JY3P 3RK2B 1LTBC 3W67A 1KN7A 2E43A 4YTPC 1N73A 3L72J 3AEFC 4XA4A 2E74B 3L71D 4BRYA 1Z3SA 2GUVA 1D7MA 3E1RA 1Z56A 2J3FD 2V7QH 2C0XA 3FWLA 2OYHA 1ZXGA 4EI2A 4JZCA 1GK6A 5KLVJ 3CXHH 2FYNB 2YNYA 3WUVA 3CCQP 1W2BO 2KYVA 1SQPE 1M1KQ 4RJTA 5CBOA 2YKOA 3UIAA 3L75E 2QEXP 1FJKA 3L4FA 1AFOA 2J60A 3L72G 1PP9E 2K1AA 1JY3N 1N7SD 2QJYC 3N4XA 2OYOA 5KLVG 5AVQB 1ZRTD 2E76C 3MHVA 4IFMA 1OVRA 2XV5A 2FFDC 1HF9A 2K9YA 2Y0EA 1LTGC 4W7YA 3B5NC 1VQMP 1KILC 4XFJA 3V2NA 3CX5I 3RBZA 2MKVA 5CMZA 1L0LD 1RHZB 2IYOA 4DZOA 1N2DC 2M3EA 2V4HA 1NTMD 1IZNB 4PV1B 1BDCA 1N7LA 4Y99C 1HWTC 1SFCC 4JF7A 2R5DA 3IN6A 1RQUA 1KFMA 2O3JA 3TNUA 4GT1A 4GOFA 2Q1KA 2Y0DA 1M90Q 4LGDE 3AE5C 2C9LY 1NTZD 1ZW0A 4C46A 1VQ7P 1SQXJ 3AEBC 3KQGA 1NU1D 3CXHI 3V2RA 1YBKA 5DJUB 5KKZB 2CK3H 1HTLC 3U1CA 1SP4A 2M5AA 2P7JA 3BVHC 1G1JA 3CCSP 2O01H 2QRXA 2IFNA 1BGYD 3T97A 4PD4H 4DT0A 4UB6H 5TISE 1YITP 5BVZA 1SQXG 3WU2E 3L75J 2XKMA 1MZ9A 5B5EE 1FIBA 3E1IA 1K73Q 1IFMA 1PP9J 2P58A 3HE5B 3H1IJ 2WPVB 3A7OA 3C8VA 4R9JA 1X79B 2KIKA 3P8MC 4HYTB 1KD1Q 4D6TJ 2JWAA 2RH0A 2KSEA 1HBWA 1T3JA 2QJYB 4BXLA 1SQQK 2R5BA 1SQPG 2E76B 1M56D 1RF1A 1N8RQ 3AE7C 3G3ZA 3L75G 4BWNA 2FFDB 3L72D 2A06E 1ZR2A 2YXQB 1KYOH 4AQRD 2B87A 1KFNA 4OGQD 1NH4A 3B5NB 1KILB 2J5UA 1GD2E 2I8DA 1QVFO 1PP9G 2FXMA 3H1IG 3HE4A 3QWOC 3S4RA 4C7NA 5KLVD 3P32A 1J1DC 2IPPA 2GA1A 4D6TG 2AXTH 4GODA 4NPDA 4RKUJ 2B88A 4Y99B 1Q2NA 1SFCB 3CC2P 2Y9ZA 5CBNA 2E5TA 3VMXA 1T3UA 1S5LE 4IL6H 3WMM0 3LW5H 4H0LD 1HGZA 2JHLF 2J5ZA 3CX5D 2N1TC 3D6ZA 1NWQA 2ZVNB 3GMAA 3L70D 2BEQD 1GU5A 3D6YA 1PGOA 2JP3A 3A3YB 5AW3B 3I55P 2KZJA 4HB1A 1EXJA 3OAKA 2ZYAA 3BVHB 2I1KA 5APXA 2M8RA 2Z4EC 1K04A 1PIXA 2YXRB 1K05A 5CJ0A 2ZFCA 3KXDA 1QVGO 1OMIA 3RL0g 1N86A 3IF4A 1IFIA 2CPSA 2NPSA 4KJMA 3A0HE 2J3OA 1EZVE 3L74E 5KAIE 2BCCE 1SQVE 1KB9I 2QE7H 4JQ0D 4WY4C 2B9BA 3JCUH 3O6QB 3FX0A 4U3FJ 5GTHE 2XU6A 2JKVA 3L71J 1QX8A 2K3RA 3CWBE 1P84D 3USSA 3Q2YA 3AE3C 4M3LA 3EFFK 1FC2C 3V5BA 5B66E 2XNXC 1JMBA 3D71A 1S1CX 2FYZA 2ZYGA 4WWIA 3MTUE 2J61A 2DW3A 1J1DB 1SQPD 1WMKA 1HUCA 1K8AQ 1H89A 1FZFA 3H32A 3VP8A 2L5GB 4U3FG 3EQ2A 3L75D 3H1KJ 3FWNA 3A0BE 3KYQA 4N78D 4ZKPA 2OTJP 4PJ0E 2QJKC 1PP9D 3H1ID 3M0DC 3MUDC 4RO0A 3JC22 2KNCA 3RK3D 1DH3A 1N7SC 3TDKA 4D6TD 1NTKK 3L36A 1EXIA 2JWDA 2JHKF 2N1TB 4Z1MH 2KS1B 1URQD 3W68A 2Y9YA 3VOPA 1FBMA 2IBZE 1SQBE 3H1KG 2KB7P 4NPFX 1A02F 4EPUA 2WITA 1A02J 1KQLA 1H0TA 1PPJG 2KLUA 1IK7A 4ZKUA 5KLIC 2K9JA 1FZGC 3L37A 5AVTB 3MP7B 3GF3A 2Q5UA 5AVZB 2Z4EB 1T6AA 1H88A 3CCRP 3L74J 1EDKA 1Q7YQ 1HH0A 1SQVJ 4RESB 2ZYDA 5APSA 3Q5RA 3ITKA 2JEEA 1SQQE 4WY4B 5AW7B 1HVVA 3CCLP 3PP5A 2D39A 5APWA 1KILE 1RE3C 1RQVA 2WQYC 4W7ZA 1OZHA 1FDOA 2JR8A 1EZVG 3L74G 3HUSC 1LT1A 1GK4A 3P7KA 2Q3IA 1LWUC 2BCCG 2FXPA 1SQVG 2IFMA 2WT7B 2XNXB 3CX5H 1FZGA 3NMDA 1Q90D 2M0BA 1RY3A 3TGUE 5EFWB 2VRSA 3M91A 1AQTA 1H0TB 2J1GA 2A45G 1R5LA 4XE5B 3NXSA 3H1JE 2GM4A 5AVXB 2G3AA 4L73A 2RKLA 2YO2A 2QVAA 2QJKB 3AE2C 3V6IA 3CXHE 3CC7P 2Y0CA 2AXCA 1VQLP 3RGUA 4U3FD 1N7SB 3VMAA 1VQ6P 5GTIH 4IFDK 1SQBJ 2H43C 1DX7A 5BU8B 1BCCE 3V4WA 3MGNA 4OGQC 5AVWB 1L0NJ 1UIIA 3I5CA 1L0LK 2FYUE 5KJ7A 5CCGA 2Z5IA 1Z3UA 1NTMK 4JYOX 5KLIB 2JHMF 3F5HA 3IFMA 3II6A 1OX3A 4M7HA 1FZBC 2YMKA 1FZGB 1GMJA 3H1KD 2WSCH 1FJPA 5AW0B 1CI6B 1SQBG 2G8YA 3S1KA 2ZAEB 1PPJD 3L70J 1E5WA 1NJIQ 2JDIH 1L0NG 1E79H 4H0LC 3RK2D 1ZR4A 1MKMA 4KT0J 1NTZK 1ZV8A 1LJ2A 2HODC 1IFNA 5CCHD 2HYNA 1JUNA 1NU1K 1W5CE 4HJGH 1H8AA 5KAFH 1Y8AA 3HD7D 1RE3B 2QIWA 1JCDA 2E75D 2E5YA 4GIFA 3HUSB 3U1AA 2ZT9C 1QEXA 1LWUB 3L70G 1LTJC 3HE5A 3CCEP 2AEJA 2O01N 1GL2C 2H89C 4ASWA 3TF5A 1RH5B 2QG4A 1EZVD 3L74D 3I56P 2BCCD 1L4AD 1SQVD 1M7LA 3NTNA 4L74A 1KMIZ 2FFDA 1NTKE 2FY8A 2WSEJ 1PV3A 1Q81Q 2PP6A 2J0YA 3G71P 3B5NA 1KILA 4PD4E 1PFIA 4EOTA 2K88A 2KXPB 1VPCA 2ITAA 3EFGA 1AQ5A 1FZCC 1G2CB 5APTA 1YQ4C 1P84I 5L8RJ 1IO4A 1BCCJ 1SFCA 1FZEC 1VQ5P 1JMMA 1SQPJ 1GL2A 1S3JA 4OGQB 2FYUJ 5KLVK 2YMYA 3OW2O 1AJYA 5AW8B 1M1JC 1CZQA 2O1KA 1JY2O 3SWFA 5K5GB 1FZBB 4L76A 1KYOE 3CCJP 2IZ1A 2IDBA 1BE3E 4H13D 2WMMA 1BCCG 2WPQA 1QL2A 1KB9H 3KPEA 