1N73C

Fibrin d-dimer, lamprey complexed with the peptide ligand: gly-his-arg-pro-amide
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
322
structure length
322
Chain Sequence
KTVQKILEEVRILEQIGVSHDAQIQELSEMWRVNQQFVTRLQQQLVDIRQTCSRSCQDTTANKISPITGKDCQQVVDNGGKDSGLYYIKPLKAKQPFLVFCEIENGNGWTVIQHRHDGSVNFTRDWVSYREGFGYLAPTLTTEFWLGNEKIHLLTGQQAYRLRIDLTDWENTHRYADYGHFKLTPESDEYRLFYSMYLDGDAGNAFDGFDFGDDPQDKFYTTHLGMLFSTPERDNDKYEGSCAEQDGSGWWMNRCHAGHLNGKYYFGGNYRKTDVEFPYDDGIIWATWHDRWYSLKMTTMKLLPMGRDLSGHGGQQQSKGNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal structure of fragment double-D from cross-linked lamprey fibrin reveals isopeptide linkages across an unexpected D-D interface
pubmed doi rcsb
molecule tags Blood clotting
molecule keywords Fibrin alpha-1 chain
total genus 92
structure length 322
sequence length 322
chains with identical sequence F
ec nomenclature
pdb deposition date 2002-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1n73C03
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 1n73C01
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 1n73C02
1JY3P 2XNXA 2HPCA 1FZBA 2WNPF 4R9TA 2HLOC 4ZFGA 2H43B 2A45I 2XNXC 1RE4B 2J3GA 2OYHA 2OYIC 2J0GA 1FZGB 1FZEC 1JY2P 2JHLF 1FZFC 2OYIA 2FIBA 1N73A 2J0HA 3GHGA 3E1IC 1RF1B 4NYTA 1M1JC 1RE3C 1LTJB 1RF1C 1LWUA 3E1IB 1FIBA 1LWUC 3GHGB 1FZGA 2Q9IA 1FZCC 2Z4EB 1FZDA 1FZFB 2FFDC 1M1JA 2J3FA 2HODC 1FZEB 1W2EA 2J5ZA 2A45H 2FFDA 2JHHC 3BVHA 2D39A 2J61B 3HUSA 2JHKF 2H43C 2HLOB 1FZBB 1RF0A 1FZBC 1N86B 2A45G 2J1GA 1N86A 1JY2N 1LT9B 1FZEA 4R9JA 1JC9A 2OYHC 2JHMF 2HODB 3H32A 3BVHB 2HPCC 2FFDB 2Z4EC 1FZCB 1LWUB 3GHGC 1LTJA 1JY2O 3H32C 1RF1A 1LTJC 1RE3B 1M1JB 4M7HA 1FZFA 1JY3N 2Z4EA 1N73B 2Q9IB 1RE3A 1JY3O 3E1IA 2J3UA 2J0YA 1FZCA 2Q9IC 1N73C 1FICA 2J2PA 3H32B 2J60A 4EPUA 1FZGC 2OYIB 1RE4A 3FIBA 2H43A 1RE4C 2HPCB 2XNXB 2JHIF 3BVHC 4JZCA 2OYHB 2HODA 1T3UA 1RF0B 1FZAC 3HUSC 4JYOX 2J3OA 1LT9C 2GY7A 1Z3SA 1LT9A 1FIDA 2J3FD 1Z3UA 2J64A 1N86C 2HLOA 4M7FA 3HUSB 1FZAA 1FZAB 2J61A 1RF0C
chains in the Genus database with same CATH superfamily
2XDJA 2H7HA 3L4FA 1NAFA 3M0AA 1SQXG 2HLOC 1T2KD 2J3GA 2LR2A 1P84D 4H44D 2KUBA 2KSEA 1NTMD 2JHLF 1OW7A 1MZ9A 2OYIA 3GHGA 4U3FE 3HD7A 5KLVE 1RF1B 3GW6A 1L2PA 4WY4D 4JQ0D 3AE2C 2YMKA 1ZP0C 3CPWO 1FZEB 5E79H 2WPQA 3VN0A 2FFDA 3P7KA 2E74C 2H89C 3R4YA 3CL3D 4HB1A 3IF4A 2KK7A 4WBAA 2FYUJ 2A06E 1VQ4P 1BCCE 3D6ZA 2D2CB 3M9HA 3KDPB 2Z4EC 2C9LY 4Y28J 4R4MA 3HD7B 1RF1A 3N7NA 4LGDE 2K3RA 3RL0D 3F89A 3KYQA 3T97A 3VYIA 3SFDC 2KS1B 1PIXA 4EPUA 2KYVA 2IBZD 1NTZD 1M8OB 1BGYG 4OGQD 1HUCA 4U3FG 3HUSC 5KLVG 2GY7A 2M5AB 1L0ND 1Z3UA 3L37A 1S4XA 3I55P 5AVQB 2AXTH 1Y47A 5GTHH 1EDIA 4KT0J 2KI7B 2XNXA 2WNPF 1KN7A 1P84H 3L73G 1L4AB 5AW7B 1L0LG 3H1IG 1FZGB 1M7LA 3GF3A 1ZR2A 1SQVE 3AE9C 1KB9E 2R44A 4ASVA 4K3AA 1VQ5P 2J0HA 2VRSA 2KXPB 5EFWB 2WTYA 3L35A 1FU1A 1FIBA 1LTAC 3H1LG 2P2UA 3S4RA 2G8YA 2FFDC 1L4AA 3H1HG 4PV1D 5H2FE 2QJKC 1KYOH 3LW5J 1VQNP 1FZBB 1Q2NA 2N9BA 3CXHD 1FZBC 1N86B 2YIUB 1N86A 1Q86Q 1USEA 1IFMA 2ZXEB 4AUWA 1HTLC 1K04A 2C9NY 3BCCJ 4IL6E 2KS1A 1RHZB 2OTLP 1KILB 5E79E 4BWNA 3KZIE 2WITA 3CCMP 4H0LC 1YQ3C 3RL0g 2Y0EA 3L71D 3E1IA 2J3UA 2P1JA 4W7YA 3RK2D 4OH8B 5CJ4A 1DD4A 2SPZA 2J60A 2W90A 3S9OA 1DEEG 1QVGO 2N1TC 2LXBA 2UWJE 3BCCG 3OJAB 3CX5I 1EXIA 3A0BE 3HUSB 3ITKA 1T6AA 3N4XA 1VQ7P 1HGVA 4LC1A 3AE8C 1HF9A 2YKOA 3G6EP 1ZRTE 1L0NJ 4HH2A 1LTSC 3CCLP 2WSFH 1LWUA 1X8YA 1JCCA 1PP9G 5KJ7A 3QWOC 1OMIA 2J5ZA 1SQQK 1VF5D 2IPPA 5APYA 1SQVG 1NTKE 3MTUE 1JY2N 1HWTC 2JWDA 3L70D 2KB7P 4I2LC 2IBZI 4R4LA 2GM4A 3H1IE 3H6PA 4EI2A 5KAFE 1GW4A 1JY3N 5AVWB 1N73B 1NAYA 4K35A 3NFQA 3BASA 4YPCA 1SVFA 2JWAA 1NU1J 1SFCD 5BU8B 3PLNA 1ZN5A 1FAVA 3H1JD 1HJ0A 1ZXGA 4N78D 2CPBA 2J3FD 2XZRA 3L74D 1YIJP 2Q7CA 1IFPA 1IFJA 1YHQP 3CCQP 1NTMJ 5KLIC 4ZMDA 