1N73C

Fibrin d-dimer, lamprey complexed with the peptide ligand: gly-his-arg-pro-amide
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
322
structure length
322
Chain Sequence
KTVQKILEEVRILEQIGVSHDAQIQELSEMWRVNQQFVTRLQQQLVDIRQTCSRSCQDTTANKISPITGKDCQQVVDNGGKDSGLYYIKPLKAKQPFLVFCEIENGNGWTVIQHRHDGSVNFTRDWVSYREGFGYLAPTLTTEFWLGNEKIHLLTGQQAYRLRIDLTDWENTHRYADYGHFKLTPESDEYRLFYSMYLDGDAGNAFDGFDFGDDPQDKFYTTHLGMLFSTPERDNDKYEGSCAEQDGSGWWMNRCHAGHLNGKYYFGGNYRKTDVEFPYDDGIIWATWHDRWYSLKMTTMKLLPMGRDLSGHGGQQQSKGNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibrin alpha-1 chain
publication title The Crystal structure of fragment double-D from cross-linked lamprey fibrin reveals isopeptide linkages across an unexpected D-D interface
pubmed doi rcsb
molecule tags Blood clotting
total genus 92
structure length 322
sequence length 322
chains with identical sequence F
ec nomenclature
pdb deposition date 2002-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1n73C03
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 1n73C01
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 1n73C02
2J3GA 3H32B 2GY7A 2J0GA 1T3UA 2XNXC 1FZCC 4ZFGA 1FZAC 3H32A 2Q9IB 4R9TA 3E1IB 1FZCB 2J3FA 1FZEC 3BVHC 2J3FD 2HPCC 1FZFC 2OYIC 1JC9A 2J3UA 2JHHC 1LTJC 2Q9IA 1FZGC 3E1IA 2XNXA 3BVHB 1FZCA 2HPCB 2J5ZA 1FZFB 1JY2P 1LTJB 4JZCA 3H32C 1FZBC 1FZEA 3BVHA 2H43C 1FZFA 2HPCA 1M1JB 1FZDA 3HUSB 1LTJA 2J2PA 1Z3UA 2A45G 1RE3C 1FICA 2WNPF 2J60A 1M1JA 3HUSA 1N86C 1RE3B 1RF1C 2JHMF 3FIBA 4M7HA 1JY3P 2HODC 2XNXB 1N86B 1RF1B 1FZAB 1RE3A 2HODB 1FZEB 1FIBA 1N86A 2JHIF 1N73C 2Z4EC 1RF1A 1FZAA 3GHGC 2OYIB 2HODA 1LT9C 1FZGB 1N73B 2FIBA 2OYIA 2JHKF 1FZGA 1FZBB 2H43B 1N73A 1LWUC 4R9JA 2FFDC 1FZBA 2H43A 1LWUB 2D39A 4EPUA 2J64A 1JY2N 1RF0C 4NYTA 4JYOX 1LWUA 1RF0B 2J61B 2J0HA 1W2EA 1RE4C 1RF0A 2J61A 2Z4EB 2HLOC 3GHGB 1RE4B 1FIDA 4M7FA 2A45H 2Q9IC 1LT9B 2A45I 3E1IC 1JY3O 1JY3N 1Z3SA 2HLOB 2Z4EA 3GHGA 1RE4A 1LT9A 2OYHC 2HLOA 2J1GA 1JY2O 2FFDB 2J3OA 2OYHB 1M1JC 2J0YA 3HUSC 2FFDA 2OYHA 2JHLF
chains in the Genus database with same CATH superfamily
1SQVG 3LIEA 3JSVC 1NTZG 1JMMA 1G1JA 2Q9IB 1KZUB 5AVVB 1FE6A 2M5AA 1VPCA 4WY4D 1FBMA 5KTBA 2I1JA 4OWFA 5KAFE 1M1JB 1N8RQ 2ZFCA 1MZ9A 3L73D 3L72D 1NH4A 3C8VA 2BCCD 1NTKG 1LTIC 2PFXA 2XV5A 3TGUD 3MIWA 5TISE 1SS1A 1YTZI 4WY4A 3AE2C 2XZRA 2E43A 3AEGC 2OYIA 4ASVA 3CPWO 1N2DC 4EPUA 2E75C 2XKMA 3L71J 3VMYA 1X79B 3CX5H 5CJ0A 4NPDA 2KK7A 2M0BA 1KB9D 5B5EH 1HGVA 1ZV8A 4H0LB 5APYA 5H2FH 3TSIA 3PHLA 2H89C 1L0NJ 3AE7C 2K88A 2J3OA 3SSUA 1S5LH 1H8AA 1NU1E 3A0BH 3CWBJ 3LW5H 5TJHA 5K5GB 1NTME 1NTMD 4RKUJ 3IFMA 2J0GA 1SQPE 1CZQA 5CBNA 3V4WA 2PRRA 4GOEA 4WY4C 1FZCB 2FYUG 2J3FA 4R4MA 1YYCA 2OYIC 3OAKA 3PLNA 3H1LD 2YIUC 3B5ND 3G9RA 2XNXA 2J5ZA 1JY2P 3G3ZA 1LTJB 3RK2B 5APVA 2QJYB 3CCJP 5AVWB 2KNCA 3HD7D 1LP1A 2KLUA 1VF5D 2W6JH 1BE3D 2W83C 3WU2E 1RF1B 1RE3A 3CXHH 3B5NA 3L73J 1N86A 3L72J 3WUTA 1UIIA 3C9IA 5DJTB 2P10A 1S2EA 3PJSK 1N7SB 1Y47A 1N7LA 2BCCJ 1H89A 2R5BA 1A02J 3HD7A 1QL1A 2O1KA 3TGUJ 4I7ZB 1IO4A 2QRXA 3NFQA 2POHA 2JWDA 4O9BA 3CCVP 5KAFH 3L4FA 4EYYQ 3SWFA 3CMAP 2G3AA 1W2EA 1K05A 2R3CA 1GU4A 4ZNCA 3O8ZA 2O01J 2OTKE 4WBAA 3HRNA 1FAVA 1AQ5A 2JP3A 5TISH 1H0TA 5E79E 2E5TA 1L4AC 3TNUB 3M9BA 3B5NC 2YKQA 2LR2A 2FXMA 3HE5B 4C46A 2QM7A 3H32A 2O01H 1HBWA 1KTMA 2RMZA 4GIFA 1JTHB 1SQBG 1NTMJ 1ZLLA 4KHXA 5AVRB 3HD7C 2ZYAA 3MD0A 4JYBA 2HPCA 1DEEG 3L75E 3L75D 2IFNA 3RL0D 3H1LJ 1PV3A 1YJWP 3BCCG 5GTHE 1SQXG 1JY3P 1M90Q 1PP9G 2ZYDA 3L35A 1VQOP 3B71A 2HODB 3GMAA 1N73C 1S72P 3O6QB 1X22A 2PGDA 1R5LA 2P2UA 4JQ0D 3RBXA 3H6PA 2JKVA 1NAFA 3CCEP 3KDPB 3VMAA 1LJ2A 1ZOYC 1NJIQ 3H25A 1VQ6P 2A06E 2A06D 4PJ0E 3V2RA 3WU2H 3EFGA 2IYPA 3I5CA 1YTZT 2Q7CA 2PP6A 1JCDA 3V2NA 2AEMA 3H1JE 1R5SA 3IAOA 1BCCE 2YO2A 2QIWA 4HKZH 2G8YA 3D70A 2M5AB 2CPSA 3RK3E 3FXEA 1K04A 3RL0C 4Z1MH 2Z5IA 3TF5A 1FZEA 1MKMA 1YBKA 3E7KA 1Q90D 3IN6A 1QX8A 3CD6P 1NU1K 5E79H 1DD3A 4WY4B 3L75J 1GU5A 2OYIB 1AJYA 1SQPK 1QVGO 1X8YA 1H88A 3GF3A 1BGYE 1BGYD 1HF9A 1VQNP 1JO5A 3P8CD 3MHVA 3FX0A 2Q3IA 2N1TD 2KB7P 1SQQG 1XTGB 2J61A 4H0LC 3U59A 1VQMP 3TK1A 5GTHH 3UIAA 1YI2P 1VQ4P 2KP8A 3AE4C 1AQTA 1JUNA 2WPVB 1OVUA 1PPJD 2N1TA 3L73G 3L72G 2JHLF 1VQ7P 2C0WA 1GL2D 3E1RA 2GY7A 2IBZD 2Q5UA 2IYOA 1FZCC 1EDIA 3TGUG 3H1JJ 1JC9A 3PH0A 1W2BO 1LTJC 3RK2C 1KD1Q 2QE7H 1SLQA 1BCCJ 1SQVK 2QJYC 2KNCB 5KKZC 4PJ0H 1LP1B 2J2PA 1GL2A 1LNQA 2M3EA 1EZVD 1RE3B 1RF1C 2JHMF 3B5NB 