3AECC 3RK3C 3BVHA 3WU2H 2H7HA 2FYUG 4H0LB 2AXTE 4U7JA 1S4XA 1FDMA 1QL1A 2IZ0A 1ZP0C 5B5EH 1FIDA 1URQC 3FXEA 2HODB 2C0WA 2IBZD 1SQBD 4AUWA 3SSUA 1OFCX 3FGAD 3BCCE 4ZMDA 3SFEC 2FBWC 2LXBA 4IL6E 1L0ND 2H8PD 4LC1A 3VN0A 1U7MA 1AVYA 2ZT9B 1LTJB 2O1JA 1GL2B 3O6QA 3V2QA 2WPSA 2N9BA 2J0GA 3E7KA 1PGJA 1EDIA 1YTZT 2NZ2A 3HTKB 1YYCA 2WTYA 3VYIA 1ZRTE 2Q6QA 3V2PA 1S9KE 4H44D 2Q3EA 5AW6B 2W27A 2IX7C 1SQXK 3GW6A 2YKPA 4IFFA 2JHHC 2Q9IC 1DD4A 4UB8H 1FZCB 2UWJE 3S9OA 2XDJA 1NTME 2J3GA 3M0AA 3Q5SA 2PAJA 1FZEB 1U57A 3JCUE 1W2EA 3CMAP 1LT9C 3VP9A 1YHQP 3TGUD 2Z5HA 4I2LC 1Y9BA 2ZXEB 3RL0D 4N3YB 3BASA 3CL3D 1M1JB 2N1TA 2KS1A 1RF0C 1MV8A 2YKQA 3V4QA 1BE3J 4R4MA 1Q82Q 1IFPA 2OQQA 1RE4C 5DJTB 2L91A 3WUUA 2OYIC 2OTKE 1VQOP 2QJPC 1SS1A 1LTAC 1KZUB 3RK3B 3NFQA 4EIJA 5AVUB 1ZN5A 3FXDA 2B89A 1URQB 1BSHA 3LIEA 1FE6A 2R3SA 3AEEC 2Z4EA 1BCCD 3M9HA 3BCCJ 1FOSE 4TT3H 3IR9A 1OVUA 1LNQA 1BE3G 1BGYE 2YIUC 2FYUD 2HPCC 2C9NY 2BEZF 3D70A 3GF7A 3OJAB 2A06G 4WY4A 4DCKA 4GDOA 3PTZA 1PZQA 1HJBA 3A2AA 1VQKP 1VDFA 2D2CD 3CC4P 5AVSB 2YO3A 3AE6C 3PLNA 3BCCG 1T2KD 1OXZA 3Q3DA 2XNXA 2WT7A 2HG5D 3O8ZA 2J3FA 5CCHC 1KQFB 4NYTA 4L75A 3SWYA 1JTHB 2WSFH 2Q9IB 2N9YB 4O9BA 3HD7C 3H25A 5KLVE 3TYYA 1USDA 2E75C 5APVA 2P67A 2W6JH 2HLOC 1AA0A 3GHGC 2KUBA 1LTSC 3M0DA 1IJDB 2BCCJ 1LT9B 1GW3A 3MUDA 5H2FH 5E79E 3F89A 2NPSD 1FZAC 3CI9A 1KC8Q 1N7SA 1GU4A 2W6AA 1JB0J 1L4AC 1EZVI 1RF0B 3CCVP 3CX5E 1PGPA 3CWBJ 5AVVB 1OWAA 3KZIH 1DD3A 1RE4B 1U7JA 2OYIB 2LXCB 3AEDC 2KK7A 1KV4A 2QJPB 1VL2A 2R3CA 4K3AA 2PFXA 1JCCA 1N73C 1MUUA 2A45I 4A7PA 4W80A 2FIBA 1J1EC 2OYHC 1WRGA 1CI6A 3H6PA 1GDTA 3N7NA 1VF5D 4HH2A 3CWBG 4LLHA 1KQSO 4R9TA 2R44A 2YIUB 3PH0A 2HPCB 2KI7B 1GZLA 3H1LE 2J58A 1KYOD 1YIJP 3AEAC 1BE3D 1AV1A 4H13C 1FZDA 2LR2A 1RE3A 1G1IA 3SWKA 1SQXE 1QGKB 2K37A 2FXOA 1YJ9P 3HUSA 2WSSH 1LWUA 3TK1A 2A06D 2W6BA 3BRTB 5AW5B 2PGDA 3EWKA 2LKMA 2WNPF 2IBZI 2WSEH 3BCCD 1LP1B 1P84H 2JHIF 5BU5A 3HD7B 2WZ7A 1WT6A 2J64A 3VTPC 5M1BA 5AW1B 5CHXA 2E75B 1X22A 2HLOB 4WBAA 2IBZG 1ZLLA 3C1LA 3GHGB 4N78E 5KAFE 2NRGA 3C9IA 1MFZA 1K9MQ 1FZAB 3H1IE 3P8CE 1CW5A 2P2UA 1SQQJ 1NAFA 1G2CA 1LGHB 5APYA 1Y47A 3GG2A 1SQVK 3M06A 2E74D 1M57D 2OARA 3RK3E 4D6TE 1L4AB 3M9BA 3VMYA 2H43A 1VQPP 1S9KD 4H44C 1T8ZA 1QLED 3CCMP 1HGVA 3R2PA 1N73B 4OWFA 3TGUJ 1BDDA 1SQQG 1FZBA 2H88C 4BRYB 1NHLA 1NGMB 1J1EB 1EDLA 2OYHB 4IOIH 4WVZA 5KTBA 3H1JJ 1GW4A 3RL0C 1JM0A 3L35A 2V7QJ 2J2PA 1JOCA 3H1LJ 3AEGC 4ZNCA 2GY7A 4YXWH 3E1IC 2HODA 4UB6E 1BSNA 4YPCA 5TJHA 3TGUG 2AEFA 4I7ZC 2J0HA 1R8EA 3CWBD 3MZWB 1KORA 4H13B 3AE9C 3H1HE 4EYYQ 2KZIA 4HKZH 5AVYB 2OGUA 5AW4B 3H1JG 3ZDMA 4OH8B 4PV1D 2H43B 2XZRA 2J3UA 1RF1C 2WSCJ 2KP8A 1LTJA 5APQA 1LTIC 1SQBK 2IYPA 3A5TA 3H1LG 1JNMA 1JC9A 1KB9E 1L0NK 1S72P 5C39A 5KJ7D 3HTKA 5CCGD 4TLFA 1VQ4P 2W90A 2HFED 3MD0A 3OA7A 1X8YA 3L73E 1TU3F 2JJLA 5TISH 1HJ0A 2D2CC 3CMEP 3TNUB 2FKWB 3BRVB 1OVVA 1YQ3C 3FIBA 1FZCA 3VMZA 4C7RA 1DEBA 3M9QA 2MJZA 1T2KC 4U3FE 3L71E 1YTZI 1FZEA 3KHUA 4H44B 1OW7A 2POHA 3R4YA 4DJGA 1X0TA 3LIDA 1IK9A 1M1JA 2M5AB 5AW2B 1SVFA 2OTLP 2KOGA 2ZXXA 1EQ7A 4N6JA 1VQ9P 4M7FA 2GUSA 1NAYA 3JSVC 3H1KE 3T97B 1JO5A 3B71A 1N86C 2AEMA 2NPSC 4ZFGA 2ZJSE 3RL0B 1NTKJ 2O01J 4UB8E 1NO4A 2PRRA 3G9RA 1PPJE 2E76D 1SQQD 2Q7CA 1ZOYC 2JO1A 2ZVOB 3E1IB 1URQA 2E42A 1OIPA 3B5ND 1KILD 4I7ZB 1NYHA 4OVNF 1YI2P 3H1HJ 1DEEG 1L0LE 1JEKA 1S2EA 4PD4I 1S5LH 4ASVA 3TSIA 1L2PA 1LTTC 3IAOA 1VQ8P 1NTKG 1RF1B 1SFCD 2ZT9D 4JYBA 5AVRB 1AVOA 2B87B 2W8ZA 1YJNP 3PRJA 1GL2D 1SQPK 1FICA
chains in the Genus database with same CATH topology