2A45I 1YI2P 3CWBG 3L72E 2K9JA 2HG5D 1SQQJ 2NPSA 1URQD 1JY2P 1ZLLA 3M0DA 3TSIA 3L74J 3RK3E 1RE3C 1GTWA 5APTA 1IZNB 3RK2C 1BE3D 3CI9A 2LKMA 1ZW0A 4DCKA 4JF7A 5KAIH 3M9QA 3CWBJ 3HRNA 2XU6A 1SQXJ 2Y9ZA 2FYUK 1SFCC 2Y9YA 1Q82Q 1Q7YQ 4AYCA 5AW3B 2K88A 3SSUA 2G3AA 2WPRA 1X0TA 1HH0A 3L36A 1SQVK 4Y99B 2Y0DA 3EQ2A 5KKZB 1LT1A 1VDFA 1K9MQ 3IN6A 1NTKG 1E5WA 2QJYB 3V2QA 3FXEA 2BASA 3A7OA 3R2PA 1FZAC 4MN4C 1AA0A 1KQLA 1CSBA 2KLVA 4GIFA 5APUA 3B8EB 2YKPA 1OIPA 3E1RA 3L75D 5C39A 2WT7A 4CPGA 2OTJP 5TISH 1H0TB 3TGUJ 3SWKA 1J1DC 1SQPD 2KZIA 2OQQA 1LTJB 1JMMA 3Q3DA 5CMZA 3GHGB 1J1DB 2WPVB 1KTMA 2Z4EB 2HR3A 4D6TE 3L72J 1ZR4A 4OWFA 5AW9B 2D39A 1YYCA 1PGOA 2JHKF 3O6QB 1OWAA 5M1BA 1SQVJ 1NOHA 1RF0A 3UIAA 2YO3A 2KOGA 3B5NA 1VF5B 2O3JA 3L72G 2NRGA 3H1HJ 2HODB 3SWFA 3V4WA 2WMMA 2PP6A 1A02F 4H0LD 1KQGB 1KZUB 2QJYC 2YO2A 1WT6A 3D71A 4UB8H 3M0DC 5CCGD 5APXA 1Z56A 2V7QJ 3A2AA 2B87B 1GL2C 2R32A 1OFCX 2J5UA 2V4HA 4KJMA 1HGZA 3ABVC 2ZXXA 1AFOA 1T3UA 3W67A 1LT9C 1NGMB 2N1TA 4PV1C 1LT9A 1KB9I 1SQPK 1FZAA 1SFCB 1VQLP 5CCHD 3A5TA 3TGUD 3CC2P 1EDLA 3I56P 2OYHA 1S1CX 2AEFA 5AVTB 3CD6P 2WQYC 1OXZA 1PP9J 2GA1A 4GKGA 4JYBA 1UIIA 3BRVB 2QVAA 3LIEA 3VMYA 1FZGA 1FZCC 2H8PD 3G4SP 2BCCJ 2QRXA 4JYCA 1SQBK 5KAFH 3NXSA 3MZWB 3WUUA 4PD4H 4BRYB 5B5EE 1BCCJ 4C7NB 2FKWB 3FWLA 4L75A 4OGQB 3RBXA 3WUVA 4IFDK 2FXPA 3Q5RA 1H8AA 3L73E 1YJWP 4D6TG 2QJPB 5DJUB 2QSIA 2OYOA 1PPJD 1SQBD 1S5LE 3VP8A 1L4AD 3CCEP 2ITAA 2E5TA 4W80A 1JY3O 2FYUD 1JNMA 1SQXD 1ZMEC 2Q9IC 1PGQA 1L0LJ 2A06G 1OVUA 4HYTB 1KFMA 3C9IA 1NTMK 1NTMG 4XA4A 1N7LA 1MFTA 1IFNA 2K37A 4U3FJ 5KLVJ 5AW2B 4PV1B 1A02J 3D6YA 2P10A 3AECC 2YXQB 4R9TA 1AVOA 1SQQD 4IL6X 1EC5A 2W6BA 2OYIC 3L71E 1IFIA 1J2JB 2OARA 1M90Q 5APWA 1KILD 2PGDA 3RK3C 4L73A 3MGNA 1KILA 3PH0A 4M3LA 3H1JJ 1U57A 2K9JB 1S72P 3AEBC 1KQFB 1DEBA 5B5EH 5CHXA 2HODC 1QVFO 2M8RA 2KNCB 3CX5H 1NKZB 2N9YB 1SLQA 1RY3A 2W6AA 4R9JA 1S2EA 1BGYD 5AVYB 2K1AA 2FYZA 3BVHB 1X79B 5AW0B 3GHGC 1L0NG 1YTZT 2XNDH 3RK3B 3F5HA 5AW4B 1JM0A 4TLFA 1YJ9P 2OTKE 3CC4P 4GT1A 5K5GB 4RESB 3M91A 3H1ID 3L73J 4WY4C 4EYYQ 1CW5A 5AVVB 3C1LA 3AE3C 1NJIQ 2J3OA 4H44C 4PD4D 4C7RA 4M7FA 1P84I 1FZAB 1RF0C 1CI6B 2Q5UA 1PV3A 1KYOI 1JTHB 4UB6E 2IYPA 3A0HH 2H43B 2QA4P 1AQTA 2E76D 4GOEA 2YXRB 1K05A 2Z5HA 3MUDC 3RBZA 2J58A 4U7JA 2BCCG 1ZRTD 3TYYA 2ZAEB 2E76C 1PGJA 2Q3EA 2KP8A 3P8CD 1YBKA 1DH3A 1OW6A 4NPEA 1QGKB 3Q5SA 3PTZA 2J61B 3HUSA 3L71G 4GODA 1KC8Q 4OGQC 3VTPC 1GW3A 1QL1A 2W83C 3VMXA 3VMAA 3RGUA 1FZEA 3HE4B 4IL6H 2IFMA 2P7JA 3II6A 5AVSB 1Q90D 2JP3A 1R5LA 3BCCD 3Q1MA 5H2FH 3HTKA 1FZFA 2Z4EA 1DX7A 1URQB 1VQKP 4N78E 2WVRA 3AE4C 1K8AQ 2J2PA 4I6MC 3LW5H 1RE4C 2IFNA 1Y8AA 3TGUE 1UIXA 1MUUA 3H1JE 3KQGA 4ASWA 5TISE 1NO4A 3B5NC 1G2CA 4H13D 1PP9D 3PRJA 4XFJA 2HPCA 4BRYA 3MHVA 1M56D 2POHA 5AW5B 1GU5A 3TK1A 2O01J 5APQA 4N3YB 1LNQA 1S9KD 4KHXA 4ZKUA 4NYTA 1RF1C 2E75C 2JO1A 2YMYA 1JO5A 2Q9IA 3OW2O 4WY4A 1FZDA 4L76A 3PP5A 3CMAP 2C0XA 1U7JA 3B5ND 2FY8A 1NU1D 5GTHE 2O01H 4NPFX 1LTIC 1SQPE 2HLOB 1PFIA 3H1KG 3W68A 3AEEC 3BRTB 1SFCA 2J1GA 3CCRP 1CZQA 1SQBJ 2N1TB 3KXDA 1SQXE 3EWKA 1OVRA 3PJSK 3H1JG 1YITP 1N2DC 2Y0CA 1IO4A 2BCCE 1LTJC 1EXJA 1RE3A 1FOSE 1KYOD 2IDBA 1FZCA 2Z5IA 1LP1B 3CWBD 2Q1KA 3WU2H 5AW8B 2JKVA 1KILC 3RK3D 2HPCB 2O1KA 2JHIF 2NPSB 1BE3J 2W8ZA 2ZYAA 5CJ0A 3E7KA 4JYOX 3HE4A 3CC7P 5KLVK 3AEGC 4YTPC 1KYOE 1KQSO 5GTIH 1N86C 2J64A 2QE7H 1AV1A 1GMJA 1BE3G 3CMEP 1BCCG 3O6QA 5CCGA 3H1KE 4RJTA 1EDKA 2DW3A 4A7PA 2PAJA 4H0LB 2B89A 2WSFJ 3TNUB 1QLED 5CCHC 1GK4A 2H88C 3IFMA 5APSA 2A45H 5CCHA 3D70A 3BVHA 2H43C 1R8EA 2K9YA 1M57D 1EQ7A 1EZVD 2JDIH 2A45G 3U1AA 2KNCA 1GL2D 5KJ7D 2WPSA 1FC2C 4EDFA 3Q5PA 2HPCC 2CK3H 3HE5B 3L70J 1GDTA 4AQRD 1RE3B 3VMZA 2L91A 3TNUA 1BE3E 2ZT9D 1GL2A 1LTBC 3MIWA 1VQMP 1OW8A 3H1LE 4B86A 2E43A 1IK9A 1LGHB 2H43A 2IBZE 3BVHC 1EZVE 2MKVA 1N7SB 1SQPG 5APVA 4PJ0E 