3V2QA 4DJGA 1N86B 1A02F 3H1KE 3A0HE 2DW3A 3CX5D 3M0DA 3HD7B 1YQ3C 3H1HG 1VF5B 2BEZF 5B5EE 3R4YA 2V7QH 1JMBA 4BRYA 1SFCD 2O01N 2R44A 3N4XA 1OIPA 1BGYJ 1MUUA 1KQLA 5KAIE 3Q5PA 2B89A 1USDA 1EDKA 2A45I 3WUUA 2QJPC 5AW6B 3H1LG 1T8ZA 2KOGA 4YXWH 1H0TB 4DT0A 3NTNA 5AVUB 1SFCA 4IOIH 2L5GB 2E5YA 3H32B 3SWKA 1BE3G 1VQKP 1HGZA 3CWBD 3M0DC 2GM4A 1KV4A 2HPCB 2YMYA 3EQ2A 4BWNA 2Y0DA 4H44D 1FICA 1FDOA 2LKMA 1IZNB 1KFNA 5M1BA 2HODC 2UWJE 4ASWA 1KYOE 4D6TE 1KYOD 3L70E 3PP5A 1BDDA 2QA4P 4TT3H 1FIBA 3LIDA 1FZAA 1G1IA 4ZKUA 1QLED 2AXTE 3RL0B 2H8PD 3EWKA 1ZW0A 2BASA 1SFCC 1NO4A 1LGHB 1ZRTE 1ZRTD 4WB4A 3CLQA 2JO1A 2WSCH 2QM8A 1KC8Q 4M3LA 3BASA 2KZIA 1CSBA 1GK6A 3HTKA 1USEA 1OX3A 3U1CA 2QEXP 1L0LG 1OW6A 3V2PA 5C39A 4H13D 2FYNB 3D71A 1HH0A 3A0HH 1G2CA 4U3FG 2QSIA 4DZOA 2WMMA 1KFMA 1IFPA 1NAYA 3LW5J 4ZMDA 5AW1B 4ZFGA 1FZAC 2R32A 2WPSA 3Q3DA 2J3FD 4H44C 5KAIH 4YTPC 3M91A 3L74E 3L74D 3MUDA 1FZFA 1NU1D 1YHQP 1AVYA 4N3YB 1ZR4A 3AEDC 2VRSA 1P84I 1SQPD 3H1IG 1FOSF 1PGQA 3D6YA 3G71P 1OZHA 1VL2A 1IFJA 4C7NA 5KKZB 4D6TJ 3L70J 2WPRA 3CCUP 3KXDA 1JY2N 5APSA 5KLVD 5KLVE 3GG2A 2J61B 4H13C 3V6IA 1FIDA 2A45H 2ZVNB 2K3RA 4Y28J 1RE4A 4RJTA 1S4XA 1KYOH 1LT9A 4MN4C 1HUCA 2HLOA 1GW4A 2N1TB 1GMJA 2BEQD 2AXTH 1NHLA 2J0YA 1NOHA 1S1CX 5L8RJ 1EXIA 3AE1C 3VP8A 4DOJA 2SPZA 4K3AA 1T3UA 2XNXC 5BU8B 4YPCA 1SQVE 1SQVD 4R9TA 1NTZE 2QJPB 5AW4B 3HE4B 3P32A 2OTLP 4JBZA 2IFMA 1K73Q 1GL2B 2D2CD 3VMXA 1RE3C 3FGAD 1NGMB 4IFDK 2AXCA 2RKLA 1N86C 1IFDA 4M7HA 2OGUA 3L74J 1KQSO 1NU1J 2YKOA 1NYHA 1FS0E 1NTKE 3KYQA 3P7KA 1LT9C 5AVYB 1SQPJ 1VF5C 2WVRA 5APXA 1OXZA 3W67A 2K37A 4BRYB 1PPJG 3CCSP 1Q82Q 4XE5B 2O3JA 2H88C 2IBZG 1M8OB 1PIXA 3WUVA 2IX7C 2P7JA 2W6BA 5KLVJ 2ZJSE 1JY3N 1NVOA 2Z4EA 3KHUA 4JYCA 1IFMA 1SFCB 5CCHD 3M06A 2K9YA 1Y9BA 1AA0A 2R3SA 1EZVG 3H32C 3KZIE 2QJKB 1GZLA 1ZN5A 1MV8A 3V4QA 4L75A 2HPCC 5CCHA 2D2CC 2J3UA 3H1IE 1NWQA 2FYUE 2N9YB 3FXDA 2B88A 1SQVJ 3BVHA 4OGQD 3H1JD 1NTZJ 1OW8A 3VP9A 4WVZA 4W80A 1BCCD 3VYIA 2RN0A 1FZAB 1DEBA 2KLVA 3RK3D 5AVXB 3L71G 3CI9A 4H44B 2Z4EC 3M9QA 1YITP 4GOFA 5APWA 5DJUB 3RL0g 4DCKA 1U57A 1KILE 1KILD 4EOTA 1K9MQ 3TYYA 2K1AA 1NTKJ 3MTUE 5CCGD 3CC7P 2NRGA 2J64A 1L0NG 1IK9A 2I1KA 3HTKB 2PAJA 3CCLP 1RF0A 3M9HA 4HYTB 2FYNC 3CWBG 3AE3C 4B86A 1G2CB 1KILA 4IL6X 5CCGA 2J1GA 1X0TA 1QEXA 2YO3A 2WWWA 4I1LA 4LC1A 1XTCC 1VQ8P 1KQGB 4H13B 2ZXXA 5KLVK 4JF7A 2FY8A 1J1DB 3MZWB 1FZEC 4I2LC 4OGQC 2JHHC 3E1IA 1FZFB 4UB6E 4PV1B 2KXPB 4IFFA 1SQBE 1DX7A 3GW6A 2IZ1A 1Z3UA 2Y9YA 5AW2B 4KJMA 3RK3C 2BCCG 1URQD 3WMM0 2H7HA 2M8RA 2P58A 2W8ZA 1YIJP 2XNXB 4LGDE 1FJPA 4IFMA 1DD4A 3BCCE 3BCCD 1T3JA 5CMZA 1SQXE 3KZIH 1PP9E 1PP9D 4C7NB 4NPFX 4OH8B 1IC2A 1NTZK 1GTWA 2JHKF 1QGKB 1RY3A 1URQA 4HH2A 2V7QJ 2YNYA 1FZBA 2H43A 1AVOA 1OVRA 3BATA 4PD4I 5KLIB 3H1KD 1YJNP 1WRGA 2MKVA 1LWUA 1KMIZ 3CC2P 1J1EB 5AW8B 2J5UA 1RE4B 5BVZA 1LT9B 3E1IC 2E74D 2HLOB 3ZDMA 2N1TC 2WSSH 1JNMA 1NTKK 3S1KA 1CI6A 4AQRD 1OMIA 1NTMG 1L0LK 2FFDA 2OYHA 1UIXA 2WQYC 1SQPG 1ZR2A 1OFCX 3T97A 2NPSD 3CXHI 3AECC 2OARA 4PD4E 1GL2C 1M57D 2Y0EA 3KQGA 4U7JA 1FZBC 2H43C 2WSEJ 2MJZA 3L36A 1JEKA 1IK7A 1ZXGA 1Z56A 4L73A 1RQUA 4TLFA 1J2JB 2NPSA 4N6JA 4XA4A 1Q7YQ 2E76D 4Y99B 1RQVA 3AEBC 2ZVOB 2D2CB 1BSNA 3KPEA 2E75D 4OVNF 2XU6A 2KYVA 1KN7A 2WSEH 2Z5HA 1FZGA 4L74A 1MFTA 3BCCJ 2KS1A 1PP9J 2FYUK 2FFDC 3F89A 2WSCJ 4UB6H 1ZP0C 2OQQA 1QL2A 1U7MA 4D6TD 3L70D 5CJ4A 2E74C 3A2AA 2J0HA 1AV1A 1OVVA 2WITA 2Z4EB 3H1KJ 1SQQE 1SQQD 2B9BA 3IR9A 1KB9I 2QJKC 2KUBA 2NPSC 4W7ZA 3BRVB 2JDIH 1FJKA 4XFJA 2J3GA 3L73E 2ITAA 1AFOA 3N7NA 3L72E 1RHZB 1RH5B 2BCCE 5APUA 2Y0CA 1FZGC 3BVHB 3TGUE 3L75G 3JCUE 4A7PA 4PV1D 1DH3A 2E76C 3IF4A 2GUSA 2YMKA 5APQA 5EFWB 3OW2O 1SVFA 1FDIA 1GW3A 1FZEB 4OGQB 1KB9E 2RH0A 2FXPA 1WT6A 3B8EB 1JB0J 1PL5A 3C1LA 3JC22 3H1HE 3H1HD 3V5BA 3RK3B 4PD4H 1SQBK 2KI7B 3P8MC 3W68A 1RF0B 2YXRB 3Q2YA 2HFED 3VMZA 2P67A 2ZT9D 2A06G 4IL6E 3VN0A 2HR3A 3ITKA 1KILB 3FWLA 1LTAC 4N78E 4N78D 2B87A 1K8AQ 2AEJA 1JY3O 1Z3SA 2J58A 3AE9C 2C9NY 5AW7B 2HG5D 1SQXK 1L4AD 4CPGA 2WT7A 3AE6C 2ZYGA 1HJ0A 2N9BA 3H1LE 2C0XA 2K9JA 3H1JG 1SQQJ 1EC5A 1GDTA 1LTBC 3CMEP 2AEFA 3SWYA 1GD2E 1BCCG 1LTTC 1Q2NA 3MGNA 1J1DC 5AW3B 1L4AA 1BE3E 3E1IB 1T6AA 3MUDC 4BXLA 1FZFC 2W90A 4PV1C 1P84E 1P84D 4QMAA 1IFNA 2JWAA 4JZCA 3GLMA 5AVQB 4UB8E 3SFDC 3HUSA 3PRJA 2JEEA 1MFZA 3R2PA 2P1JA 1KORA 1NTZD 1PGOA 3ABVC 4ZKPA 1JM0A 1HTLC 2Y9ZA 3II6A 2R5DA 3MP7B 2JR8A 1BGYG 1URQB 5AW0B 4HJGH 1FZBB 2H43B 1N73A 3QWOC 1S5LX 1JOCA 3TDKA 