1MZ9A 3II6A 3HE4B 1FIBA 4M7HA 1LTSC 3M0DA 1FZBC 1FZGB 1IJDB 2FYUK 4C7NB 1LT9B 1GW3A 3MUDA 4KHXA 2WSCH 2NPSD 3E1IA 1J2JB 1IFMA 1FJPA 3CI9A 1FZAC 1FZFC 5AW0B 3H32C 3HE5B 1CI6B 1N7SA 3A7OA 1GU4A 1IFDA 1JY2P 2W6AA 4R9JA 1X79B 3HRNA 3P8MC 1E5WA 4HYTB 1L4AC 2BASA 1NOHA 3RK2D 1ZR4A 1RF0B 1HBWA 1T3JA 1NTZK 1ZV8A 5AVVB 1OWAA 4DOJA 1JTHA 1SQQK 2Q9IA 2R5BA 1RE4B 2HODC 1IFNA 5CCHD 1RF1A 2HYNA 1JUNA 2OYIB 1NU1K 3G3ZA 2FFDB 1H8AA 1ZR2A 4AQRD 2R3CA 1KFNA 3HD7D 1RE3B 1NH4A 3B5NB 1KILB 1JCCA 1N73C 1GD2E 1MUUA 3KDPB 2A45I 2FXMA 3HE4A 1JCDA 4C7NA 1LT9A 4GIFA 3P32A 4W80A 3HUSB 1J1DC 2FIBA 3U1AA 2IPPA 1LWUB 2M3BA 2KLVA 1J1EC 2OYHC 1LTJC 1WRGA 3HE5A 5APUA 1CI6A 4GKGA 3H6PA 1GL2C 2A45H 1GDTA 3N7NA 1XTGB 4HH2A 4LLHA 4R9TA 4Y99B 1SFCB 1JY2N 3B8EB 2HPCB 1RF0A 1GZLA 3VMXA 3MIWA 1T3UA 1JY3O 1RE4A 1L4AD 2J58A 3WMM0 4B86A 3LW5H 1M7LA 2QM8A 3NTNA 2OYIA 1N86B 1HGZA 2FFDA 2J5ZA 2JHLF 3U59A 2NPSB 3RK2C 3CLQA 3P8CD 1FZDA 2J0YA 2PP6A 2N1TC 1NWQA 1RE3A 1G1IA 3B5NA 1KILA 1PFIA 4JYCA 2QM7A 4EOTA 1GU5A 3HUSA 1VPCA 3EFGA 1LWUA 1AQ5A 3TK1A 2W6BA 1FZCC 1G2CB 3BRTB 5APTA 5AW5B 3A3YB 5AW3B 1IO4A 3OAKA 3BVHB 1SFCA 2I1KA 2WWWA 1FZEC 2LKMA 2HPCA 1JMMA 2P1JA 2WNPF 1X9VA 2WSEH 5APXA 2M8RA 1GL2A 5BU5A 2JHIF 3HD7B 2WZ7A 2Z4EC 1WT6A 2J64A 3VTPC 5KLVK 2YMYA 5AW1B 5CJ0A 5AW8B 2ZFCA 4I6MC 5CHXA 1N86A 1IFIA 1M1JC 2CPSA 2NPSA 1CZQA 2O1KA 1XTCC 2CPBA 1JY2O 2HLOB 4WBAA 1ZLLA 3SWFA 2J3OA 2J59M 3GHGB 4N78E 2J61B 4AYCA 1FZBB 3C9IA 1IC2A 1MFZA 1FZAB 1FZFB 3H32B 3P8CE 1CW5A 4WY4C 2P2UA 1NAFA 1G2CA 2N1TD 2WPQA 1GTWA 1LGHB 5APYA 1CSBA 1SQVK 1QL2A 3M06A 3KPEA 2OARA 1L4AB 5CCHA 3RK3C 3BVHA 2XU6A 2H7HA 3M9BA 3VMYA 2H43A 1S9KD 1FDMA 1T8ZA 1QL1A 5AW9B 4M3LA 1FIDA 3HD7A 1URQC 2HODB 5CJ4A 3V5BA 2C0WA 2XNXC 4AUWA 1FOSF 1NKNA 2WPRA 1FAVA 1HGVA 2FYZA 2HLOA 3R2PA 1NKZB 1N73B 3GHGA 3MTUE 2H8PD 2J61A 4LC1A 3VN0A 1FZBA 4WB4A 1NHLA 1J1DB 1FZAA 1HUCA 1FU1A 1H89A 1FZFA 3H32A 1J1EB 3VP8A 2L5GB 2OYHB 1LTJB 4I1LA 1SLQA 2O1JA 2R32A 3EQ2A 1GL2B 5KJ7C 5KTBA 5CCGC 3KYQA 4N78D 1GW4A 3RL0C 2WPSA 3V2QA 1L4AA 4ZKPA 2N9BA 3L35A 2I1JA 2J0GA 2J2PA 4WY4D 3M0DC 1JOCA 3BATA 1YTZT 3HTKB 2GY7A 3E1IC 1YYCA 2HODA 3RK3D 2WTYA 3VYIA 1N7SC 1DH3A 3V2PA 1NTKK 2KSJA 3L36A 1IFJA 2J0HA 1S9KE 1JY3P 3RK2B 5AW6B 2JHKF 2W27A 1LTBC 2N1TB 2IX7C 1SQXK 1URQD 2E43A 3VOPA 4IFFA 2YKPA 1N73A 2JHHC 1FBMA 4XA4A 5AVYB 5AW4B 2KB7P 2Q9IC 1Z3SA 2GUVA 4OH8B 2H43B 1Z56A 2XZRA 2J3FD 2C0XA 2J3UA 1FZCB 1A02F 2WITA 1RF1C 5APQA 2KP8A 1LTJA 2OYHA 4JZCA 4EPUA 1GK6A 1A02J 1KQLA 1LTIC 1SQBK 2XDJA 2YNYA 3A5TA 4ZKUA 2J3GA 2KYVA 3M0AA 1FZEB 2PAJA 1JNMA 1JC9A 2YKOA 1W2EA 1L0NK 1FZGC 3L37A 3UIAA 5AVTB 1LT9C 5KJ7D 3VP9A 3HTKA 2Z5HA 1FJKA 2Q5UA 4I2LC 5CCGD 5AVZB 2Z4EB 3L4FA 2ZXEB 3RL0D 4N3YB 1AFOA 1H88A 2J60A 3BASA 3CL3D 1M1JB 2HFED 1HH0A 4RESB 2N1TA 3MD0A 3OA7A 5APSA 1X8YA 1RF0C 1MV8A 1JY3N 2YKQA 3V4QA 1N7SD 2JJLA 3N4XA 2JEEA 5AVQB 3TNUB 2FKWB 3BRVB 1RE4C 4WY4B 5AW7B 3FIBA 1FZCA 1HVVA 3VMZA 4C7RA 1DEBA 4IFMA 2OYIC 2XV5A 2FFDC 3PP5A 3M9QA 2MJZA 1T2KC 2D39A 5APWA 1LTAC 1LTGC 1KZUB 3RK3B 1YTZI 1FZEA 1RE3C 4W7YA 3B5NC 3NFQA 1KILC 4EIJA 5AVUB 3V2NA 1ZN5A 4W7ZA 2POHA 3HUSC 5CMZA 1URQB 1GK4A 3LIEA 3P7KA 2Q3IA 1LWUC 2Z4EA 2IFMA 4DZOA 1N2DC 3LIDA 3M9HA 2WT7B 2XNXB 1FOSE 3IR9A 1IK9A 1M1JA 5AW2B 1SVFA 1N7LA 1FZGA 3NMDA 2KOGA 1RY3A 4Y99C 1HWTC 1SFCC 2VRSA 4JF7A 2R5DA 2HPCC 1EQ7A 3M91A 4N6JA 2J1GA 2C9NY 1KFMA 4M7FA 2GUSA 3TNUA 4GT1A 3OJAB 2A45G 4WY4A 4XE5B 3NXSA 1JO5A 1N86C 2GM4A 5AVXB 1HJBA 3A2AA 4LGDE 2NPSC 1VDFA 4ZFGA 3RL0B 1NO4A 2YO2A 2C9LY 5AVSB 2YO3A 4C46A 2Q7CA 3KQGA 3E1IB 1T2KD 1OXZA 1URQA 2E42A 1N7SB 3V2RA 2XNXA 3B5ND 2WT7A 1KILD 1HTLC 2HG5D 1SP4A 3U1CA 3O8ZA 2J3FA 2P7JA 5CCHC 4IFDK 3BVHC 4NYTA 2H43C 1DX7A 5BU8B 3SWYA 3TSIA 1G1JA 1JTHB 2WSFH 3MGNA 3V4WA 2Q9IB 1LTTC 2O01H 4O9BA 5AVWB 3HD7C 3I5CA 2IFNA 1RF1B 1SFCD 3TYYA 1L0LK 3T97A 4JYBA 5AVRB 5BVZA 5KJ7A 5CCGA 2Z5IA 5APVA 2P67A 1Z3UA 1NTMK 4JYOX 1GL2D 2HLOC 1SQPK 2JHMF 1FICA 3GHGC 3IFMA 2XKMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D39 A;  3HUS A;  1FIB A;  4M7H A;  1FZB C;  1FZG B;  1LWU A;  1FZE A;  1RE3 C;  1LT9 B;  1FZC C;  3E1I A;  1FZA C;  1FZF C;  3H32 C;  2J0G A;  2J2P A;  3HUS C;  1JY2 P;  2Z4E A;  1LWU C;  3BVH B;  1FZE C;  4R9J A;  2XNX B;  2HPC A;  2GY7 A;  3E1I C;  2WNP F;  2HOD A;  1M1J A;  2JHI F;  1RF0 B;  1FZG A;  1LTJ B;  2Z4E C;  2J64 A;  2J0H A;  1JY3 P;  2Q9I A;  2HPC C;  2JHK F;  1RE4 B;  2J1G A;  1N86 A;  2HOD C;  1M1J C;  1RF1 A;  1N73 A;  4M7F A;  2JHH C;  2OYI B;  1JY2 