1SS1A 1G1IA 3CXHI 3V2PA 1W5CE 4HKZH 3FGAD 1L0NK 4N6JA 4IFFA 5AVUB 1PPJE 1SQBE 2R5BA 3VOPA 1QX8A 2M3EA 2E74B 3GF7A 3JCUE 3AE1C 1FZEC 1U7MA 1PZQA 2E75B 1FDOA 3E1IC 1DD3A 2R3CA 3HE5A 1MKMA 2P58A 2RKLA 1NWQA 1KV4A 2JR8A 2ZJSE 1NTKK 3AEFC 3AE5C 3BCCE 3CCVP 1JTHA 1BSHA 1SQQE 4WVZA 3MP7B 1NTME 3CWBE 1XTCC 2WSSH 3H32A 1VQOP 3H1LJ 1NU1K 1BDCA 1X9VA 4UB8E 4EOTA 4M7HA 3G71P 2Q9IB 2YNYA 2FYUE 2B9BA 1LTTC 1FICA 1PL5A 4LLHA 1RE4A 3FIBA 1H0TA 4RKUJ 1MV8A 2OYHB 3V2NA 3MD0A 1EDJA 1Z3SA 3H25A 3AEAC 2WSEH 4I7ZC 4PD4I 1YTZI 2J61A 3JSVC 4GOFA 2AEMA 2WZ7A 4C7NA 1KILE 1KB9H 2M0BA 1NTKJ 2J0GA 3U1CA 1KD1Q 2IBZG 3CX5E 2IZ0A 3L75J 1NTZG 1URQC 2FIBA 1HVVA 5KTBA 4U3FD 5KLVD 2QEXP 4WWIA 2RN0A 3FXDA 3USSA 4DJGA 1FZFB 4D6TD 3NMDA 1RQUA 1PPJG 1SQBG 2IYOA 3H1IJ 3L73D 1TU3F 1S3JA 1L0LD 2YIUC 2FYUG 2W27A 1IC2A 5CBOA 2Q3IA 4C46A 5AW1B 3FX0A 1NHLA 2A06D 1GD2E 2ZYDA 3CCUP 3IAOA 1LT9B 2FXOA 2MJZA 1JC9A 1BDDA 4BXLA 3H1LD 1T3JA 1BGYE 3O8ZA 5CCGC 3V4QA 3H1HD 2FFDB 1BGYJ 4IFMA 1R5SA 3TDKA 4ZNCA 1JY2O 3B4SA 4XE5B 4O9BA 2QIWA 2E76B 4DT0A 5AW6B 1N8RQ 1SQQG 1NVOA 1T8ZA 3H32B 1FZGC 2FBWC 1NH4A 2OGUA 3K5BA 1VQ8P 3CXHE 2ZT9B 3IR9A 2D2CD 1L0NE 3L74E 1SQPJ 3I5CA 2PRRA 1LJ2A 1FBMA 2YKQA 1FZBA 2XKMA 3HD7D 3KHUA 3EFGA 2ZFCA 4DZOA 1LP1A 4DOJA 2ZVOB 3M06A 4EIJA 2ZVNB 1IFDA 3HD7C 4YXWH 1LWUC 1JEKA 1FE6A 1FDIA 2RMZA 1NTZJ 2QM8A 3CX5D 1RH5B 3KZIH 2D2CC 4HJGH 1PGPA 1GU4A 5B66H 4NPDA 5DJTB 1OZHA 1NU1E 3MUDA 4H13B 1Q81Q 3AEDC 3WU2E 3LIDA 1OVVA 3H32C 5B66E 1M1JB 3JC22 3V5BA 2JEEA 3T97B 1SQVD 3CCSP 2GUVA 2PFXA 3A3YB 2IZ1A 2I8DA 1EZVI 3L70G 2GUSA 2BCCD 3C8VA 1VQ9P 3P8MC 2HODA 2O01N 3M9BA 2ZYGA 1VQ6P 1AVYA 1G2CB 2B88A 1KB9D 3B5NB 1X22A 2W6JH 5GTIE 1T2KC 5TJHA 3SFEC 1G1JA 4JPZB 2XNXC 1RE4B 1Y9BA 3WUTA 2E5YA 1NTZK 1URQA 2N1TD 3RK2B 3V6IA 1YQ4C 1GK6A 2M3BA 3L74G 1USDA 2QJPC 2J3FA 5AVZB 1VPCA 3VP9A 2WSEJ 5KLIB 2BEQD 1WRGA 2FYNB 2NPSD 4OVNF 1H89A 3V2RA 1OX3A 1BSNA 4TT3H 1S5LX 1ZV8A 1E79H 2OYHC 1M1KQ 2WWWA 2BEZF 2LXCB 1J1EB 4WB4A 1PP9E 3PHLA 5KAIE 1FZCB 3P8CE 3HTKB 1VQPP 1N73C 4GDOA 2XV5A 5CBNA 4L74A 3OAKA 1QEXA 1WMKA 1ZOYC 1KFNA 4D6TJ 1RQVA 4JZCA 3GMAA 1RF0B 1NKNA 1VF5C 4IOIH 4H44B 4PD4E 1FIDA 3SWYA 2HLOA 1IJDB 2RH0A 2M5AA 1NYHA 1JCDA 1NU1G 3H1KJ 2HFED 1NTKD 1MFZA 4WY4B 3CXHH 3L70E 3H1KD 3JCUH 3QH9A 1GL2B 3CCJP 4YXDC 3TF5A 1YJNP 1SQXK 3A0HE 1N73A 1M1JC 1IK7A 3E1IB 3A0BH 1HJBA 1JB0J 1JMBA 1SP4A 3AE7C 2KSJA 3CLQA 2AXCA 4UB6H 3L75G 4H13C 3RL0C 1W2EA 2JHHC 1CI6A 5AVXB 5AVRB 2R3SA 5BVZA 1N7SD 3U59A 3G3ZA 2J59M 2ZT9C 3RL0B 2JHMF 1XTGB 3OA7A 1N7SC 1JOCA 1LWUB 2CPSA 1AQ5A 2E74D 2L5GB 3GG2A 1VL2A 1BCCD 5KJ7C 2J0YA 2AXTE 2V7QH 3P32A 2HYNA 3WMM0 1HBWA 3B71A 1KORA 2OYIB 2E75D 3BATA 2C0WA 2QM7A 3L72D 1JUNA 3Q2YA 5L8RJ 3S1KA 2WSCJ 1L0LK 2E42A 2KLUA 1JY3P 3NTNA 4ZFGA 2QJKB 4QMAA 1H88A 2I1KA 2B87A 1FDMA 1EZVG 2WSCH 1FZFC 2JJLA 5KKZC 4ZKPA 4Y99C 3FWNA 2QG4A 1K73Q 1M1JA 4I1LA 2AEJA 1J1EC 1KMIZ 2P67A 1QL2A 3TGUG 1L4AC 1S9KE 2FXMA 1DIPA 3ZDMA 2FYNC 1S5LH 3L71J 2I1JA 1N7SA 3KPEA 4Z1MH 2NPSC 1LTGC 3L75E 2IX7C 1AJYA 5BU5A 1LTJA 3G9RA 1D7MA 1NTZE 4PJ0H 1P84E 3AE6C 2KIKA 2KZJA 1W2BO 3EFFK 1GZLA 1FJPA 1L0LE 4W7ZA 2Q6QA 1FS0E 3H1HE 2XNXB 4RO0A 2WT7B 1FJKA 4I7ZB 4JBZA 2NZ2A 3GLMA 2O1JA 2R5DA 1FOSF
chains in the Genus database with same CATH topology