5KLIC 4RESB 2WTYA 2ZT9C 1S3JA 1LWUB 2ZAEB 3BRTB 3NXSA 3JCUH 1Y8AA 1L2PA 1J1EC 2L91A 1RE4C 1NTKD 3H1HJ 4W7YA 2HLOC 4M7FA 1NKNA 1L0LE 1L0LD 3GHGA 1CI6B 1L0NK 2XNDH 1W5CE 3A7OA 2FFDB 2OYHB 1KB9H 2J59M 3HUSC 2WSFJ 4U3FE 4U3FD 4K35A 5AVZB 2O1JA 3QH9A 2E74B 1R8EA 3T97B 3I56P 2IDBA 2LXBA 1E5WA 3USSA 3G6EP 2KSJA 3Q5RA 2OTJP 5GTIE 3I55P 1FOSE 5AW9B 1KQFB 1JCCA 2Q9IA 4IL6H 1SQQK 1BDCA 4KT0J 3Q1MA 1BE3J 2WSFH 5KJ7D 1FZDA 2NPSB 2FXOA 2WNPF 1X9VA 1M1JA 3H1KG 2GUVA 1EDJA 3FIBA 4AUWA 4Y99C 1OW7A 3AEEC 2M3BA 1VQ9P 5CHXA 1EQ7A 2LXCB 2KIKA 3A3YB 3L37A 3H1ID 1QVFO 3K5BA 1HJBA 2FYUD 3GHGC 2C9LY 1FZGB 5KJ7A 2FIBA 2WPQA 2KS1B 1FU1A 4GDOA 4GODA 2E76B 1E79H 3NMDA 1P84H 2I8DA 4H0LD 5B66E 1S9KE 1S9KD 2E75B 2CPBA 2KSEA 5AVSB 4UB8H 3CCRP 2Q9IC 3S9OA 4NPEA 1PGJA 1BSHA 4I6MC 1VDFA 2IPPA 4WWIA 1TU3F 1M1JC 1L0LJ 2QVAA 1VQ5P 3RK2D 5CCHC 3FWNA 2FBWC 5BU5A 3CCMP 2ZXEB 2IZ0A 4U3FJ 3BVHC 2Q1KA 5KJ7C 2W6AA 1NTMK 1FC2C 1FZCA 3B4SA 1D7MA 2YIUB 2V4HA 2W27A 2IBZI 3AEFC 3OA7A 1Q81Q 1FDMA 4EIJA 4HB1A 1LTJA 3G4SP 1CW5A 2A45G 1N7SD 4EI2A 1T2KD 4D6TG 3L70G 1OWAA 3OJAB 3P8CE 1Q86Q 3Q5SA 1RF1A 2HYNA 4AYCA 5APTA 1SQBD 1EZVI 1GK4A 3CL3D 2WZ7A 2FYZA 3H1IJ 1N7SA 5CBOA 5GTIH 2FYUJ 1LTSC 3U1AA 3GF7A 1RF0C 1M1KQ 1ZMEC 2NZ2A 4NYTA 4RO0A 4JYOX 1PPJE 1SQXD 3CX5I 1KILC 4LLHA 2B87B 5CCGC 2IBZE 2YKPA 2WT7B 1YJ9P 1NKZB 1WMKA 2K9JB 3AEAC 3S4RA 1PGPA 1EDLA 3PTZA 4GKGA 1SP4A 1LTGC 4C7RA 1M56D 2ZT9B 3RBZA 3HE4A 3M0AA 3VOPA 3AE8C 1L4AB 1EZVE 5B66H 3TNUA 1VQLP 2FKWB 1YQ4C 3HE5A 3L74G 2OYOA 1NU1G 1JTHA 1N7SC 2QG4A 1T2KC 4EDFA 3CX5E 3HUSB 2YXQB 4I7ZC 4R4LA 2J60A 1U7JA 1PZQA 2JJLA 5H2FE 3RGUA 1PFIA 3CC4P 1LT1A 2JHIF 4PD4D 1URQC 2HODA 1S5LE 1N73B 2CK3H 3L71E 3L71D 4GT1A 3O6QA 1HWTC 2GA1A 3A0BE 2KZJA 5KLVG 1LWUC 4R9JA 1KYOI 1IFIA 4YXDC 1SQBJ 2XDJA 2D39A 1M7LA 1VQPP 1L0NE 1L0ND 2Q6QA 3EFFK 3F5HA 3GHGB 3CCQP 2Q3EA 4L76A 2E42A 3AE5C 3VTPC 1DIPA 1SQXJ 3SFEC 3CWBE 4JPZB 5AVTB 2OYHC 1EXJA 1JY2O 1HVVA 5AW5B 3A5TA 3CXHE 3CXHD 3D6ZA 1IJDB
chains in the Genus database with same CATH topology
1LTBC 3SWYA 1GD2E 1LTTC 2C0WA 1GZLA 3LIEA 1ZN5A 1GL2D 2GY7A 3MGNA 1J1DC 2Q5UA 5AW3B 1MV8A 1FZCC 3V4QA 1JMMA 1G1JA 1L4AA 2Q9IB 3E1IB 2HPCC 1FZFC 1KZUB 5CCHA 5AVVB 1JC9A 2J3UA 1LTJC 3RK2C 1NWQA 1SLQA 1IFNA 4JZCA 1VPCA 1SQVK 4WY4D 1FBMA 5AVQB 2I1JA 5KTBA 3BVHA 1M1JB 2ZFCA 1MZ9A 2J2PA 1GL2A 3VP9A 4W80A 3HUSA 2JEEA 1MFZA 1NH4A 1RE3B 3R2PA 1RF1C 2JHMF 3VYIA 2P1JA 3B5NB 3V2QA 1N86B 1A02F 4ZKPA 1FZAB 1DEBA 2KLVA 3RK3D 1LTIC 2XV5A 5AVXB 3CI9A 1HTLC 2Z4EC 3II6A 3MIWA 3M9QA 2R5DA 1YTZI 4WY4A 2XZRA 2E43A 3M0DA 3HD7B 1URQB 2OYIA 5APWA 5AW0B 1FZBB 2H43B 1N73A 1JOCA 4EOTA 1KILD 4RESB 2WTYA 3TYYA 3MTUE 5CCGD 1N2DC 1LWUB 3BRTB 4EPUA 2J64A 1IK9A 2XKMA 2I1KA 3VMYA 3HTKB 3NXSA 1X79B 1SFCD 2PAJA 1J1EC 3N4XA 5CJ0A 1RE4C 1MUUA 1KQLA 1RF0A 4W7YA 3M9HA 2HLOC 4HYTB 1HGVA 4M7FA 1ZV8A 2A45I 1NKNA 5APYA 4B86A 5AW6B 3TSIA 3GHGA 1G2CB 1KILA 1CI6B 1L0NK 1T8ZA 5CCGA 2J1GA 2KOGA 2YO3A 3A7OA 2FFDB 2J3OA 2OYHB 3NTNA 5AVUB 1SFCA 2WWWA 4I1LA 1H8AA 2J59M 3HUSC 4LC1A 2L5GB 1XTCC 5AVZB 2O1JA 3LW5H 3H32B 5KLVK 3IFMA 2J0GA 4JF7A 1CZQA 1E5WA 3V4WA 1J1DB 4WY4C 1HGZA 1FZCB 2J3FA 2KSJA 4I2LC 1FZEC 1YYCA 3M0DC 2OYIC 3OAKA 1FOSE 5AW9B 2GM4A 2JHHC 1JCCA 2Q9IA 3B5ND 3E1IA 2XNXA 2HPCB 1FZFB 2YMYA 2J5ZA 3EQ2A 1JY2P 3G3ZA 4IFFA 1SQQK 1LTJB 3RK2B 3H32C 1DX7A 5APVA 2WSFH 5KJ7D 1FZDA 1Z3UA 1FICA 2NPSB 5AW2B 5AVWB 3RK3C 1X9VA 2WNPF 1M1JA 2LKMA 3HD7D 1URQD 2GUVA 3WMM0 2H7HA 1KFNA 3FIBA 4AUWA 2M8RA 4Y99C 2HODC 2XNXB 4LGDE 2M3BA 4IFMA 1RF1B 1FJPA 1RE3A 5CHXA 1EQ7A 3PP5A 3B5NA 1T3JA 3A3YB 3L37A 5CMZA 1FIBA 1N86A 3LIDA 1HJBA 1FZAA 3GHGC 1G1IA 2C9LY 4ZKUA 3C9IA 1FZGB 4C7NB 3RL0B 2H8PD 4OH8B 1IC2A 5KJ7A 1N7SB 2FIBA 2WPQA 1N7LA 1NTZK 1GTWA 2JHKF 1FU1A 2BASA 1H89A 1RY3A 1SFCC 1NO4A 1LGHB 2R5BA 1A02J 3HD7A 1URQA 4WB4A 1QL1A 2O1KA 3NMDA 4HH2A 2YNYA 1FZBA 2H43A 1IO4A 1S9KE 1S9KD 3CLQA 3NFQA 3BATA 2POHA 2WSCH 2QM8A 4O9BA 1WRGA 2CPBA 1LWUA 3L4FA 3SWFA 4M3LA 3BASA 1CSBA 1GK6A 1W2EA 3HTKA 5AVSB 1J1EB 5AW8B 3U1CA 2R3CA 1GU4A 1RE4B 3V2PA 2Q9IC 5BVZA 1LT9B 3O8ZA 3E1IC 2HLOB 4I6MC 4WBAA 2N1TC 3HRNA 1FAVA 1HH0A 1JNMA 1AQ5A 1VDFA 1NTKK 1G2CA 1CI6A 2IPPA 4DZOA 1M1JC 4AQRD 1KFMA 1L0LK 2FFDA 2OYHA 1L4AC 3TNUB 3RK2D 5CCHC 3M9BA 5AW1B 1ZR2A 3B5NC 2YKQA 5BU5A 2FXMA 4ZFGA 3HE5B 4C46A 1FZAC 3T97A 2QM7A 3H32A 2NPSD 2ZXEB 2R32A 2WPSA 2O01H 1HBWA 3BVHC 2J3FD 4GIFA 1JTHB 5KJ7C 2OARA 2W6AA 1NTMK 1FZCA 1GL2C 1ZLLA 3M91A 4KHXA 5AVRB 