O;  2HLO B;  2FFD B;  2J3O A;  2A45 G;  3GHG B;  2Q9I C;  1Z3S A;  2J61 B;  2H43 B;  1N86 C;  1FZB B;  2J3F D;  1RE3 B;  2J3U A;  1FZC B;  4EPU A;  4ZFG A;  1N73 C;  2OYH A;  1RF1 C;  1LTJ A;  4JZC A;  2A45 I;  1FZA B;  1FZF B;  3H32 B;  1LT9 A;  3HUS B;  2FIB A;  1LWU B;  2J3G A;  1FZE B;  2OYH C;  1LTJ C;  3E1I B;  1JC9 A;  1W2E A;  2A45 H;  3BVH A;  1FZG C;  1LT9 C;  2H43 A;  2XNX A;  4R9T A;  2Z4E B;  1JY2 N;  2HPC B;  1FID A;  1RF0 A;  2J3F A;  2J60 A;  2HOD B;  3BVH C;  1M1J B;  4NYT A;  2H43 C;  1T3U A;  2XNX C;  1JY3 O;  1RE4 A;  2Q9I B;  1RF0 C;  1JY3 N;  2OYI A;  1N86 B;  2HLO A;  2FFD A;  2J5Z A;  2JHL F;  1RF1 B;  1N73 B;  3GHG A;  1FZD A;  2J61 A;  2J0Y A;  1RE4 C;  1FZB A;  1RE3 A;  3FIB A;  1FZC A;  1Z3U A;  4JYO X;  2OYI C;  1FZA A;  2HLO C;  1FZF A;  2FFD C;  3H32 A;  2JHM F;  1FIC A;  2OYH B;  3GHG C; 
#chains in the Genus database with same CATH topology
 1VQN P;  3HE4 B;  1KTM A;  4C7N B;  1VF5 C;  2FYU K;  1ZME C;  4KHX A;  3H1J D;  1J2J B;  3H1H G;  1FZF C;  3H32 C;  1EC5 A;  3AE1 C;  4CPG A;  3Q1M A;  1NTZ E;  1IFD A;  1JY2 P;  3L73 J;  3HRN A;  3H1L D;  3CXH D;  2BAS A;  1NOH A;  1NU1 E;  1PGQ A;  3WUT A;  4R4L A;  2SPZ A;  4DOJ A;  1KYO I;  1JTH A;  2D2C B;  2Q9I A;  1SQX D;  3A0H H;  1EDJ A;  1KQG B;  5KAI H;  3KDP B;  3LW5 J;  1LT9 A;  3RBX A;  3K5B A;  3L73 G;  2M3B A;  4IL6 X;  2KLV A;  5GTH H;  5APU A;  4GKG A;  2A45 H;  1XTG B;  2W83 C;  1JY2 N;  3B8E B;  1RF0 A;  3CPW O;  5B66 H;  3L71 G;  3MIW A;  1S5L X;  1JY3 O;  1RE4 A;  4EDF A;  4B86 A;  3AE4 C;  2QM8 A;  2OYI A;  1N86 B;  4Y28 J;  3U59 A;  2NPS B;  2QSI A;  3RK2 C;  3CLQ A;  3P8C D;  2HR3 A;  4JYC A;  2QM7 A;  2E74 C;  3L72 E;  3A0B H;  4PJ0 H;  4MN4 C;  1UIX A;  5H2F E;  1L0L J;  2FYN C;  3ABV C;  3QH9 A;  1YJW P;  2WWW A;  1NTM J;  2QA4 P;  2HPC A;  2P1J A;  1X9V A;  1L0N E;  1Q86 Q;  3PHL A;  3G4S P;  4I6M C;  4GOE A;  3GLM A;  1PL5 A;  3KZI E;  1XTC C;  2CPB A;  3CCU P;  1FS0 E;  2XND H;  2J59 M;  2J61 B;  4AYC A;  1VF5 B;  1IC2 A;  1OW8 A;  1L0L G;  1NTZ J;  1FZF B;  3H32 B;  1NTK D;  4JPZ B;  3B4S A;  3AE8 C;  2N1T D;  1GTW A;  1CSB A;  1NTM G;  3L70 E;  4PD4 D;  1FDI A;  1NVO A;  1NU1 J;  5CCH A;  1OW6 A;  2P10 A;  5AW9 B;  1LP1 A;  3HD7 A;  2KNC B;  3H1H D;  1R5S A;  5CJ4 A;  1MFT A;  5E79 H;  1FOS F;  1NKN A;  2WPR A;  1FAV A;  4PV1 C;  2WVR A;  2HLO A;  3CD6 P;  1BGY J;  2RMZ A;  1NKZ B;  1NTZ G;  3GHG A;  1DIP A;  4WB4 A;  3SFD C;  3PJS K;  1FZA A;  4QMA A;  1FU1 A;  1NU1 G;  3G6E P;  2RN0 A;  1KB9 D;  1SLQ A;  1USE A;  4I1L A;  4K35 A;  2R32 A;  3Q5P A;  5KJ7 C;  5GTI E;  5CCG C;  4JBZ A;  1L4A A;  2I1J A;  2K9J B;  4WY4 D;  4YXD C;  4NPE A;  3BAT A;  2WSF J;  3L73 D;  1BGY G;  2KSJ A;  5KKZ C;  1IFJ A;  1P84 E;  1M8O B;  1JY3 P;  3RK2 B;  1LTB C;  3W67 A;  1KN7 A;  2E43 A;  4YTP C;  1N73 A;  3L72 J;  3AEF C;  4XA4 A;  2E74 B;  3L71 D;  4BRY A;  1Z3S A;  2GUV A;  1D7M A;  3E1R A;  1Z56 A;  2J3F D;  2V7Q H;  2C0X A;  3FWL A;  2OYH A;  1ZXG A;  4EI2 A;  4JZC A;  1GK6 A;  5KLV J;  3CXH H;  2FYN B;  2YNY A;  3WUV A;  3CCQ P;  1W2B O;  2KYV A;  1SQP E;  1M1K Q;  4RJT A;  5CBO A;  2YKO A;  3UIA A;  3L75 E;  2QEX P;  1FJK A;  3L4F A;  1AFO A;  2J60 A;  3L72 G;  1PP9 E;  2K1A A;  1JY3 N;  1N7S D;  2QJY C;  3N4X A;  2OYO A;  5KLV G;  5AVQ B;  1ZRT D;  2E76 C;  3MHV A;  4IFM A;  1OVR A;  2XV5 A;  2FFD C;  1HF9 A;  2K9Y A;  2Y0E A;  1LTG C;  4W7Y A;  3B5N C;  1VQM P;  1KIL C;  4XFJ A;  3V2N A;  3CX5 I;  3RBZ A;  2MKV A;  5CMZ A;  1L0L D;  1RHZ B;  2IYO A;  4DZO A;  1N2D C;  2M3E A;  2V4H A;  1NTM D;  1IZN B;  4PV1 B;  1BDC A;  1N7L A;  4Y99 C;  1HWT C;  1SFC C;  4JF7 A;  2R5D A;  3IN6 A;  1RQU A;  1KFM A;  2O3J A;  3TNU A;  4GT1 A;  4GOF A;  2Q1K A;  2Y0D A;  1M90 Q;  4LGD E;  3AE5 C;  2C9L Y;  1NTZ D;  1ZW0 A;  4C46 A;  1VQ7 P;  1SQX J;  3AEB C;  3KQG A;  1NU1 D;  3CXH I;  3V2R A;  1YBK A;  5DJU B;  5KKZ B;  2CK3 H;  1HTL C;  3U1C A;  1SP4 A;  2M5A A;  2P7J A;  