2XDJA 2WT7A 3L4FA 1FBMA 2H7HA 1NAFA 2YKQA 2HPCA 1FZBA 2XKMA 3M0AA 2HLOC 3HD7D 1T2KD 3EFGA 2J3GA 2ZFCA 2POHA 5AW5B 4DZOA 4DOJA 1GU5A 3TK1A 2JHLF 3M06A 5APQA 1MZ9A 2OYIA 4EIJA 1J1DC 1IFDA 4N3YB 1S9KD 3GHGA 4KHXA 3HD7A 4ZKUA 1RF1B 4NYTA 1LTJB 1RF1C 3HD7C 1JMMA 4WY4D 5CMZA 1LWUC 2YMYA 3GHGB 1JO5A 2Q9IA 1J1DB 2Z4EB 4WY4A 1FZDA 3PP5A 2QM8A 2C0XA 1ZR4A 1FZEB 3B5ND 2WPQA 2O01H 5AW9B 3VN0A 2FFDA 3P7KA 1GU4A 2D39A 1YYCA 2JHKF 3CL3D 1LTIC 2HLOB 1PFIA 1OWAA 4WBAA 3BRTB 1NOHA 1RF0A 3UIAA 1SFCA 2J1GA 2YO3A 1CZQA 2KOGA 3B5NA 2N1TB 3MUDA 2HODB 3SWFA 3V4WA 3M9HA 3KDPB 2Z4EC 2PP6A 1A02F 1N2DC 2C9LY 3LIDA 1IO4A 3H32C 3HD7B 1KZUB 1LTJC 1RF1A 3N7NA 4LGDE 1M1JB 2YO2A 1WT6A 3V5BA 2JEEA 3M0DC 1RE3A 5APXA 5CCGD 1Z56A 3RL0D 3KYQA 3A2AA 3T97A 3VYIA 1FOSE 1FZCA 2Z5IA 2GUVA 1GL2C 2R32A 3A3YB 5AW8B 4EPUA 2KYVA 1KILC 3RK3D 2HPCB 2O1KA 2JHIF 1HGZA 2NPSB 2GUSA 1HUCA 1AFOA 3P8MC 2HODA 5CJ0A 1T3UA 3M9BA 3HUSC 4JYOX 3HE4A 1G2CB 1LT9C 2N1TA 5KLVK 2GY7A 1LT9A 3B5NB 1Z3UA 3L37A 2J64A 1SQPK 1N86C 1FZAA 1SFCB 5AVQB 5CCHD 1T2KC 1G1JA 2XNXA 2WNPF 3A5TA 2XNXC 1RE4B 2OYHA 1L4AB 5AW7B 5CCGA 1FZGB 1M7LA 5AVTB 1ZR2A 1NTZK 1URQA 2N1TD 3RK2B 1OXZA 2J0HA 2VRSA 2WTYA 4GKGA 3L35A 4JYBA 3BRVB 1FU1A 1GK6A 2PAJA 1FIBA 3LIEA 1LTAC 2M3BA 3VMYA 2P2UA 3TNUB 1FZGA 1FZCC 2H8PD 5CCHC 2FFDC 1L4AA 1GK4A 2J3FA 5AVZB 4JYCA 1SQBK 3IFMA 5APSA 2A45H 5CCHA 3NXSA 1VPCA 3VP9A 3BVHA 2H43C 1FZBB 2N9BA 1WRGA 4C7NB 1EQ7A 2FKWB 2NPSD 1FZBC 1N86B 2A45G 4IFDK 1H89A 1N86A 3V2RA 3U1AA 1IFMA 2ZXEB 1GL2D 4AUWA 5KJ7D 1ZV8A 2WPSA 2OYHC 1HTLC 2WWWA 2C9NY 1J1EB 4WB4A 1H8AA 2HPCC 1KILB 1FZCB 3HE5B 2WITA 3P8CE 1GDTA 4AQRD 1RE3B 3VP8A 3VMZA 1L4AD 3TNUA 3HTKB 4W80A 1JY3O 3E1IA 2J3UA 1GL2A 2P1JA 1LTBC 4W7YA 1JNMA 2Q9IC 3MIWA 1N73C 3RK2D 4OH8B 5CJ4A 4B86A 2XV5A 2J60A 2E43A 1IK9A 4HYTB 1KFMA 3OAKA 1LGHB 3C9IA 2H43A 1NTMK 3BVHC 4XA4A 1N7SB 1N7LA 1KFNA 5APVA 1IFNA 4JZCA 1RF0B 2N1TC 1G1IA 1NKNA 3V2PA 3OJAB 1FIDA 5AW2B 3SWYA 2HLOA 1A02J 3HUSB 1IJDB 1L0NK 4N6JA 4IFFA 5AVUB 1JCDA 4R9TA 2R5BA 3VOPA 3N4XA 2HFED 1MFZA 2W6BA 1HGVA 4LC1A 4WY4B 2OYIC 1FZEC 1IFIA 1J2JB 2OARA 1GL2B 2YKOA 1SQXK 1N73A 5APWA 3E1IC 2R3CA 4HH2A 1LTSC 1M1JC 2WSFH 1KILD 3RK3C 1LWUA 3E1IB 1X8YA 3HE5A 1JCCA 3MGNA 1HJBA 1KILA 4M3LA 1SP4A 2KSJA 3CLQA 1DEBA 1NWQA 5CHXA 5KJ7A 2HODC 3RL0C 1W2EA 2J5ZA 1NTKK 1SQQK 2JHHC 1CI6A 2IPPA 5APYA 1JTHA 5AVXB 2M8RA 5AVRB 5BVZA 1N7SD 1NKZB 3MTUE 1SLQA 1RY3A 2W6AA 1JY2N 1HWTC 3U59A 2KB7P 3G3ZA 2J59M 4I2LC 4R9JA 3RL0B 2JHMF 1XTCC 2YKPA 2GM4A 1XTGB 3OA7A 1N7SC 3H32A 5AVYB 3H6PA 3BVHB 2FYZA 1X79B 1JOCA 5AW0B 1NU1K 1LWUB 2CPSA 3GHGC 1AQ5A 1X9VA 1YTZT 3RK3B 1GW4A 5AW4B 4EOTA 4M7HA 1JY3N 5AVWB 1N73B 2L5GB 2Q9IB 2YNYA 3NFQA 1LTTC 3BASA 4GT1A 5KJ7C 1SVFA 2J0YA 1FICA 3P32A 4RESB 2HYNA 3WMM0 1HBWA 3M91A 4LLHA 4WY4C 1RE4A 2OYIB 3FIBA 3BATA 1SFCD 1CW5A 2C0WA 2QM7A 5BU8B 5AVVB 1JUNA 1MV8A 1ZN5A 2OYHB 3V2NA 3MD0A 1FAVA 4N78D 2J3OA 2CPBA 1Z3SA 1L0LK 2J3FD 2XZRA 2E42A 2WSEH 4C7RA 4M7FA 2Q7CA 1FZAB 1YTZI 2J61A 1RF0C 1CI6B 1IFJA 2WZ7A 2Q5UA 4C7NA 1JY3P 1JTHB 3NTNA 4ZFGA 2H43B 2A45I 1H88A 2HG5D 2J0GA 2Z5HA 2NPSA 1URQD 2I1KA 3U1CA 1FDMA 1JY2P 1ZLLA 3M0DA 3TSIA 2WSCH 1FZFC 1URQC 2FIBA 2J58A 1HVVA 3TYYA 2JJLA 4ZKPA 5KTBA 4Y99C 1RE3C 2KP8A 1GTWA 3P8CD 1DH3A 1FZFB 5APTA 1M1JA 3RK2C 3NMDA 4I1LA 3CI9A 2LKMA 1J1EC 2P67A 1QL2A 4JF7A 1L4AC 1S9KE 3M9QA 2J61B 3HUSA 3HRNA 2FXMA 2W27A 2XU6A 3VTPC 2FYUK 1IC2A 1GW3A 2Q3IA 1SFCC 4C46A 5AW1B 1QL1A 1NHLA 2I1JA 3VMXA 1GD2E 4AYCA 5AW3B 1N7SA 1LT9B 1FZEA 2MJZA 3HE4B 2IFMA 1JC9A 2WPRA 1T3JA 2P7JA 3KPEA 3II6A 3O8ZA 5AVSB 5CCGC 2NPSC 3V4QA 1LTGC 2FFDB 4IFMA 2IX7C 5BU5A 1LTJA 1HH0A 1JY2O 3HTKA 4XE5B 4O9BA 3L36A 1SQVK 4Y99B 1FZFA 2Z4EA 3EQ2A 5AW6B 1DX7A 1VDFA 1URQB 4N78E 1E5WA 2J2PA 1T8ZA 3H32B 1FZGC 1GZLA 1FJPA 4I6MC 4W7ZA 1NH4A 3LW5H 3V2QA 1RE4C 2XNXB 2IFNA 2WT7B 2BASA 3A7OA 1FJKA 1MUUA 3KQGA 3R2PA 3IR9A 1FZAC 1NO4A 2R5DA 1KQLA 3B5NC 1G2CA 1CSBA 2KLVA 4GIFA 5APUA 2O1JA 3B8EB 3I5CA 1FOSF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JY3 P;  2XNX A;  2HPC A;  1FZB A;  2WNP F;  4R9T A;  2HLO C;  4ZFG A;  2H43 B;  2A45 I;  2XNX C;  1RE4 B;  2J3G A;  2OYH A;  2OYI C;  2J0G A;  1FZG B;  1FZE C;  1JY2 P;  2JHL F;  1FZF C;  2OYI A;  2FIB A;  1N73 A;  2J0H A;  3GHG A;  3E1I C;  1RF1 B;  4NYT A;  1M1J C;  1RE3 C;  1LTJ B;  1RF1 C;  1LWU A;  3E1I B;  1FIB A;  1LWU C;  3GHG B;  1FZG A;  2Q9I A;  