3KQGA 3HD7C 3MD0A 3MUDA 2W27A 1FZBC 4JYBA 2H43C 1FZFA 2MJZA 3L36A 2HPCA 3OA7A 1FDMA 4EIJA 1LTJA 1CW5A 2A45G 2IFNA 4N3YB 3RL0D 1ZR4A 1Z56A 1N7SD 2VRSA 1T2KD 1J2JB 1OWAA 2NPSA 4N6JA 3OJAB 1JY3P 3P8CE 4XA4A 1FOSF 3L35A 4Y99B 2HODB 1N73C 1RF1A 2HYNA 4AYCA 3KPEA 5APTA 1IFJA 2XU6A 2KYVA 2WSEH 1GK4A 2Z5HA 1FZGA 3CL3D 4C7NA 2WZ7A 2P2UA 2FYZA 1N7SA 2FYUK 2WPRA 2FFDC 1LTSC 3U1AA 3H6PA 1JY2N 1RF0C 5APSA 1NAFA 4NYTA 1QL2A 5CJ4A 4JYOX 3A2AA 2J61B 2J0HA 1KILC 4LLHA 3KDPB 2WITA 2Z4EB 5CCGC 1FIDA 2YKPA 2A45H 2WT7B 1NKZB 3V2RA 1RE4A 3EFGA 1LT9A 1HUCA 3IR9A 2HLOA 3I5CA 1YTZT 1GW4A 2Q7CA 2PP6A 2N1TB 1SP4A 1LTGC 1JCDA 4GKGA 3V2NA 4C7RA 1NHLA 2J0YA 1NOHA 3HE4A 3M0AA 2NPSC 4W7ZA 3BRVB 3VOPA 3VP8A 1FJKA 2J3GA 4DOJA 1AFOA 1L4AB 3N7NA 1T3UA 2XNXC 3TNUA 5BU8B 2YO2A 2FKWB 4R9TA 5APUA 3HE5A 2CPSA 5AW4B 3HE4B 3P32A 1FZGC 3BVHB 3RL0C 1JTHA 1N7SC 2Z5IA 2IFMA 1T2KC 1GL2B 1FZEA 1DH3A 3HUSB 3VMXA 1RE3C 4IFDK 2J60A 2GUSA 1N86C 5APQA 1IFDA 2JJLA 4M7HA 1NU1K 1SVFA 2YKOA 1PFIA 4WY4B 1GW3A 1FZEB 2JHIF 1GU5A 2OYIB 1URQC 3KYQA 3P7KA 1LT9C 1SQPK 2HODA 5AVYB 1N73B 1X8YA 4GT1A 1HWTC 5APXA 1OXZA 1WT6A 1H88A 3B8EB 1LWUC 4R9JA 1IFIA 3V5BA 3RK3B 1SQBK 1JO5A 2XDJA 3P8CD 2D39A 4XE5B 1M7LA 3P8MC 2Q3IA 1RF0B 2N1TD 2HFED 2KB7P 3VMZA 2P67A 1XTGB 3VN0A 2J61A 3U59A 2IX7C 3GHGB 1KILB 2P7JA 2W6BA 3TK1A 1LTAC 4N78E 4N78D 2E42A 3VTPC 1JY3O 1JY3N 1Z3SA 2Z4EA 2J58A 2C9NY 5AW7B 2HG5D 1SQXK 3UIAA 4JYCA 1L4AD 1IFMA 2WT7A 5AVTB 2KP8A 2OYHC 1SFCB 5CCHD 3M06A 2N9BA 1JY2O 1JUNA 2C0XA 1HVVA 5AW5B 3A5TA 2N1TA 1IJDB 1GDTA 2JHLF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J3G A;  3H32 B;  2GY7 A;  2J0G A;  1T3U A;  2XNX C;  1FZC C;  4ZFG A;  1FZA C;  3H32 A;  2Q9I B;  4R9T A;  3E1I B;  1FZC B;  2J3F A;  1FZE C;  3BVH C;  2J3F D;  2HPC C;  1FZF C;  2OYI C;  1JC9 A;  2J3U A;  2JHH C;  1LTJ C;  2Q9I A;  1FZG C;  3E1I A;  2XNX A;  3BVH B;  1FZC A;  2HPC B;  2J5Z A;  1FZF B;  1JY2 P;  1LTJ B;  4JZC A;  3H32 C;  1FZB C;  1FZE A;  3BVH A;  2H43 C;  1FZF A;  2HPC A;  1M1J B;  1FZD A;  3HUS B;  1LTJ A;  2J2P A;  1Z3U A;  2A45 G;  1RE3 C;  1FIC A;  2WNP F;  2J60 A;  1M1J A;  3HUS A;  1N86 C;  1RE3 B;  1RF1 C;  2JHM F;  3FIB A;  4M7H A;  1JY3 P;  2HOD C;  2XNX B;  1N86 B;  1RF1 B;  1FZA B;  1RE3 A;  2HOD B;  1FZE B;  1FIB A;  1N86 A;  2JHI F;  1N73 C;  2Z4E C;  1RF1 A;  1FZA A;  3GHG C;  2OYI B;  2HOD A;  1LT9 C;  1FZG B;  1N73 B;  2FIB A;  2OYI A;  2JHK F;  1FZG A;  1FZB B;  2H43 B;  1N73 A;  1LWU C;  4R9J A;  2FFD C;  1FZB A;  2H43 A;  1LWU B;  2D39 A;  4EPU A;  2J64 A;  1JY2 N;  1RF0 C;  4NYT A;  4JYO X;  1LWU A;  1RF0 B;  2J61 B;  2J0H A;  1W2E A;  1RE4 C;  1RF0 A;  2J61 A;  2Z4E B;  2HLO C;  3GHG B;  1RE4 B;  1FID A;  4M7F A;  2A45 H;  2Q9I C;  1LT9 B;  2A45 I;  3E1I C;  1JY3 O;  1JY3 N;  1Z3S A;  2HLO B;  2Z4E A;  3GHG A;  1RE4 A;  1LT9 A;  2OYH C;  2HLO A;  2J1G A;  1JY2 O;  2FFD B;  2J3O A;  2OYH B;  1M1J C;  2J0Y A;  3HUS C;  2FFD A;  2OYH A;  2JHL F; 
#chains in the Genus database with same CATH topology
 1SQV G;  3LIE A;  3JSV C;  1NTZ G;  1JMM A;  1G1J A;  2Q9I B;  1KZU B;  5AVV B;  1FE6 A;  2M5A A;  1VPC A;  4WY4 D;  1FBM A;  5KTB A;  2I1J A;  4OWF A;  5KAF E;  1M1J B;  1N8R Q;  2ZFC A;  1MZ9 A;  3L73 D;  3L72 D;  1NH4 A;  3C8V A;  2BCC D;  1NTK G;  1LTI C;  2PFX A;  2XV5 A;  3TGU D;  3MIW A;  5TIS E;  1SS1 A;  1YTZ I;  4WY4 A;  3AE2 C;  2XZR A;  2E43 A;  3AEG C;  2OYI A;  4ASV A;  3CPW O;  1N2D C;  4EPU A;  2E75 C;  2XKM A;  3L71 J;  3VMY A;  1X79 B;  3CX5 H;  5CJ0 A;  4NPD A;  2KK7 A;  2M0B A;  1KB9 D;  5B5E H;  1HGV A;  1ZV8 A;  4H0L B;  5APY A;  5H2F H;  3TSI A;  3PHL A;  2H89 C;  1L0N J;  3AE7 C;  2K88 A;  2J3O A;  3SSU A;  1S5L H;  1H8A A;  1NU1 E;  3A0B H;  3CWB J;  3LW5 H;  5TJH A;  5K5G B;  1NTM E;  1NTM D;  4RKU J;  3IFM A;  2J0G A;  1SQP E;  1CZQ A;  5CBN A;  3V4W A;  2PRR A;  4GOE A;  4WY4 C;  1FZC B;  2FYU G;  2J3F A;  4R4M A;  1YYC A;  2OYI C;  3OAK A;  3PLN A;  3H1L D;  2YIU C;  3B5N D;  3G9R A;  2XNX A;  2J5Z A;  1JY2 P;  3G3Z A;  1LTJ B;  3RK2 B;  5APV A;  2QJY B;  3CCJ P;  5AVW B;  2KNC A;  3HD7 D;  1LP1 A;  2KLU A;  1VF5 D;  2W6J H;  1BE3 D;  2W83 C;  3WU2 E;  1RF1 B;  1RE3 A;  3CXH H;  3B5N A;  3L73 J;  1N86 A;  3L72 J;  3WUT A;  1UII A;  3C9I A;  5DJT B;  2P10 A;  1S2E A;  3PJS K;  1N7S B;  1Y47 A;  1N7L A;  2BCC J;  1H89 A;  2R5B A;  1A02 J;  3HD7 A;  1QL1 A;  2O1K A;  3TGU J;  4I7Z B;  