3BVH C;  1G1J A;  3CCS P;  2O01 H;  2QRX A;  2IFN A;  1BGY D;  3T97 A;  4PD4 H;  4DT0 A;  4UB6 H;  5TIS E;  1YIT P;  5BVZ A;  1SQX G;  3WU2 E;  3L75 J;  2XKM A;  1MZ9 A;  5B5E E;  1FIB A;  3E1I A;  1K73 Q;  1IFM A;  1PP9 J;  2P58 A;  3HE5 B;  3H1I J;  2WPV B;  3A7O A;  3C8V A;  4R9J A;  1X79 B;  2KIK A;  3P8M C;  4HYT B;  1KD1 Q;  4D6T J;  2JWA A;  2RH0 A;  2KSE A;  1HBW A;  1T3J A;  2QJY B;  4BXL A;  1SQQ K;  2R5B A;  1SQP G;  2E76 B;  1M56 D;  1RF1 A;  1N8R Q;  3AE7 C;  3G3Z A;  3L75 G;  4BWN A;  2FFD B;  3L72 D;  2A06 E;  1ZR2 A;  2YXQ B;  1KYO H;  4AQR D;  2B87 A;  1KFN A;  4OGQ D;  1NH4 A;  3B5N B;  1KIL B;  2J5U A;  1GD2 E;  2I8D A;  1QVF O;  1PP9 G;  2FXM A;  3H1I G;  3HE4 A;  3QWO C;  3S4R A;  4C7N A;  5KLV D;  3P32 A;  1J1D C;  2IPP A;  2GA1 A;  4D6T G;  2AXT H;  4GOD A;  4NPD A;  4RKU J;  2B88 A;  4Y99 B;  1Q2N A;  1SFC B;  3CC2 P;  2Y9Z A;  5CBN A;  2E5T A;  3VMX A;  1T3U A;  1S5L E;  4IL6 H;  3WMM 0;  3LW5 H;  4H0L D;  1HGZ A;  2JHL F;  2J5Z A;  3CX5 D;  2N1T C;  3D6Z A;  1NWQ A;  2ZVN B;  3GMA A;  3L70 D;  2BEQ D;  1GU5 A;  3D6Y A;  1PGO A;  2JP3 A;  3A3Y B;  5AW3 B;  3I55 P;  2KZJ A;  4HB1 A;  1EXJ A;  3OAK A;  2ZYA A;  3BVH B;  2I1K A;  5APX A;  2M8R A;  2Z4E C;  1K04 A;  1PIX A;  2YXR B;  1K05 A;  5CJ0 A;  2ZFC A;  3KXD A;  1QVG O;  1OMI A;  3RL0 g;  1N86 A;  3IF4 A;  1IFI A;  2CPS A;  2NPS A;  4KJM A;  3A0H E;  2J3O A;  1EZV E;  3L74 E;  5KAI E;  2BCC E;  1SQV E;  1KB9 I;  2QE7 H;  4JQ0 D;  4WY4 C;  2B9B A;  3JCU H;  3O6Q B;  3FX0 A;  4U3F J;  5GTH E;  2XU6 A;  2JKV A;  3L71 J;  1QX8 A;  2K3R A;  3CWB E;  1P84 D;  3USS A;  3Q2Y A;  3AE3 C;  4M3L A;  3EFF K;  1FC2 C;  3V5B A;  5B66 E;  2XNX C;  1JMB A;  3D71 A;  1S1C X;  2FYZ A;  2ZYG A;  4WWI A;  3MTU E;  2J61 A;  2DW3 A;  1J1D B;  1SQP D;  1WMK A;  1HUC A;  1K8A Q;  1H89 A;  1FZF A;  3H32 A;  3VP8 A;  2L5G B;  4U3F G;  3EQ2 A;  3L75 D;  3H1K J;  3FWN A;  3A0B E;  3KYQ A;  4N78 D;  4ZKP A;  2OTJ P;  4PJ0 E;  2QJK C;  1PP9 D;  3H1I D;  3M0D C;  3MUD C;  4RO0 A;  3JC2 2;  2KNC A;  3RK3 D;  1DH3 A;  1N7S C;  3TDK A;  4D6T D;  1NTK K;  3L36 A;  1EXI A;  2JWD A;  2JHK F;  2N1T B;  4Z1M H;  2KS1 B;  1URQ D;  3W68 A;  2Y9Y A;  3VOP A;  1FBM A;  2IBZ E;  1SQB E;  3H1K G;  2KB7 P;  4NPF X;  1A02 F;  4EPU A;  2WIT A;  1A02 J;  1KQL A;  1H0T A;  1PPJ G;  2KLU A;  1IK7 A;  4ZKU A;  5KLI C;  2K9J A;  1FZG C;  3L37 A;  5AVT B;  3MP7 B;  3GF3 A;  2Q5U A;  5AVZ B;  2Z4E B;  1T6A A;  1H88 A;  3CCR P;  3L74 J;  1EDK A;  1Q7Y Q;  1HH0 A;  1SQV J;  4RES B;  2ZYD A;  5APS A;  3Q5R A;  3ITK A;  2JEE A;  1SQQ E;  4WY4 B;  5AW7 B;  1HVV A;  3CCL P;  3PP5 A;  2D39 A;  5APW A;  1KIL E;  1RE3 C;  1RQV A;  2WQY C;  4W7Z A;  1OZH A;  1FDO A;  2JR8 A;  1EZV G;  3L74 G;  3HUS C;  1LT1 A;  1GK4 A;  3P7K A;  2Q3I A;  1LWU C;  2BCC G;  2FXP A;  1SQV G;  2IFM A;  2WT7 B;  2XNX B;  3CX5 H;  1FZG A;  3NMD A;  1Q90 D;  2M0B A;  1RY3 A;  3TGU E;  5EFW B;  2VRS A;  3M91 A;  1AQT A;  1H0T B;  2J1G A;  2A45 G;  1R5L A;  4XE5 B;  3NXS A;  3H1J E;  2GM4 A;  5AVX B;  2G3A A;  4L73 A;  2RKL A;  2YO2 A;  2QVA A;  2QJK B;  3AE2 C;  3V6I A;  3CXH E;  3CC7 P;  2Y0C A;  2AXC A;  1VQL P;  3RGU A;  4U3F D;  1N7S B;  3VMA A;  1VQ6 P;  5GTI H;  4IFD K;  1SQB J;  2H43 C;  1DX7 A;  5BU8 B;  1BCC E;  3V4W A;  3MGN A;  4OGQ C;  5AVW B;  1L0N J;  1UII A;  3I5C A;  1L0L K;  2FYU E;  5KJ7 A;  5CCG A;  2Z5I A;  1Z3U A;  1NTM K;  4JYO X;  5KLI B;  2JHM F;  3F5H A;  3IFM A;  3II6 A;  1OX3 A;  4M7H A;  1FZB C;  2YMK A;  1FZG B;  1GMJ A;  3H1K D;  2WSC H;  1FJP A;  5AW0 B;  1CI6 B;  1SQB G;  2G8Y A;  3S1K A;  2ZAE B;  1PPJ D;  3L70 J;  1E5W A;  1NJI Q;  2JDI H;  1L0N G;  1E79 H;  4H0L C;  3RK2 D;  1ZR4 A;  1MKM A;  4KT0 J;  1NTZ K;  1ZV8 A;  1LJ2 A;  2HOD C;  1IFN A;  5CCH D;  2HYN A;  1JUN A;  1NU1 K;  1W5C E;  4HJG H;  1H8A A;  5KAF H;  1Y8A A;  3HD7 D;  1RE3 B;  2QIW A;  1JCD A;  2E75 D;  2E5Y A;  4GIF A;  3HUS B;  3U1A A;  2ZT9 C;  1QEX A;  1LWU B;  