1FZC C;  2Z4E B;  1FZD A;  1FZF B;  2FFD C;  1M1J A;  2J3F A;  2HOD C;  1FZE B;  1W2E A;  2J5Z A;  2A45 H;  2FFD A;  2JHH C;  3BVH A;  2D39 A;  2J61 B;  3HUS A;  2JHK F;  2H43 C;  2HLO B;  1FZB B;  1RF0 A;  1FZB C;  1N86 B;  2A45 G;  2J1G A;  1N86 A;  1JY2 N;  1LT9 B;  1FZE A;  4R9J A;  1JC9 A;  2OYH C;  2JHM F;  2HOD B;  3H32 A;  3BVH B;  2HPC C;  2FFD B;  2Z4E C;  1FZC B;  1LWU B;  3GHG C;  1LTJ A;  1JY2 O;  3H32 C;  1RF1 A;  1LTJ C;  1RE3 B;  1M1J B;  4M7H A;  1FZF A;  1JY3 N;  2Z4E A;  1N73 B;  2Q9I B;  1RE3 A;  1JY3 O;  3E1I A;  2J3U A;  2J0Y A;  1FZC A;  2Q9I C;  1N73 C;  1FIC A;  2J2P A;  3H32 B;  2J60 A;  4EPU A;  1FZG C;  2OYI B;  1RE4 A;  3FIB A;  2H43 A;  1RE4 C;  2HPC B;  2XNX B;  2JHI F;  3BVH C;  4JZC A;  2OYH B;  2HOD A;  1T3U A;  1RF0 B;  1FZA C;  3HUS C;  4JYO X;  2J3O A;  1LT9 C;  2GY7 A;  1Z3S A;  1LT9 A;  1FID A;  2J3F D;  1Z3U A;  2J64 A;  1N86 C;  2HLO A;  4M7F A;  3HUS B;  1FZA A;  1FZA B;  2J61 A;  1RF0 C; 
#chains in the Genus database with same CATH topology
 2XDJ A;  2H7H A;  3L4F A;  1NAF A;  3M0A A;  1SQX G;  2HLO C;  1T2K D;  2J3G A;  2LR2 A;  1P84 D;  4H44 D;  2KUB A;  2KSE A;  1NTM D;  2JHL F;  1OW7 A;  1MZ9 A;  2OYI A;  3GHG A;  4U3F E;  3HD7 A;  5KLV E;  1RF1 B;  3GW6 A;  1L2P A;  4WY4 D;  4JQ0 D;  3AE2 C;  2YMK A;  1ZP0 C;  3CPW O;  1FZE B;  5E79 H;  2WPQ A;  3VN0 A;  2FFD A;  3P7K A;  2E74 C;  2H89 C;  3R4Y A;  3CL3 D;  4HB1 A;  3IF4 A;  2KK7 A;  4WBA A;  2FYU J;  2A06 E;  1VQ4 P;  1BCC E;  3D6Z A;  2D2C B;  3M9H A;  3KDP B;  2Z4E C;  2C9L Y;  4Y28 J;  4R4M A;  3HD7 B;  1RF1 A;  3N7N A;  4LGD E;  2K3R A;  3RL0 D;  3F89 A;  3KYQ A;  3T97 A;  3VYI A;  3SFD C;  2KS1 B;  1PIX A;  4EPU A;  2KYV A;  2IBZ D;  1NTZ D;  1M8O B;  1BGY G;  4OGQ D;  1HUC A;  4U3F G;  3HUS C;  5KLV G;  2GY7 A;  2M5A B;  1L0N D;  1Z3U A;  3L37 A;  1S4X A;  3I55 P;  5AVQ B;  2AXT H;  1Y47 A;  5GTH H;  1EDI A;  4KT0 J;  2KI7 B;  2XNX A;  2WNP F;  1KN7 A;  1P84 H;  3L73 G;  1L4A B;  5AW7 B;  1L0L G;  3H1I G;  1FZG B;  1M7L A;  3GF3 A;  1ZR2 A;  1SQV E;  3AE9 C;  1KB9 E;  2R44 A;  4ASV A;  4K3A A;  1VQ5 P;  2J0H A;  2VRS A;  2KXP B;  5EFW B;  2WTY A;  3L35 A;  1FU1 A;  1FIB A;  1LTA C;  3H1L G;  2P2U A;  3S4R A;  2G8Y A;  2FFD C;  1L4A A;  3H1H G;  4PV1 D;  5H2F E;  2QJK C;  1KYO H;  3LW5 J;  1VQN P;  1FZB B;  1Q2N A;  2N9B A;  3CXH D;  1FZB C;  1N86 B;  2YIU B;  1N86 A;  1Q86 Q;  1USE A;  1IFM A;  2ZXE B;  4AUW A;  1HTL C;  1K04 A;  2C9N Y;  3BCC J;  4IL6 E;  2KS1 A;  1RHZ B;  2OTL P;  1KIL B;  5E79 E;  4BWN A;  3KZI E;  2WIT A;  3CCM P;  4H0L C;  1YQ3 C;  3RL0 g;  2Y0E A;  3L71 D;  3E1I A;  2J3U A;  2P1J A;  4W7Y A;  3RK2 D;  4OH8 B;  5CJ4 A;  1DD4 A;  2SPZ A;  2J60 A;  2W90 A;  3S9O A;  1DEE G;  1QVG O;  2N1T C;  2LXB A;  2UWJ E;  3BCC G;  3OJA B;  3CX5 I;  1EXI A;  3A0B E;  3HUS B;  3ITK A;  1T6A A;  3N4X A;  1VQ7 P;  1HGV A;  4LC1 A;  3AE8 C;  1HF9 A;  2YKO A;  3G6E P;  1ZRT E;  1L0N J;  4HH2 A;  1LTS C;  3CCL P;  2WSF H;  1LWU A;  1X8Y A;  1JCC A;  1PP9 G;  5KJ7 A;  3QWO C;  1OMI A;  2J5Z A;  1SQQ K;  1VF5 D;  2IPP A;  5APY A;  1SQV G;  1NTK E;  3MTU E;  1JY2 N;  1HWT C;  2JWD A;  3L70 D;  2KB7 P;  4I2L C;  2IBZ I;  4R4L A;  2GM4 A;  3H1I E;  3H6P A;  4EI2 A;  5KAF E;  1GW4 A;  1JY3 N;  5AVW B;  1N73 B;  1NAY A;  4K35 A;  3NFQ A;  3BAS A;  4YPC A;  1SVF A;  2JWA A;  1NU1 J;  1SFC D;  5BU8 B;  3PLN A;  1ZN5 A;  1FAV A;  3H1J D;  1HJ0 A;  1ZXG A;  4N78 D;  2CPB A;  2J3F D;  2XZR A;  3L74 D;  1YIJ P;  2Q7C A;  1IFP A;  1IFJ A;  1YHQ P;  3CCQ P;  1NTM J;  5KLI C;  4ZMD A;  2A45 I;  1YI2 P;  3CWB G;  3L72 E;  2K9J A;  2HG5 D;  1SQQ J;  2NPS A;  1URQ D;  1JY2 P;  1ZLL A;  3M0D A;  3TSI A;  3L74 J;  3RK3 E;  1RE3 C;  1GTW A;  5APT A;  1IZN B;  3RK2 C;  1BE3 D;  3CI9 A;  