1IO4 A;  2QRX A;  3NFQ A;  2POH A;  2JWD A;  4O9B A;  3CCV P;  5KAF H;  3L4F A;  4EYY Q;  3SWF A;  3CMA P;  2G3A A;  1W2E A;  1K05 A;  2R3C A;  1GU4 A;  4ZNC A;  3O8Z A;  2O01 J;  2OTK E;  4WBA A;  3HRN A;  1FAV A;  1AQ5 A;  2JP3 A;  5TIS H;  1H0T A;  5E79 E;  2E5T A;  1L4A C;  3TNU B;  3M9B A;  3B5N C;  2YKQ A;  2LR2 A;  2FXM A;  3HE5 B;  4C46 A;  2QM7 A;  3H32 A;  2O01 H;  1HBW A;  1KTM A;  2RMZ A;  4GIF A;  1JTH B;  1SQB G;  1NTM J;  1ZLL A;  4KHX A;  5AVR B;  3HD7 C;  2ZYA A;  3MD0 A;  4JYB A;  2HPC A;  1DEE G;  3L75 E;  3L75 D;  2IFN A;  3RL0 D;  3H1L J;  1PV3 A;  1YJW P;  3BCC G;  5GTH E;  1SQX G;  1JY3 P;  1M90 Q;  1PP9 G;  2ZYD A;  3L35 A;  1VQO P;  3B71 A;  2HOD B;  3GMA A;  1N73 C;  1S72 P;  3O6Q B;  1X22 A;  2PGD A;  1R5L A;  2P2U A;  4JQ0 D;  3RBX A;  3H6P A;  2JKV A;  1NAF A;  3CCE P;  3KDP B;  3VMA A;  1LJ2 A;  1ZOY C;  1NJI Q;  3H25 A;  1VQ6 P;  2A06 E;  2A06 D;  4PJ0 E;  3V2R A;  3WU2 H;  3EFG A;  2IYP A;  3I5C A;  1YTZ T;  2Q7C A;  2PP6 A;  1JCD A;  3V2N A;  2AEM A;  3H1J E;  1R5S A;  3IAO A;  1BCC E;  2YO2 A;  2QIW A;  4HKZ H;  2G8Y A;  3D70 A;  2M5A B;  2CPS A;  3RK3 E;  3FXE A;  1K04 A;  3RL0 C;  4Z1M H;  2Z5I A;  3TF5 A;  1FZE A;  1MKM A;  1YBK A;  3E7K A;  1Q90 D;  3IN6 A;  1QX8 A;  3CD6 P;  1NU1 K;  5E79 H;  1DD3 A;  4WY4 B;  3L75 J;  1GU5 A;  2OYI B;  1AJY A;  1SQP K;  1QVG O;  1X8Y A;  1H88 A;  3GF3 A;  1BGY E;  1BGY D;  1HF9 A;  1VQN P;  1JO5 A;  3P8C D;  3MHV A;  3FX0 A;  2Q3I A;  2N1T D;  2KB7 P;  1SQQ G;  1XTG B;  2J61 A;  4H0L C;  3U59 A;  1VQM P;  3TK1 A;  5GTH H;  3UIA A;  1YI2 P;  1VQ4 P;  2KP8 A;  3AE4 C;  1AQT A;  1JUN A;  2WPV B;  1OVU A;  1PPJ D;  2N1T A;  3L73 G;  3L72 G;  2JHL F;  1VQ7 P;  2C0W A;  1GL2 D;  3E1R A;  2GY7 A;  2IBZ D;  2Q5U A;  2IYO A;  1FZC C;  1EDI A;  3TGU G;  3H1J J;  1JC9 A;  3PH0 A;  1W2B O;  1LTJ C;  3RK2 C;  1KD1 Q;  2QE7 H;  1SLQ A;  1BCC J;  1SQV K;  2QJY C;  2KNC B;  5KKZ C;  4PJ0 H;  1LP1 B;  2J2P A;  1GL2 A;  1LNQ A;  2M3E A;  1EZV D;  1RE3 B;  1RF1 C;  2JHM F;  3B5N B;  3V2Q A;  4DJG A;  1N86 B;  1A02 F;  3H1K E;  3A0H E;  2DW3 A;  3CX5 D;  3M0D A;  3HD7 B;  1YQ3 C;  3H1H G;  1VF5 B;  2BEZ F;  5B5E E;  3R4Y A;  2V7Q H;  1JMB A;  4BRY A;  1SFC D;  2O01 N;  2R44 A;  3N4X A;  1OIP A;  1BGY J;  1MUU A;  1KQL A;  5KAI E;  3Q5P A;  2B89 A;  1USD A;  1EDK A;  2A45 I;  3WUU A;  2QJP C;  5AW6 B;  3H1L G;  1T8Z A;  2KOG A;  4YXW H;  1H0T B;  4DT0 A;  3NTN A;  5AVU B;  1SFC A;  4IOI H;  2L5G B;  2E5Y A;  3H32 B;  3SWK A;  1BE3 G;  1VQK P;  1HGZ A;  3CWB D;  3M0D C;  2GM4 A;  1KV4 A;  2HPC B;  2YMY A;  3EQ2 A;  4BWN A;  2Y0D A;  4H44 D;  1FIC A;  1FDO A;  2LKM A;  1IZN B;  1KFN A;  5M1B A;  2HOD C;  2UWJ E;  4ASW A;  1KYO E;  4D6T E;  1KYO D;  3L70 E;  3PP5 A;  1BDD A;  2QA4 P;  4TT3 H;  1FIB A;  3LID A;  1FZA A;  1G1I A;  4ZKU A;  1QLE D;  2AXT E;  3RL0 B;  2H8P D;  3EWK A;  1ZW0 A;  2BAS A;  1SFC C;  1NO4 A;  1LGH B;  1ZRT E;  1ZRT D;  4WB4 A;  3CLQ A;  2JO1 A;  2WSC H;  2QM8 A;  1KC8 Q;  4M3L A;  3BAS A;  2KZI A;  1CSB A;  1GK6 A;  3HTK A;  1USE A;  1OX3 A;  3U1C A;  2QEX P;  1L0L G;  1OW6 A;  3V2P A;  5C39 A;  4H13 D;  2FYN B;  3D71 A;  1HH0 A;  3A0H H;  1G2C A;  4U3F G;  2QSI A;  4DZO A;  2WMM A;  1KFM A;  1IFP A;  1NAY A;  3LW5 J;  4ZMD A;  5AW1 B;  4ZFG A;  1FZA C;  2R32 A;  2WPS A;  3Q3D A;  2J3F D;  4H44 C;  5KAI H;  4YTP C;  3M91 A;  3L74 E;  3L74 D;  3MUD A;  1FZF A;  1NU1 D;  1YHQ P;  1AVY A;  4N3Y B;  1ZR4 A;  3AED C;  2VRS A;  1P84 I;  1SQP D;  3H1I G;  1FOS F;  1PGQ A;  3D6Y A;  3G71 P;  1OZH A;  1VL2 A;  1IFJ A;  4C7N A;  5KKZ B;  4D6T J;  3L70 J;  2WPR A;  3CCU P;  3KXD A;  1JY2 N;  5APS A;  5KLV D;  5KLV E;  3GG2 A;  2J61 B;  4H13 C;  3V6I A;  1FID A;  2A45 H;  2ZVN B;  2K3R A;  4Y28 J;  1RE4 A;  4RJT A;  1S4X A;  1KYO H;  1LT9 A;  4MN4 C;  1HUC A;  2HLO A;  1GW4 A;  2N1T B;  1GMJ A;  2BEQ D;  2AXT H;  1NHL A;  2J0Y A;  1NOH A;  1S1C X;  5L8R J;  1EXI A;  3AE1 C;  3VP8 A;  4DOJ A;  2SPZ A;  4K3A A;  1T3U A;  2XNX C;  5BU8 B;  4YPC A;  1SQV E;  1SQV D;  4R9T A;  1NTZ E;  2QJP B;  5AW4 B;  3HE4 B;  3P32 A;  2OTL P;  4JBZ A;  2IFM A;  1K73 Q;  1GL2 B;  2D2C D;  3VMX A;  1RE3 C;  3FGA D;  1NGM B;  4IFD K;  2AXC A;  2RKL A;  1N86 C;  1IFD A;  4M7H A;  2OGU A;  3L74 J;  1KQS O;  1NU1 J;  2YKO A;  1NYH A;  1FS0 E;  1NTK E;  3KYQ A;  3P7K A;  1LT9 C;  5AVY B;  1SQP J;  1VF5 C;  