3L70 G;  1LTJ C;  3HE5 A;  3CCE P;  2AEJ A;  2O01 N;  1GL2 C;  2H89 C;  4ASW A;  3TF5 A;  1RH5 B;  2QG4 A;  1EZV D;  3L74 D;  3I56 P;  2BCC D;  1L4A D;  1SQV D;  1M7L A;  3NTN A;  4L74 A;  1KMI Z;  2FFD A;  1NTK E;  2FY8 A;  2WSE J;  1PV3 A;  1Q81 Q;  2PP6 A;  2J0Y A;  3G71 P;  3B5N A;  1KIL A;  4PD4 E;  1PFI A;  4EOT A;  2K88 A;  2KXP B;  1VPC A;  2ITA A;  3EFG A;  1AQ5 A;  1FZC C;  1G2C B;  5APT A;  1YQ4 C;  1P84 I;  5L8R J;  1IO4 A;  1BCC J;  1SFC A;  1FZE C;  1VQ5 P;  1JMM A;  1SQP J;  1GL2 A;  1S3J A;  4OGQ B;  2FYU J;  5KLV K;  2YMY A;  3OW2 O;  1AJY A;  5AW8 B;  1M1J C;  1CZQ A;  2O1K A;  1JY2 O;  3SWF A;  5K5G B;  1FZB B;  4L76 A;  1KYO E;  3CCJ P;  2IZ1 A;  2IDB A;  1BE3 E;  4H13 D;  2WMM A;  1BCC G;  2WPQ A;  1QL2 A;  1KB9 H;  3KPE A;  3AEC C;  3RK3 C;  3BVH A;  3WU2 H;  2H7H A;  2FYU G;  4H0L B;  2AXT E;  4U7J A;  1S4X A;  1FDM A;  1QL1 A;  2IZ0 A;  1ZP0 C;  5B5E H;  1FID A;  1URQ C;  3FXE A;  2HOD B;  2C0W A;  2IBZ D;  1SQB D;  4AUW A;  3SSU A;  1OFC X;  3FGA D;  3BCC E;  4ZMD A;  3SFE C;  2FBW C;  2LXB A;  4IL6 E;  1L0N D;  2H8P D;  4LC1 A;  3VN0 A;  1U7M A;  1AVY A;  2ZT9 B;  1LTJ B;  2O1J A;  1GL2 B;  3O6Q A;  3V2Q A;  2WPS A;  2N9B A;  2J0G A;  3E7K A;  1PGJ A;  1EDI A;  1YTZ T;  2NZ2 A;  3HTK B;  1YYC A;  2WTY A;  3VYI A;  1ZRT E;  2Q6Q A;  3V2P A;  1S9K E;  4H44 D;  2Q3E A;  5AW6 B;  2W27 A;  2IX7 C;  1SQX K;  3GW6 A;  2YKP A;  4IFF A;  2JHH C;  2Q9I C;  1DD4 A;  4UB8 H;  1FZC B;  2UWJ E;  3S9O A;  2XDJ A;  1NTM E;  2J3G A;  3M0A A;  3Q5S A;  2PAJ A;  1FZE B;  1U57 A;  3JCU E;  1W2E A;  3CMA P;  1LT9 C;  3VP9 A;  1YHQ P;  3TGU D;  2Z5H A;  4I2L C;  1Y9B A;  2ZXE B;  3RL0 D;  4N3Y B;  3BAS A;  3CL3 D;  1M1J B;  2N1T A;  2KS1 A;  1RF0 C;  1MV8 A;  2YKQ A;  3V4Q A;  1BE3 J;  4R4M A;  1Q82 Q;  1IFP A;  2OQQ A;  1RE4 C;  5DJT B;  2L91 A;  3WUU A;  2OYI C;  2OTK E;  1VQO P;  2QJP C;  1SS1 A;  1LTA C;  1KZU B;  3RK3 B;  3NFQ A;  4EIJ A;  5AVU B;  1ZN5 A;  3FXD A;  2B89 A;  1URQ B;  1BSH A;  3LIE A;  1FE6 A;  2R3S A;  3AEE C;  2Z4E A;  1BCC D;  3M9H A;  3BCC J;  1FOS E;  4TT3 H;  3IR9 A;  1OVU A;  1LNQ A;  1BE3 G;  1BGY E;  2YIU C;  2FYU D;  2HPC C;  2C9N Y;  2BEZ F;  3D70 A;  3GF7 A;  3OJA B;  2A06 G;  4WY4 A;  4DCK A;  4GDO A;  3PTZ A;  1PZQ A;  1HJB A;  3A2A A;  1VQK P;  1VDF A;  2D2C D;  3CC4 P;  5AVS B;  2YO3 A;  3AE6 C;  3PLN A;  3BCC G;  1T2K D;  1OXZ A;  3Q3D A;  2XNX A;  2WT7 A;  2HG5 D;  3O8Z A;  2J3F A;  5CCH C;  1KQF B;  4NYT A;  4L75 A;  3SWY A;  1JTH B;  2WSF H;  2Q9I B;  2N9Y B;  4O9B A;  3HD7 C;  3H25 A;  5KLV E;  3TYY A;  1USD A;  2E75 C;  5APV A;  2P67 A;  2W6J H;  2HLO C;  1AA0 A;  3GHG C;  2KUB A;  1LTS C;  3M0D A;  1IJD B;  2BCC J;  1LT9 B;  1GW3 A;  3MUD A;  5H2F H;  5E79 E;  3F89 A;  2NPS D;  1FZA C;  3CI9 A;  1KC8 Q;  1N7S A;  1GU4 A;  2W6A A;  1JB0 J;  1L4A C;  1EZV I;  1RF0 B;  3CCV P;  3CX5 E;  1PGP A;  3CWB J;  5AVV B;  1OWA A;  3KZI H;  1DD3 A;  1RE4 B;  1U7J A;  2OYI B;  2LXC B;  3AED C;  2KK7 A;  1KV4 A;  2QJP B;  1VL2 A;  2R3C A;  4K3A A;  2PFX A;  1JCC A;  1N73 C;  1MUU A;  2A45 I;  4A7P A;  4W80 A;  2FIB A;  1J1E C;  2OYH C;  1WRG A;  1CI6 A;  3H6P A;  1GDT A;  3N7N A;  1VF5 D;  4HH2 A;  3CWB G;  4LLH A;  1KQS O;  4R9T A;  2R44 A;  2YIU B;  3PH0 A;  2HPC B;  2KI7 B;  1GZL A;  3H1L E;  2J58 A;  1KYO D;  1YIJ P;  3AEA C;  1BE3 D;  1AV1 A;  4H13 C;  1FZD A;  2LR2 A;  1RE3 A;  1G1I A;  3SWK A;  1SQX E;  1QGK B;  2K37 A;  2FXO A;  1YJ9 P;  3HUS A;  2WSS H;  1LWU A;  3TK1 A;  2A06 D;  2W6B A;  3BRT B;  5AW5 B;  2PGD A;  3EWK A;  2LKM A;  2WNP F;  2IBZ I;  2WSE H;  3BCC D;  1LP1 B;  1P84 H;  2JHI F;  5BU5 A;  3HD7 B;  2WZ7 A;  1WT6 A;  2J64 A;  3VTP C;  5M1B A;  5AW1 B;  5CHX A;  2E75 B;  1X22 A;  2HLO B;  4WBA A;  2IBZ G;  1ZLL A;  3C1L A;  3GHG B;  4N78 E;  5KAF E;  2NRG A;  3C9I A;  1MFZ A;  1K9M Q;  1FZA B;  3H1I E;  3P8C E;  1CW5 A;  2P2U A;  1SQQ J;  1NAF A;  1G2C A;  1LGH B;  5APY A;  1Y47 A;  3GG2 A;  1SQV