2LKM A;  1ZW0 A;  4DCK A;  4JF7 A;  5KAI H;  3M9Q A;  3CWB J;  3HRN A;  2XU6 A;  1SQX J;  2Y9Z A;  2FYU K;  1SFC C;  2Y9Y A;  1Q82 Q;  1Q7Y Q;  4AYC A;  5AW3 B;  2K88 A;  3SSU A;  2G3A A;  2WPR A;  1X0T A;  1HH0 A;  3L36 A;  1SQV K;  4Y99 B;  2Y0D A;  3EQ2 A;  5KKZ B;  1LT1 A;  1VDF A;  1K9M Q;  3IN6 A;  1NTK G;  1E5W A;  2QJY B;  3V2Q A;  3FXE A;  2BAS A;  3A7O A;  3R2P A;  1FZA C;  4MN4 C;  1AA0 A;  1KQL A;  1CSB A;  2KLV A;  4GIF A;  5APU A;  3B8E B;  2YKP A;  1OIP A;  3E1R A;  3L75 D;  5C39 A;  2WT7 A;  4CPG A;  2OTJ P;  5TIS H;  1H0T B;  3TGU J;  3SWK A;  1J1D C;  1SQP D;  2KZI A;  2OQQ A;  1LTJ B;  1JMM A;  3Q3D A;  5CMZ A;  3GHG B;  1J1D B;  2WPV B;  1KTM A;  2Z4E B;  2HR3 A;  4D6T E;  3L72 J;  1ZR4 A;  4OWF A;  5AW9 B;  2D39 A;  1YYC A;  1PGO A;  2JHK F;  3O6Q B;  1OWA A;  5M1B A;  1SQV J;  1NOH A;  1RF0 A;  3UIA A;  2YO3 A;  2KOG A;  3B5N A;  1VF5 B;  2O3J A;  3L72 G;  2NRG A;  3H1H J;  2HOD B;  3SWF A;  3V4W A;  2WMM A;  2PP6 A;  1A02 F;  4H0L D;  1KQG B;  1KZU B;  2QJY C;  2YO2 A;  1WT6 A;  3D71 A;  4UB8 H;  3M0D C;  5CCG D;  5APX A;  1Z56 A;  2V7Q J;  3A2A A;  2B87 B;  1GL2 C;  2R32 A;  1OFC X;  2J5U A;  2V4H A;  4KJM A;  1HGZ A;  3ABV C;  2ZXX A;  1AFO A;  1T3U A;  3W67 A;  1LT9 C;  1NGM B;  2N1T A;  4PV1 C;  1LT9 A;  1KB9 I;  1SQP K;  1FZA A;  1SFC B;  1VQL P;  5CCH D;  3A5T A;  3TGU D;  3CC2 P;  1EDL A;  3I56 P;  2OYH A;  1S1C X;  2AEF A;  5AVT B;  3CD6 P;  2WQY C;  1OXZ A;  1PP9 J;  2GA1 A;  4GKG A;  4JYB A;  1UII A;  3BRV B;  2QVA A;  3LIE A;  3VMY A;  1FZG A;  1FZC C;  2H8P D;  3G4S P;  2BCC J;  2QRX A;  4JYC A;  1SQB K;  5KAF H;  3NXS A;  3MZW B;  3WUU A;  4PD4 H;  4BRY B;  5B5E E;  1BCC J;  4C7N B;  2FKW B;  3FWL A;  4L75 A;  4OGQ B;  3RBX A;  3WUV A;  4IFD K;  2FXP A;  3Q5R A;  1H8A A;  3L73 E;  1YJW P;  4D6T G;  2QJP B;  5DJU B;  2QSI A;  2OYO A;  1PPJ D;  1SQB D;  1S5L E;  3VP8 A;  1L4A D;  3CCE P;  2ITA A;  2E5T A;  4W80 A;  1JY3 O;  2FYU D;  1JNM A;  1SQX D;  1ZME C;  2Q9I C;  1PGQ A;  1L0L J;  2A06 G;  1OVU A;  4HYT B;  1KFM A;  3C9I A;  1NTM K;  1NTM G;  4XA4 A;  1N7L A;  1MFT A;  1IFN A;  2K37 A;  4U3F J;  5KLV J;  5AW2 B;  4PV1 B;  1A02 J;  3D6Y A;  2P10 A;  3AEC C;  2YXQ B;  4R9T A;  1AVO A;  1SQQ D;  4IL6 X;  1EC5 A;  2W6B A;  2OYI C;  3L71 E;  1IFI A;  1J2J B;  2OAR A;  1M90 Q;  5APW A;  1KIL D;  2PGD A;  3RK3 C;  4L73 A;  3MGN A;  1KIL A;  3PH0 A;  4M3L A;  3H1J J;  1U57 A;  2K9J B;  1S72 P;  3AEB C;  1KQF B;  1DEB A;  5B5E H;  5CHX A;  2HOD C;  1QVF O;  2M8R A;  2KNC B;  3CX5 H;  1NKZ B;  2N9Y B;  1SLQ A;  1RY3 A;  2W6A A;  4R9J A;  1S2E A;  1BGY D;  5AVY B;  2K1A A;  2FYZ A;  3BVH B;  1X79 B;  5AW0 B;  3GHG C;  1L0N G;  1YTZ T;  2XND H;  3RK3 B;  3F5H A;  5AW4 B;  1JM0 A;  4TLF A;  1YJ9 P;  2OTK E;  3CC4 P;  4GT1 A;  5K5G B;  4RES B;  3M91 A;  3H1I D;  3L73 J;  4WY4 C;  4EYY Q;  1CW5 A;  5AVV B;  3C1L A;  3AE3 C;  1NJI Q;  2J3O A;  4H44 C;  4PD4 D;  4C7R A;  4M7F A;  1P84 I;  1FZA B;  1RF0 C;  1CI6 B;  2Q5U A;  1PV3 A;  1KYO I;  1JTH B;  4UB6 E;  2IYP A;  3A0H H;  2H43 B;  2QA4 P;  1AQT A;  2E76 D;  4GOE A;  2YXR B;  1K05 A;  2Z5H A;  3MUD C;  3RBZ A;  2J58 A;  4U7J A;  2BCC G;  1ZRT D;  3TYY A;  2ZAE B;  2E76 C;  1PGJ A;  2Q3E A;  2KP8 A;  3P8C D;  1YBK A;  1DH3 A;  1OW6 A;  4NPE A;  1QGK B;  3Q5S A;  3PTZ A;  2J61 B;  3HUS A;  3L71 G;  4GOD A;  1KC8 Q;  4OGQ C;  3VTP C;  1GW3 A;  1QL1 A;  2W83 C;  3VMX A;  3VMA A;  3RGU A;  1FZE A;  3HE4 B;  4IL6 H;  2IFM A;  2P7J A;  3II6 A;  5AVS B;  1Q90 D;  2JP3 A;  1R5L A;  3BCC D;  3Q1M A;  5H2F H;  3HTK A;  1FZF A;  2Z4E A;  1DX7 A;  1URQ B;  1VQK P;  4N78 E;  2WVR A;  3AE4 C;  1K8A Q;  2J2P A;  4I6M C;  3LW5 H;  1RE4 C;  2IFN A;  1Y8A A;  3TGU E;  1UIX A;  1MUU A;  3H1J E;  3KQG A;  4ASW A;  