2WVR A;  5APX A;  1OXZ A;  3W67 A;  2K37 A;  4BRY B;  1PPJ G;  3CCS P;  1Q82 Q;  4XE5 B;  2O3J A;  2H88 C;  2IBZ G;  1M8O B;  1PIX A;  3WUV A;  2IX7 C;  2P7J A;  2W6B A;  5KLV J;  2ZJS E;  1JY3 N;  1NVO A;  2Z4E A;  3KHU A;  4JYC A;  1IFM A;  1SFC B;  5CCH D;  3M06 A;  2K9Y A;  1Y9B A;  1AA0 A;  2R3S A;  1EZV G;  3H32 C;  3KZI E;  2QJK B;  1GZL A;  1ZN5 A;  1MV8 A;  3V4Q A;  4L75 A;  2HPC C;  5CCH A;  2D2C C;  2J3U A;  3H1I E;  1NWQ A;  2FYU E;  2N9Y B;  3FXD A;  2B88 A;  1SQV J;  3BVH A;  4OGQ D;  3H1J D;  1NTZ J;  1OW8 A;  3VP9 A;  4WVZ A;  4W80 A;  1BCC D;  3VYI A;  2RN0 A;  1FZA B;  1DEB A;  2KLV A;  3RK3 D;  5AVX B;  3L71 G;  3CI9 A;  4H44 B;  2Z4E C;  3M9Q A;  1YIT P;  4GOF A;  5APW A;  5DJU B;  3RL0 g;  4DCK A;  1U57 A;  1KIL E;  1KIL D;  4EOT A;  1K9M Q;  3TYY A;  2K1A A;  1NTK J;  3MTU E;  5CCG D;  3CC7 P;  2NRG A;  2J64 A;  1L0N G;  1IK9 A;  2I1K A;  3HTK B;  2PAJ A;  3CCL P;  1RF0 A;  3M9H A;  4HYT B;  2FYN C;  3CWB G;  3AE3 C;  4B86 A;  1G2C B;  1KIL A;  4IL6 X;  5CCG A;  2J1G A;  1X0T A;  1QEX A;  2YO3 A;  2WWW A;  4I1L A;  4LC1 A;  1XTC C;  1VQ8 P;  1KQG B;  4H13 B;  2ZXX A;  5KLV K;  4JF7 A;  2FY8 A;  1J1D B;  3MZW B;  1FZE C;  4I2L C;  4OGQ C;  2JHH C;  3E1I A;  1FZF B;  4UB6 E;  4PV1 B;  2KXP B;  4IFF A;  1SQB E;  1DX7 A;  3GW6 A;  2IZ1 A;  1Z3U A;  2Y9Y A;  5AW2 B;  4KJM A;  3RK3 C;  2BCC G;  1URQ D;  3WMM 0;  2H7H A;  2M8R A;  2P58 A;  2W8Z A;  1YIJ P;  2XNX B;  4LGD E;  1FJP A;  4IFM A;  1DD4 A;  3BCC E;  3BCC D;  1T3J A;  5CMZ A;  1SQX E;  3KZI H;  1PP9 E;  1PP9 D;  4C7N B;  4NPF X;  4OH8 B;  1IC2 A;  1NTZ K;  1GTW A;  2JHK F;  1QGK B;  1RY3 A;  1URQ A;  4HH2 A;  2V7Q J;  2YNY A;  1FZB A;  2H43 A;  1AVO A;  1OVR A;  3BAT A;  4PD4 I;  5KLI B;  3H1K D;  1YJN P;  1WRG A;  2MKV A;  1LWU A;  1KMI Z;  3CC2 P;  1J1E B;  5AW8 B;  2J5U A;  1RE4 B;  5BVZ A;  1LT9 B;  3E1I C;  2E74 D;  2HLO B;  3ZDM A;  2N1T C;  2WSS H;  1JNM A;  1NTK K;  3S1K A;  1CI6 A;  4AQR D;  1OMI A;  1NTM G;  1L0L K;  2FFD A;  2OYH A;  1UIX A;  2WQY C;  1SQP G;  1ZR2 A;  1OFC X;  3T97 A;  2NPS D;  3CXH I;  3AEC C;  2OAR A;  4PD4 E;  1GL2 C;  1M57 D;  2Y0E A;  3KQG A;  4U7J A;  1FZB C;  2H43 C;  2WSE J;  2MJZ A;  3L36 A;  1JEK A;  1IK7 A;  1ZXG A;  1Z56 A;  4L73 A;  1RQU A;  4TLF A;  1J2J B;  2NPS A;  4N6J A;  4XA4 A;  1Q7Y Q;  2E76 D;  4Y99 B;  1RQV A;  3AEB C;  2ZVO B;  2D2C B;  1BSN A;  3KPE A;  2E75 D;  4OVN F;  2XU6 A;  2KYV A;  1KN7 A;  2WSE H;  2Z5H A;  1FZG A;  4L74 A;  1MFT A;  3BCC J;  2KS1 A;  1PP9 J;  2FYU K;  2FFD C;  3F89 A;  2WSC J;  4UB6 H;  1ZP0 C;  2OQQ A;  1QL2 A;  1U7M A;  4D6T D;  3L70 D;  5CJ4 A;  2E74 C;  3A2A A;  2J0H A;  1AV1 A;  1OVV A;  2WIT A;  2Z4E B;  3H1K J;  1SQQ E;  1SQQ D;  2B9B A;  3IR9 A;  1KB9 I;  2QJK C;  2KUB A;  2NPS C;  4W7Z A;  3BRV B;  2JDI H;  1FJK A;  4XFJ A;  2J3G A;  3L73 E;  2ITA A;  1AFO A;  3N7N A;  3L72 E;  1RHZ B;  1RH5 B;  2BCC E;  5APU A;  2Y0C A;  1FZG C;  3BVH B;  3TGU E;  3L75 G;  3JCU E;  4A7P A;  4PV1 D;  1DH3 A;  2E76 C;  3IF4 A;  2GUS A;  2YMK A;  5APQ A;  5EFW B;  3OW2 O;  1SVF A;  1FDI A;  1GW3 A;  1FZE B;  4OGQ B;  1KB9 E;  2RH0 A;  2FXP A;  1WT6 A;  3B8E B;  1JB0 J;  1PL5 A;  3C1L A;  3JC2 2;  3H1H E;  3H1H D;  3V5B A;  3RK3 B;  4PD4 H;  1SQB K;  2KI7 B;  3P8M C;  3W68 A;  1RF0 B;  2YXR B;  3Q2Y A;  2HFE D;  3VMZ A;  2P67 A;  2ZT9 D;  2A06 G;  4IL6 E;  3VN0 A;  2HR3 A;  3ITK A;  1KIL B;  3FWL A;  1LTA C;  4N78 E;  4N78 D;  2B87 A;  1K8A Q;  2AEJ A;  1JY3 O;  1Z3S A;  2J58 A;  3AE9 C;  2C9N Y;  5AW7 B;  2HG5 D;  1SQX K;  1L4A D;  4CPG A;  2WT7 A;  3AE6 C;  2ZYG A;  1HJ0 A;  2N9B A;  3H1L E;  2C0X A;  2K9J A;  3H1J G;  1SQQ J;  1EC5 A;  1GDT A;  1LTB C;  3CME P;  2AEF A;  3SWY A;  1GD2 E;  1BCC G;  1LTT C;  1Q2N A;  3MGN A;  1J1D C;  5AW3 B;  1L4A A;  1BE3 E;  3E1I B;  1T6A A;  3MUD C;  4BXL A;  1FZF C;  2W90 A;  4PV1 C;  1P84 E;  1P84 D;  4QMA A;  1IFN A;  2JWA A;  4JZC A;  3GLM A;  5AVQ B;  4UB8 E;  3SFD C;  3HUS A;  3PRJ A;  2JEE A;  1MFZ A;  3R2P A;  2P1J A;  1KOR A;  1NTZ D;  1PGO A;  3ABV C;  4ZKP A;  1JM0 A;  1HTL C;  2Y9Z A;  3II6 A;  2R5D A;  3MP7 B;  2JR8 A;  1BGY G;  1URQ B;  5AW0 B;  4HJG H;  1FZB B;  2H43 B;  1N73 A;  3QWO C;  1S5L X;  1JOC A;  3TDK A;  5KLI C;  4RES B;  2WTY A;  2ZT9 C;  1S3J A;  1LWU B;  2ZAE B;  3BRT B;  3NXS A;  3JCU H;  1Y8A A;  1L2P A;  1J1E C;  2L91 A;  1RE4 C;  1NTK