K;  3M06 A;  2E74 D;  1M57 D;  2OAR A;  3RK3 E;  4D6T E;  1L4A B;  3M9B A;  3VMY A;  2H43 A;  1VQP P;  1S9K D;  4H44 C;  1T8Z A;  1QLE D;  3CCM P;  1HGV A;  3R2P A;  1N73 B;  4OWF A;  3TGU J;  1BDD A;  1SQQ G;  1FZB A;  2H88 C;  4BRY B;  1NHL A;  1NGM B;  1J1E B;  1EDL A;  2OYH B;  4IOI H;  4WVZ A;  5KTB A;  3H1J J;  1GW4 A;  3RL0 C;  1JM0 A;  3L35 A;  2V7Q J;  2J2P A;  1JOC A;  3H1L J;  3AEG C;  4ZNC A;  2GY7 A;  4YXW H;  3E1I C;  2HOD A;  4UB6 E;  1BSN A;  4YPC A;  5TJH A;  3TGU G;  2AEF A;  4I7Z C;  2J0H A;  1R8E A;  3CWB D;  3MZW B;  1KOR A;  4H13 B;  3AE9 C;  3H1H E;  4EYY Q;  2KZI A;  4HKZ H;  5AVY B;  2OGU A;  5AW4 B;  3H1J G;  3ZDM A;  4OH8 B;  4PV1 D;  2H43 B;  2XZR A;  2J3U A;  1RF1 C;  2WSC J;  2KP8 A;  1LTJ A;  5APQ A;  1LTI C;  1SQB K;  2IYP A;  3A5T A;  3H1L G;  1JNM A;  1JC9 A;  1KB9 E;  1L0N K;  1S72 P;  5C39 A;  5KJ7 D;  3HTK A;  5CCG D;  4TLF A;  1VQ4 P;  2W90 A;  2HFE D;  3MD0 A;  3OA7 A;  1X8Y A;  3L73 E;  1TU3 F;  2JJL A;  5TIS H;  1HJ0 A;  2D2C C;  3CME P;  3TNU B;  2FKW B;  3BRV B;  1OVV A;  1YQ3 C;  3FIB A;  1FZC A;  3VMZ A;  4C7R A;  1DEB A;  3M9Q A;  2MJZ A;  1T2K C;  4U3F E;  3L71 E;  1YTZ I;  1FZE A;  3KHU A;  4H44 B;  1OW7 A;  2POH A;  3R4Y A;  4DJG A;  1X0T A;  3LID A;  1IK9 A;  1M1J A;  2M5A B;  5AW2 B;  1SVF A;  2OTL P;  2KOG A;  2ZXX A;  1EQ7 A;  4N6J A;  1VQ9 P;  4M7F A;  2GUS A;  1NAY A;  3JSV C;  3H1K E;  3T97 B;  1JO5 A;  3B71 A;  1N86 C;  2AEM A;  2NPS C;  4ZFG A;  2ZJS E;  3RL0 B;  1NTK J;  2O01 J;  4UB8 E;  1NO4 A;  2PRR A;  3G9R A;  1PPJ E;  2E76 D;  1SQQ D;  2Q7C A;  1ZOY C;  2JO1 A;  2ZVO B;  3E1I B;  1URQ A;  2E42 A;  1OIP A;  3B5N D;  1KIL D;  4I7Z B;  1NYH A;  4OVN F;  1YI2 P;  3H1H J;  1DEE G;  1L0L E;  1JEK A;  1S2E A;  4PD4 I;  1S5L H;  4ASV A;  3TSI A;  1L2P A;  1LTT C;  3IAO A;  1VQ8 P;  1NTK G;  1RF1 B;  1SFC D;  2ZT9 D;  4JYB A;  5AVR B;  1AVO A;  2B87 B;  2W8Z A;  1YJN P;  3PRJ A;  1GL2 D;  1SQP K;  1FIC A; 
#chains in the Genus database with same CATH homology
 1MZ9 A;  3II6 A;  3HE4 B;  1FIB A;  4M7H A;  1LTS C;  3M0D A;  1FZB C;  1FZG B;  1IJD B;  2FYU K;  4C7N B;  1LT9 B;  1GW3 A;  3MUD A;  4KHX A;  2WSC H;  2NPS D;  3E1I A;  1J2J B;  1IFM A;  1FJP A;  3CI9 A;  1FZA C;  1FZF C;  5AW0 B;  3H32 C;  3HE5 B;  1CI6 B;  1N7S A;  3A7O A;  1GU4 A;  1IFD A;  1JY2 P;  2W6A A;  4R9J A;  1X79 B;  3HRN A;  3P8M C;  1E5W A;  4HYT B;  1L4A C;  2BAS A;  1NOH A;  3RK2 D;  1ZR4 A;  1RF0 B;  1HBW A;  1T3J A;  1NTZ K;  1ZV8 A;  5AVV B;  1OWA A;  4DOJ A;  1JTH A;  1SQQ K;  2Q9I A;  2R5B A;  1RE4 B;  2HOD C;  1IFN A;  5CCH D;  1RF1 A;  2HYN A;  1JUN A;  2OYI B;  1NU1 K;  3G3Z A;  2FFD B;  1H8A A;  1ZR2 A;  4AQR D;  2R3C A;  1KFN A;  3HD7 D;  1RE3 B;  1NH4 A;  3B5N B;  1KIL B;  1JCC A;  1N73 C;  1GD2 E;  1MUU A;  3KDP B;  2A45 I;  2FXM A;  3HE4 A;  1JCD A;  4C7N A;  1LT9 A;  4GIF A;  3P32 A;  4W80 A;  3HUS B;  1J1D C;  2FIB A;  3U1A A;  2IPP A;  1LWU B;  2M3B A;  2KLV A;  1J1E C;  2OYH C;  1LTJ C;  1WRG A;  3HE5 A;  5APU A;  1CI6 A;  4GKG A;  3H6P A;  1GL2 C;  2A45 H;  1GDT A;  3N7N A;  1XTG B;  4HH2 A;  4LLH A;  4R9T A;  4Y99 B;  1SFC B;  1JY2 N;  3B8E B;  2HPC B;  1RF0 A;  1GZL A;  3VMX A;  3MIW A;  1T3U A;  1JY3 O;  1RE4 A;  1L4A D;  2J58 A;  3WMM 0;  4B86 A;  3LW5 H;  1M7L A;  2QM8 A;  3NTN A;  2OYI A;  1N86 B;  1HGZ A;  2FFD A;  2J5Z A;  2JHL F;  3U59 A;  2NPS B;  3RK2 C;  3CLQ A;  3P8C D;  1FZD A;  2J0Y A;  2PP6 A;  2N1T C;  1NWQ A;  1RE3 A;  1G1I A;  3B5N A;  1KIL A;  1PFI A;  4JYC A;  2QM7 A;  4EOT A;  1GU5 A;  3HUS A;  1VPC A;  3EFG A;  1LWU A;  1AQ5 A;  3TK1 A;  2W6B A;  1FZC C;  1G2C B;  3BRT B;  5APT A;  5AW5 B;  3A3Y B;  5AW3 B;  1IO4 A;  3OAK A;  3BVH B;  1SFC A;  2I1K A;  2WWW A;  1FZE C;  2LKM A;  2HPC A;  1JMM A;  2P1J A;  2WNP F;  1X9V A;  2WSE H;  5APX A;  2M8R A;  1GL2 A;  5BU5 A;  2JHI F;  3HD7 B;  2WZ7 A;  2Z4E C;  1WT6 A;  2J64 A;  3VTP C;  5KLV K;  2YMY A;  5AW1 B;  5CJ0 A;  5AW8 B;  2ZFC A;  