5TIS E;  1NO4 A;  3B5N C;  1G2C A;  4H13 D;  1PP9 D;  3PRJ A;  4XFJ A;  2HPC A;  4BRY A;  3MHV A;  1M56 D;  2POH A;  5AW5 B;  1GU5 A;  3TK1 A;  2O01 J;  5APQ A;  4N3Y B;  1LNQ A;  1S9K D;  4KHX A;  4ZKU A;  4NYT A;  1RF1 C;  2E75 C;  2JO1 A;  2YMY A;  1JO5 A;  2Q9I A;  3OW2 O;  4WY4 A;  1FZD A;  4L76 A;  3PP5 A;  3CMA P;  2C0X A;  1U7J A;  3B5N D;  2FY8 A;  1NU1 D;  5GTH E;  2O01 H;  4NPF X;  1LTI C;  1SQP E;  2HLO B;  1PFI A;  3H1K G;  3W68 A;  3AEE C;  3BRT B;  1SFC A;  2J1G A;  3CCR P;  1CZQ A;  1SQB J;  2N1T B;  3KXD A;  1SQX E;  3EWK A;  1OVR A;  3PJS K;  3H1J G;  1YIT P;  1N2D C;  2Y0C A;  1IO4 A;  2BCC E;  1LTJ C;  1EXJ A;  1RE3 A;  1FOS E;  1KYO D;  2IDB A;  1FZC A;  2Z5I A;  1LP1 B;  3CWB D;  2Q1K A;  3WU2 H;  5AW8 B;  2JKV A;  1KIL C;  3RK3 D;  2HPC B;  2O1K A;  2JHI F;  2NPS B;  1BE3 J;  2W8Z A;  2ZYA A;  5CJ0 A;  3E7K A;  4JYO X;  3HE4 A;  3CC7 P;  5KLV K;  3AEG C;  4YTP C;  1KYO E;  1KQS O;  5GTI H;  1N86 C;  2J64 A;  2QE7 H;  1AV1 A;  1GMJ A;  1BE3 G;  3CME P;  1BCC G;  3O6Q A;  5CCG A;  3H1K E;  4RJT A;  1EDK A;  2DW3 A;  4A7P A;  2PAJ A;  4H0L B;  2B89 A;  2WSF J;  3TNU B;  1QLE D;  5CCH C;  1GK4 A;  2H88 C;  3IFM A;  5APS A;  2A45 H;  5CCH A;  3D70 A;  3BVH A;  2H43 C;  1R8E A;  2K9Y A;  1M57 D;  1EQ7 A;  1EZV D;  2JDI H;  2A45 G;  3U1A A;  2KNC A;  1GL2 D;  5KJ7 D;  2WPS A;  1FC2 C;  4EDF A;  3Q5P A;  2HPC C;  2CK3 H;  3HE5 B;  3L70 J;  1GDT A;  4AQR D;  1RE3 B;  3VMZ A;  2L91 A;  3TNU A;  1BE3 E;  2ZT9 D;  1GL2 A;  1LTB C;  3MIW A;  1VQM P;  1OW8 A;  3H1L E;  4B86 A;  2E43 A;  1IK9 A;  1LGH B;  2H43 A;  2IBZ E;  3BVH C;  1EZV E;  2MKV A;  1N7S B;  1SQP G;  5APV A;  4PJ0 E;  1SS1 A;  1G1I A;  3CXH I;  3V2P A;  1W5C E;  4HKZ H;  3FGA D;  1L0N K;  4N6J A;  4IFF A;  5AVU B;  1PPJ E;  1SQB E;  2R5B A;  3VOP A;  1QX8 A;  2M3E A;  2E74 B;  3GF7 A;  3JCU E;  3AE1 C;  1FZE C;  1U7M A;  1PZQ A;  2E75 B;  1FDO A;  3E1I C;  1DD3 A;  2R3C A;  3HE5 A;  1MKM A;  2P58 A;  2RKL A;  1NWQ A;  1KV4 A;  2JR8 A;  2ZJS E;  1NTK K;  3AEF C;  3AE5 C;  3BCC E;  3CCV P;  1JTH A;  1BSH A;  1SQQ E;  4WVZ A;  3MP7 B;  1NTM E;  3CWB E;  1XTC C;  2WSS H;  3H32 A;  1VQO P;  3H1L J;  1NU1 K;  1BDC A;  1X9V A;  4UB8 E;  4EOT A;  4M7H A;  3G71 P;  2Q9I B;  2YNY A;  2FYU E;  2B9B A;  1LTT C;  1FIC A;  1PL5 A;  4LLH A;  1RE4 A;  3FIB A;  1H0T A;  4RKU J;  1MV8 A;  2OYH B;  3V2N A;  3MD0 A;  1EDJ A;  1Z3S A;  3H25 A;  3AEA C;  2WSE H;  4I7Z C;  4PD4 I;  1YTZ I;  2J61 A;  3JSV C;  4GOF A;  2AEM A;  2WZ7 A;  4C7N A;  1KIL E;  1KB9 H;  2M0B A;  1NTK J;  2J0G A;  3U1C A;  1KD1 Q;  2IBZ G;  3CX5 E;  2IZ0 A;  3L75 J;  1NTZ G;  1URQ C;  2FIB A;  1HVV A;  5KTB A;  4U3F D;  5KLV D;  2QEX P;  4WWI A;  2RN0 A;  3FXD A;  3USS A;  4DJG A;  1FZF B;  4D6T D;  3NMD A;  1RQU A;  1PPJ G;  1SQB G;  2IYO A;  3H1I J;  3L73 D;  1TU3 F;  1S3J A;  1L0L D;  2YIU C;  2FYU G;  2W27 A;  1IC2 A;  5CBO A;  2Q3I A;  4C46 A;  5AW1 B;  3FX0 A;  1NHL A;  2A06 D;  1GD2 E;  2ZYD A;  3CCU P;  3IAO A;  1LT9 B;  2FXO A;  2MJZ A;  1JC9 A;  1BDD A;  4BXL A;  3H1L D;  1T3J A;  1BGY E;  3O8Z A;  5CCG C;  3V4Q A;  3H1H D;  2FFD B;  1BGY J;  4IFM A;  1R5S A;  3TDK A;  4ZNC A;  1JY2 O;  3B4S A;  4XE5 B;  4O9B A;  2QIW A;  2E76 B;  4DT0 A;  5AW6 B;  1N8R Q;  1SQQ G;  1NVO A;  1T8Z A;  3H32 B;  1FZG C;  2FBW C;  1NH4 A;  2OGU A;  3K5B A;  1VQ8 P;  3CXH E;  2ZT9 B;  3IR9 A;  2D2C D;  1L0N E;  3L74 E;  1SQP J;  3I5C A;  2PRR A;  1LJ2 A;  1FBM A;  2YKQ A;  1FZB A;  2XKM A;  3HD7 D;  3KHU A;  3EFG A;  2ZFC A;  4DZO A;  1LP1 A;  4DOJ A;  2ZVO B;  3M06 A;  4EIJ A;  2ZVN B;  1IFD A;  3HD7 C;  4YXW H;  1LWU C;  1JEK A;  1FE6 A;  1FDI A;  2RMZ A;  1NTZ J;  2QM8 A;  3CX5 D;  1RH5 B;  3KZI H;  2D2C C;  4HJG H;  1PGP A;  1GU4 A;  5B66 H;  4NPD A;  5DJT