D;  3H1H J;  4W7Y A;  2HLO C;  4M7F A;  1NKN A;  1L0L E;  1L0L D;  3GHG A;  1CI6 B;  1L0N K;  2XND H;  1W5C E;  3A7O A;  2FFD B;  2OYH B;  1KB9 H;  2J59 M;  3HUS C;  2WSF J;  4U3F E;  4U3F D;  4K35 A;  5AVZ B;  2O1J A;  3QH9 A;  2E74 B;  1R8E A;  3T97 B;  3I56 P;  2IDB A;  2LXB A;  1E5W A;  3USS A;  3G6E P;  2KSJ A;  3Q5R A;  2OTJ P;  5GTI E;  3I55 P;  1FOS E;  5AW9 B;  1KQF B;  1JCC A;  2Q9I A;  4IL6 H;  1SQQ K;  1BDC A;  4KT0 J;  3Q1M A;  1BE3 J;  2WSF H;  5KJ7 D;  1FZD A;  2NPS B;  2FXO A;  2WNP F;  1X9V A;  1M1J A;  3H1K G;  2GUV A;  1EDJ A;  3FIB A;  4AUW A;  4Y99 C;  1OW7 A;  3AEE C;  2M3B A;  1VQ9 P;  5CHX A;  1EQ7 A;  2LXC B;  2KIK A;  3A3Y B;  3L37 A;  3H1I D;  1QVF O;  3K5B A;  1HJB A;  2FYU D;  3GHG C;  2C9L Y;  1FZG B;  5KJ7 A;  2FIB A;  2WPQ A;  2KS1 B;  1FU1 A;  4GDO A;  4GOD A;  2E76 B;  1E79 H;  3NMD A;  1P84 H;  2I8D A;  4H0L D;  5B66 E;  1S9K E;  1S9K D;  2E75 B;  2CPB A;  2KSE A;  5AVS B;  4UB8 H;  3CCR P;  2Q9I C;  3S9O A;  4NPE A;  1PGJ A;  1BSH A;  4I6M C;  1VDF A;  2IPP A;  4WWI A;  1TU3 F;  1M1J C;  1L0L J;  2QVA A;  1VQ5 P;  3RK2 D;  5CCH C;  3FWN A;  2FBW C;  5BU5 A;  3CCM P;  2ZXE B;  2IZ0 A;  4U3F J;  3BVH C;  2Q1K A;  5KJ7 C;  2W6A A;  1NTM K;  1FC2 C;  1FZC A;  3B4S A;  1D7M A;  2YIU B;  2V4H A;  2W27 A;  2IBZ I;  3AEF C;  3OA7 A;  1Q81 Q;  1FDM A;  4EIJ A;  4HB1 A;  1LTJ A;  3G4S P;  1CW5 A;  2A45 G;  1N7S D;  4EI2 A;  1T2K D;  4D6T G;  3L70 G;  1OWA A;  3OJA B;  3P8C E;  1Q86 Q;  3Q5S A;  1RF1 A;  2HYN A;  4AYC A;  5APT A;  1SQB D;  1EZV I;  1GK4 A;  3CL3 D;  2WZ7 A;  2FYZ A;  3H1I J;  1N7S A;  5CBO A;  5GTI H;  2FYU J;  1LTS C;  3U1A A;  3GF7 A;  1RF0 C;  1M1K Q;  1ZME C;  2NZ2 A;  4NYT A;  4RO0 A;  4JYO X;  1PPJ E;  1SQX D;  3CX5 I;  1KIL C;  4LLH A;  2B87 B;  5CCG C;  2IBZ E;  2YKP A;  2WT7 B;  1YJ9 P;  1NKZ B;  1WMK A;  2K9J B;  3AEA C;  3S4R A;  1PGP A;  1EDL A;  3PTZ A;  4GKG A;  1SP4 A;  1LTG C;  4C7R A;  1M56 D;  2ZT9 B;  3RBZ A;  3HE4 A;  3M0A A;  3VOP A;  3AE8 C;  1L4A B;  1EZV E;  5B66 H;  3TNU A;  1VQL P;  2FKW B;  1YQ4 C;  3HE5 A;  3L74 G;  2OYO A;  1NU1 G;  1JTH A;  1N7S C;  2QG4 A;  1T2K C;  4EDF A;  3CX5 E;  3HUS B;  2YXQ B;  4I7Z C;  4R4L A;  2J60 A;  1U7J A;  1PZQ A;  2JJL A;  5H2F E;  3RGU A;  1PFI A;  3CC4 P;  1LT1 A;  2JHI F;  4PD4 D;  1URQ C;  2HOD A;  1S5L E;  1N73 B;  2CK3 H;  3L71 E;  3L71 D;  4GT1 A;  3O6Q A;  1HWT C;  2GA1 A;  3A0B E;  2KZJ A;  5KLV G;  1LWU C;  4R9J A;  1KYO I;  1IFI A;  4YXD C;  1SQB J;  2XDJ A;  2D39 A;  1M7L A;  1VQP P;  1L0N E;  1L0N D;  2Q6Q A;  3EFF K;  3F5H A;  3GHG B;  3CCQ P;  2Q3E A;  4L76 A;  2E42 A;  3AE5 C;  3VTP C;  1DIP A;  1SQX J;  3SFE C;  3CWB E;  4JPZ B;  5AVT B;  2OYH C;  1EXJ A;  1JY2 O;  1HVV A;  5AW5 B;  3A5T A;  3CXH E;  3CXH D;  3D6Z A;  1IJD B; 
#chains in the Genus database with same CATH homology
 1LTB C;  3SWY A;  1GD2 E;  1LTT C;  2C0W A;  1GZL A;  3LIE A;  1ZN5 A;  1GL2 D;  2GY7 A;  3MGN A;  1J1D C;  2Q5U A;  5AW3 B;  1MV8 A;  1FZC C;  3V4Q A;  1JMM A;  1G1J A;  1L4A A;  2Q9I B;  3E1I B;  2HPC C;  1FZF C;  1KZU B;  5CCH A;  5AVV B;  1JC9 A;  2J3U A;  1LTJ C;  3RK2 C;  1NWQ A;  1SLQ A;  1IFN A;  4JZC A;  1VPC A;  1SQV K;  4WY4 D;  1FBM A;  5AVQ B;  2I1J A;  5KTB A;  3BVH A;  1M1J B;  2ZFC A;  1MZ9 A;  2J2P A;  1GL2 A;  3VP9 A;  4W80 A;  3HUS A;  2JEE A;  1MFZ A;  1NH4 A;  1RE3 B;  3R2P A;  1RF1 C;  2JHM F;  3VYI A;  2P1J A;  3B5N B;  3V2Q A;  1N86 B;  1A02 F;  4ZKP A;  1FZA B;  1DEB A;  2KLV A;  3RK3 D;  1LTI C;  2XV5 A;  5AVX B;  3CI9 A;  1HTL C;  2Z4E C;  3II6 A;  3MIW A;  3M9Q A;  2R5D A;  1YTZ I;  4WY4 A;  2XZR A;  2E43 A;  3M0D A;  3HD7 B;  1URQ B;  2OYI A;  5APW A;  5AW0 B;  1FZB B;  2H43 B;  1N73 A;  1JOC A;  4EOT A;  1KIL D;  4RES B;  2WTY A;  3TYY A;  3MTU E;  5CCG D;  1N2D C;  1LWU B;  3BRT B;  4EPU A;  2J64 A;  1IK9 A;  2XKM A;  2I1K A;  3VMY A;  3HTK B;  3NXS A;  1X79 B;  1SFC D;  2PAJ A;  1J1E C;  3N4X A;  5CJ0 A;  1RE4 C;  1MUU A;  1KQL A;  1RF0 A;  4W7Y A;  3M9H A;  2HLO C;  4HYT B;  1HGV A;  4M7F A;  1ZV8 A;  2A45 I;  1NKN A;  5APY A;  4B86 A;  5AW6 B;  3TSI A;  3GHG A;  1G2C B;  1KIL A;  1CI6 B;  1L0N K;  1T8Z A;  5CCG A;  2J1G A;  2KOG A;  2YO3 A;  3A7O A;  2FFD B;  2J3O A;  2OYH B;  3NTN A;  5AVU B;  1SFC A;  2WWW A;  4I1L A;  1H8A A;  2J59 M;  3HUS C;  4LC1 A;  2L5G B;  1XTC C;  5AVZ B;  2O1J A;  3LW5 H;  3H32 B;  5KLV