4I6M C;  5CHX A;  1N86 A;  1IFI A;  1M1J C;  2CPS A;  2NPS A;  1CZQ A;  2O1K A;  1XTC C;  2CPB A;  1JY2 O;  2HLO B;  4WBA A;  1ZLL A;  3SWF A;  2J3O A;  2J59 M;  3GHG B;  4N78 E;  2J61 B;  4AYC A;  1FZB B;  3C9I A;  1IC2 A;  1MFZ A;  1FZA B;  1FZF B;  3H32 B;  3P8C E;  1CW5 A;  4WY4 C;  2P2U A;  1NAF A;  1G2C A;  2N1T D;  2WPQ A;  1GTW A;  1LGH B;  5APY A;  1CSB A;  1SQV K;  1QL2 A;  3M06 A;  3KPE A;  2OAR A;  1L4A B;  5CCH A;  3RK3 C;  3BVH A;  2XU6 A;  2H7H A;  3M9B A;  3VMY A;  2H43 A;  1S9K D;  1FDM A;  1T8Z A;  1QL1 A;  5AW9 B;  4M3L A;  1FID A;  3HD7 A;  1URQ C;  2HOD B;  5CJ4 A;  3V5B A;  2C0W A;  2XNX C;  4AUW A;  1FOS F;  1NKN A;  2WPR A;  1FAV A;  1HGV A;  2FYZ A;  2HLO A;  3R2P A;  1NKZ B;  1N73 B;  3GHG A;  3MTU E;  2H8P D;  2J61 A;  4LC1 A;  3VN0 A;  1FZB A;  4WB4 A;  1NHL A;  1J1D B;  1FZA A;  1HUC A;  1FU1 A;  1H89 A;  1FZF A;  3H32 A;  1J1E B;  3VP8 A;  2L5G B;  2OYH B;  1LTJ B;  4I1L A;  1SLQ A;  2O1J A;  2R32 A;  3EQ2 A;  1GL2 B;  5KJ7 C;  5KTB A;  5CCG C;  3KYQ A;  4N78 D;  1GW4 A;  3RL0 C;  2WPS A;  3V2Q A;  1L4A A;  4ZKP A;  2N9B A;  3L35 A;  2I1J A;  2J0G A;  2J2P A;  4WY4 D;  3M0D C;  1JOC A;  3BAT A;  1YTZ T;  3HTK B;  2GY7 A;  3E1I C;  1YYC A;  2HOD A;  3RK3 D;  2WTY A;  3VYI A;  1N7S C;  1DH3 A;  3V2P A;  1NTK K;  2KSJ A;  3L36 A;  1IFJ A;  2J0H A;  1S9K E;  1JY3 P;  3RK2 B;  5AW6 B;  2JHK F;  2W27 A;  1LTB C;  2N1T B;  2IX7 C;  1SQX K;  1URQ D;  2E43 A;  3VOP A;  4IFF A;  2YKP A;  1N73 A;  2JHH C;  1FBM A;  4XA4 A;  5AVY B;  5AW4 B;  2KB7 P;  2Q9I C;  1Z3S A;  2GUV A;  4OH8 B;  2H43 B;  1Z56 A;  2XZR A;  2J3F D;  2C0X A;  2J3U A;  1FZC B;  1A02 F;  2WIT A;  1RF1 C;  5APQ A;  2KP8 A;  1LTJ A;  2OYH A;  4JZC A;  4EPU A;  1GK6 A;  1A02 J;  1KQL A;  1LTI C;  1SQB K;  2XDJ A;  2YNY A;  3A5T A;  4ZKU A;  2J3G A;  2KYV A;  3M0A A;  1FZE B;  2PAJ A;  1JNM A;  1JC9 A;  2YKO A;  1W2E A;  1L0N K;  1FZG C;  3L37 A;  3UIA A;  5AVT B;  1LT9 C;  5KJ7 D;  3VP9 A;  3HTK A;  2Z5H A;  1FJK A;  2Q5U A;  4I2L C;  5CCG D;  5AVZ B;  2Z4E B;  3L4F A;  2ZXE B;  3RL0 D;  4N3Y B;  1AFO A;  1H88 A;  2J60 A;  3BAS A;  3CL3 D;  1M1J B;  2HFE D;  1HH0 A;  4RES B;  2N1T A;  3MD0 A;  3OA7 A;  5APS A;  1X8Y A;  1RF0 C;  1MV8 A;  1JY3 N;  2YKQ A;  3V4Q A;  1N7S D;  2JJL A;  3N4X A;  2JEE A;  5AVQ B;  3TNU B;  2FKW B;  3BRV B;  1RE4 C;  4WY4 B;  5AW7 B;  3FIB A;  1FZC A;  1HVV A;  3VMZ A;  4C7R A;  1DEB A;  4IFM A;  2OYI C;  2XV5 A;  2FFD C;  3PP5 A;  3M9Q A;  2MJZ A;  1T2K C;  2D39 A;  5APW A;  1LTA C;  1LTG C;  1KZU B;  3RK3 B;  1YTZ I;  1FZE A;  1RE3 C;  4W7Y A;  3B5N C;  3NFQ A;  1KIL C;  4EIJ A;  5AVU B;  3V2N A;  1ZN5 A;  4W7Z A;  2POH A;  3HUS C;  5CMZ A;  1URQ B;  1GK4 A;  3LIE A;  3P7K A;  2Q3I A;  1LWU C;  2Z4E A;  2IFM A;  4DZO A;  1N2D C;  3LID A;  3M9H A;  2WT7 B;  2XNX B;  1FOS E;  3IR9 A;  1IK9 A;  1M1J A;  5AW2 B;  1SVF A;  1N7L A;  1FZG A;  3NMD A;  2KOG A;  1RY3 A;  4Y99 C;  1HWT C;  1SFC C;  2VRS A;  4JF7 A;  2R5D A;  2HPC C;  1EQ7 A;  3M91 A;  4N6J A;  2J1G A;  2C9N Y;  1KFM A;  4M7F A;  2GUS A;  3TNU A;  4GT1 A;  3OJA B;  2A45 G;  4WY4 A;  4XE5 B;  3NXS A;  1JO5 A;  1N86 C;  2GM4 A;  5AVX B;  1HJB A;  3A2A A;  4LGD E;  2NPS C;  1VDF A;  4ZFG A;  3RL0 B;  1NO4 A;  2YO2 A;  2C9L Y;  5AVS B;  2YO3 A;  4C46 A;  2Q7C A;  3KQG A;  3E1I B;  1T2K D;  1OXZ A;  1URQ A;  2E42 A;  1N7S B;  3V2R A;  2XNX A;  3B5N D;  2WT7 A;  1KIL D;  1HTL C;  2HG5 D;  1SP4 A;  3U1C A;  3O8Z A;  2J3F A;  2P7J A;  5CCH C;  4IFD K;  3BVH C;  4NYT A;  2H43 C;  1DX7 A;  5BU8 B;  3SWY A;  3TSI A;  1G1J A;  1JTH B;  2WSF H;  3MGN A;  3V4W A;  2Q9I B;  1LTT C;  2O01 H;  4O9B A;  5AVW B;  3HD7 C;  3I5C A;  2IFN A;  1RF1 B;  1SFC D;  3TYY A;  1L0L K;  3T97 A;  4JYB A;  5AVR B;  5BVZ A;  5KJ7 A;  5CCG A;  2Z5I A;  5APV A;  2P67 A;  1Z3U A;  1NTM K;  4JYO X;  1GL2 D;  2HLO C;  1SQP K;  2JHM F;  1FIC A;  3GHG C;  3IFM A;  2XKM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...