K;  3IFM A;  2J0G A;  4JF7 A;  1CZQ A;  1E5W A;  3V4W A;  1J1D B;  4WY4 C;  1HGZ A;  1FZC B;  2J3F A;  2KSJ A;  4I2L C;  1FZE C;  1YYC A;  3M0D C;  2OYI C;  3OAK A;  1FOS E;  5AW9 B;  2GM4 A;  2JHH C;  1JCC A;  2Q9I A;  3B5N D;  3E1I A;  2XNX A;  2HPC B;  1FZF B;  2YMY A;  2J5Z A;  3EQ2 A;  1JY2 P;  3G3Z A;  4IFF A;  1SQQ K;  1LTJ B;  3RK2 B;  3H32 C;  1DX7 A;  5APV A;  2WSF H;  5KJ7 D;  1FZD A;  1Z3U A;  1FIC A;  2NPS B;  5AW2 B;  5AVW B;  3RK3 C;  1X9V A;  2WNP F;  1M1J A;  2LKM A;  3HD7 D;  1URQ D;  2GUV A;  3WMM 0;  2H7H A;  1KFN A;  3FIB A;  4AUW A;  2M8R A;  4Y99 C;  2HOD C;  2XNX B;  4LGD E;  2M3B A;  4IFM A;  1RF1 B;  1FJP A;  1RE3 A;  5CHX A;  1EQ7 A;  3PP5 A;  3B5N A;  1T3J A;  3A3Y B;  3L37 A;  5CMZ A;  1FIB A;  1N86 A;  3LID A;  1HJB A;  1FZA A;  3GHG C;  1G1I A;  2C9L Y;  4ZKU A;  3C9I A;  1FZG B;  4C7N B;  3RL0 B;  2H8P D;  4OH8 B;  1IC2 A;  5KJ7 A;  1N7S B;  2FIB A;  2WPQ A;  1N7L A;  1NTZ K;  1GTW A;  2JHK F;  1FU1 A;  2BAS A;  1H89 A;  1RY3 A;  1SFC C;  1NO4 A;  1LGH B;  2R5B A;  1A02 J;  3HD7 A;  1URQ A;  4WB4 A;  1QL1 A;  2O1K A;  3NMD A;  4HH2 A;  2YNY A;  1FZB A;  2H43 A;  1IO4 A;  1S9K E;  1S9K D;  3CLQ A;  3NFQ A;  3BAT A;  2POH A;  2WSC H;  2QM8 A;  4O9B A;  1WRG A;  2CPB A;  1LWU A;  3L4F A;  3SWF A;  4M3L A;  3BAS A;  1CSB A;  1GK6 A;  1W2E A;  3HTK A;  5AVS B;  1J1E B;  5AW8 B;  3U1C A;  2R3C A;  1GU4 A;  1RE4 B;  3V2P A;  2Q9I C;  5BVZ A;  1LT9 B;  3O8Z A;  3E1I C;  2HLO B;  4I6M C;  4WBA A;  2N1T C;  3HRN A;  1FAV A;  1HH0 A;  1JNM A;  1AQ5 A;  1VDF A;  1NTK K;  1G2C A;  1CI6 A;  2IPP A;  4DZO A;  1M1J C;  4AQR D;  1KFM A;  1L0L K;  2FFD A;  2OYH A;  1L4A C;  3TNU B;  3RK2 D;  5CCH C;  3M9B A;  5AW1 B;  1ZR2 A;  3B5N C;  2YKQ A;  5BU5 A;  2FXM A;  4ZFG A;  3HE5 B;  4C46 A;  1FZA C;  3T97 A;  2QM7 A;  3H32 A;  2NPS D;  2ZXE B;  2R32 A;  2WPS A;  2O01 H;  1HBW A;  3BVH C;  2J3F D;  4GIF A;  1JTH B;  5KJ7 C;  2OAR A;  2W6A A;  1NTM K;  1FZC A;  1GL2 C;  1ZLL A;  3M91 A;  4KHX A;  5AVR B;  3KQG A;  3HD7 C;  3MD0 A;  3MUD A;  2W27 A;  1FZB C;  4JYB A;  2H43 C;  1FZF A;  2MJZ A;  3L36 A;  2HPC A;  3OA7 A;  1FDM A;  4EIJ A;  1LTJ A;  1CW5 A;  2A45 G;  2IFN A;  4N3Y B;  3RL0 D;  1ZR4 A;  1Z56 A;  1N7S D;  2VRS A;  1T2K D;  1J2J B;  1OWA A;  2NPS A;  4N6J A;  3OJA B;  1JY3 P;  3P8C E;  4XA4 A;  1FOS F;  3L35 A;  4Y99 B;  2HOD B;  1N73 C;  1RF1 A;  2HYN A;  4AYC A;  3KPE A;  5APT A;  1IFJ A;  2XU6 A;  2KYV A;  2WSE H;  1GK4 A;  2Z5H A;  1FZG A;  3CL3 D;  4C7N A;  2WZ7 A;  2P2U A;  2FYZ A;  1N7S A;  2FYU K;  2WPR A;  2FFD C;  1LTS C;  3U1A A;  3H6P A;  1JY2 N;  1RF0 C;  5APS A;  1NAF A;  4NYT A;  1QL2 A;  5CJ4 A;  4JYO X;  3A2A A;  2J61 B;  2J0H A;  1KIL C;  4LLH A;  3KDP B;  2WIT A;  2Z4E B;  5CCG C;  1FID A;  2YKP A;  2A45 H;  2WT7 B;  1NKZ B;  3V2R A;  1RE4 A;  3EFG A;  1LT9 A;  1HUC A;  3IR9 A;  2HLO A;  3I5C A;  1YTZ T;  1GW4 A;  2Q7C A;  2PP6 A;  2N1T B;  1SP4 A;  1LTG C;  1JCD A;  4GKG A;  3V2N A;  4C7R A;  1NHL A;  2J0Y A;  1NOH A;  3HE4 A;  3M0A A;  2NPS C;  4W7Z A;  3BRV B;  3VOP A;  3VP8 A;  1FJK A;  2J3G A;  4DOJ A;  1AFO A;  1L4A B;  3N7N A;  1T3U A;  2XNX C;  3TNU A;  5BU8 B;  2YO2 A;  2FKW B;  4R9T A;  5APU A;  3HE5 A;  2CPS A;  5AW4 B;  3HE4 B;  3P32 A;  1FZG C;  3BVH B;  3RL0 C;  1JTH A;  1N7S C;  2Z5I A;  2IFM A;  1T2K C;  1GL2 B;  1FZE A;  1DH3 A;  3HUS B;  3VMX A;  1RE3 C;  4IFD K;  2J60 A;  2GUS A;  1N86 C;  5APQ A;  1IFD A;  2JJL A;  4M7H A;  1NU1 K;  1SVF A;  2YKO A;  1PFI A;  4WY4 B;  1GW3 A;  1FZE B;  2JHI F;  1GU5 A;  2OYI B;  1URQ C;  3KYQ A;  3P7K A;  1LT9 C;  1SQP K;  2HOD A;  5AVY B;  1N73 B;  1X8Y A;  4GT1 A;  1HWT C;  5APX A;  1OXZ A;  1WT6 A;  1H88 A;  3B8E B;  1LWU C;  4R9J A;  1IFI A;  3V5B A;  3RK3 B;  1SQB K;  1JO5 A;  2XDJ A;  3P8C D;  2D39 A;  4XE5 B;  1M7L A;  3P8M C;  2Q3I A;  1RF0 B;  2N1T D;  2HFE D;  2KB7 P;  3VMZ A;  2P67 A;  1XTG B;  3VN0 A;  2J61 A;  3U59 A;  2IX7 C;  3GHG B;  1KIL B;  2P7J A;  2W6B A;  3TK1 A;  1LTA C;  4N78 E;  4N78 D;  2E42 A;  3VTP C;  1JY3 O;  1JY3 N;  1Z3S A;  2Z4E A;  2J58 A;  2C9N Y;  5AW7 B;  2HG5 D;  1SQX K;  3UIA A;  4JYC A;  1L4A D;  1IFM A;  2WT7 A;  5AVT B;  2KP8 A;  2OYH C;  1SFC B;  5CCH D;  3M06 A;  2N9B A;  1JY2 O;  1JUN A;  2C0X A;  1HVV A;  5AW5 B;  3A5T A;  2N1T A;  1IJD B;  1GDT A;  2JHL F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...