B;  1OZH A;  1NU1 E;  3MUD A;  4H13 B;  1Q81 Q;  3AED C;  3WU2 E;  3LID A;  1OVV A;  3H32 C;  5B66 E;  1M1J B;  3JC2 2;  3V5B A;  2JEE A;  3T97 B;  1SQV D;  3CCS P;  2GUV A;  2PFX A;  3A3Y B;  2IZ1 A;  2I8D A;  1EZV I;  3L70 G;  2GUS A;  2BCC D;  3C8V A;  1VQ9 P;  3P8M C;  2HOD A;  2O01 N;  3M9B A;  2ZYG A;  1VQ6 P;  1AVY A;  1G2C B;  2B88 A;  1KB9 D;  3B5N B;  1X22 A;  2W6J H;  5GTI E;  1T2K C;  5TJH A;  3SFE C;  1G1J A;  4JPZ B;  2XNX C;  1RE4 B;  1Y9B A;  3WUT A;  2E5Y A;  1NTZ K;  1URQ A;  2N1T D;  3RK2 B;  3V6I A;  1YQ4 C;  1GK6 A;  2M3B A;  3L74 G;  1USD A;  2QJP C;  2J3F A;  5AVZ B;  1VPC A;  3VP9 A;  2WSE J;  5KLI B;  2BEQ D;  1WRG A;  2FYN B;  2NPS D;  4OVN F;  1H89 A;  3V2R A;  1OX3 A;  1BSN A;  4TT3 H;  1S5L X;  1ZV8 A;  1E79 H;  2OYH C;  1M1K Q;  2WWW A;  2BEZ F;  2LXC B;  1J1E B;  4WB4 A;  1PP9 E;  3PHL A;  5KAI E;  1FZC B;  3P8C E;  3HTK B;  1VQP P;  1N73 C;  4GDO A;  2XV5 A;  5CBN A;  4L74 A;  3OAK A;  1QEX A;  1WMK A;  1ZOY C;  1KFN A;  4D6T J;  1RQV A;  4JZC A;  3GMA A;  1RF0 B;  1NKN A;  1VF5 C;  4IOI H;  4H44 B;  4PD4 E;  1FID A;  3SWY A;  2HLO A;  1IJD B;  2RH0 A;  2M5A A;  1NYH A;  1JCD A;  1NU1 G;  3H1K J;  2HFE D;  1NTK D;  1MFZ A;  4WY4 B;  3CXH H;  3L70 E;  3H1K D;  3JCU H;  3QH9 A;  1GL2 B;  3CCJ P;  4YXD C;  3TF5 A;  1YJN P;  1SQX K;  3A0H E;  1N73 A;  1M1J C;  1IK7 A;  3E1I B;  3A0B H;  1HJB A;  1JB0 J;  1JMB A;  1SP4 A;  3AE7 C;  2KSJ A;  3CLQ A;  2AXC A;  4UB6 H;  3L75 G;  4H13 C;  3RL0 C;  1W2E A;  2JHH C;  1CI6 A;  5AVX B;  5AVR B;  2R3S A;  5BVZ A;  1N7S D;  3U59 A;  3G3Z A;  2J59 M;  2ZT9 C;  3RL0 B;  2JHM F;  1XTG B;  3OA7 A;  1N7S C;  1JOC A;  1LWU B;  2CPS A;  1AQ5 A;  2E74 D;  2L5G B;  3GG2 A;  1VL2 A;  1BCC D;  5KJ7 C;  2J0Y A;  2AXT E;  2V7Q H;  3P32 A;  2HYN A;  3WMM 0;  1HBW A;  3B71 A;  1KOR A;  2OYI B;  2E75 D;  3BAT A;  2C0W A;  2QM7 A;  3L72 D;  1JUN A;  3Q2Y A;  5L8R J;  3S1K A;  2WSC J;  1L0L K;  2E42 A;  2KLU A;  1JY3 P;  3NTN A;  4ZFG A;  2QJK B;  4QMA A;  1H88 A;  2I1K A;  2B87 A;  1FDM A;  1EZV G;  2WSC H;  1FZF C;  2JJL A;  5KKZ C;  4ZKP A;  4Y99 C;  3FWN A;  2QG4 A;  1K73 Q;  1M1J A;  4I1L A;  2AEJ A;  1J1E C;  1KMI Z;  2P67 A;  1QL2 A;  3TGU G;  1L4A C;  1S9K E;  2FXM A;  1DIP A;  3ZDM A;  2FYN C;  1S5L H;  3L71 J;  2I1J A;  1N7S A;  3KPE A;  4Z1M H;  2NPS C;  1LTG C;  3L75 E;  2IX7 C;  1AJY A;  5BU5 A;  1LTJ A;  3G9R A;  1D7M A;  1NTZ E;  4PJ0 H;  1P84 E;  3AE6 C;  2KIK A;  2KZJ A;  1W2B O;  3EFF K;  1GZL A;  1FJP A;  1L0L E;  4W7Z A;  2Q6Q A;  1FS0 E;  3H1H E;  2XNX B;  4RO0 A;  2WT7 B;  1FJK A;  4I7Z B;  4JBZ A;  2NZ2 A;  3GLM A;  2O1J A;  2R5D A;  1FOS F; 
#chains in the Genus database with same CATH homology
 2XDJ A;  2WT7 A;  3L4F A;  1FBM A;  2H7H A;  1NAF A;  2YKQ A;  2HPC A;  1FZB A;  2XKM A;  3M0A A;  2HLO C;  3HD7 D;  1T2K D;  3EFG A;  2J3G A;  2ZFC A;  2POH A;  5AW5 B;  4DZO A;  4DOJ A;  1GU5 A;  3TK1 A;  2JHL F;  3M06 A;  5APQ A;  1MZ9 A;  2OYI A;  4EIJ A;  1J1D C;  1IFD A;  4N3Y B;  1S9K D;  3GHG A;  4KHX A;  3HD7 A;  4ZKU A;  1RF1 B;  4NYT A;  1LTJ B;  1RF1 C;  3HD7 C;  1JMM A;  4WY4 D;  5CMZ A;  1LWU C;  2YMY A;  3GHG B;  1JO5 A;  2Q9I A;  1J1D B;  2Z4E B;  4WY4 A;  1FZD A;  3PP5 A;  2QM8 A;  2C0X A;  1ZR4 A;  1FZE B;  3B5N D;  2WPQ A;  2O01 H;  5AW9 B;  3VN0 A;  2FFD A;  3P7K A;  1GU4 A;  2D39 A;  1YYC A;  2JHK F;  3CL3 D;  1LTI C;  2HLO B;  1PFI A;  1OWA A;  4WBA A;  3BRT B;  1NOH A;  1RF0 A;  3UIA A;  1SFC A;  2J1G A;  2YO3 A;  1CZQ A;  2KOG A;  3B5N A;  2N1T B;  3MUD A;  2HOD B;  3SWF A;  3V4W A;  3M9H A;  3KDP B;  2Z4E C;  2PP6 A;  1A02 F;  1N2D C;  2C9L Y;  3LID A;  1IO4 A;  3H32 C;  3HD7 B;  1KZU B;  1LTJ C;  1RF1 A;  3N7N A;  4LGD E;  1M1J B;  2YO2 A;  1WT6 A;  3V5B A;  2JEE A;  3M0D C;  1RE3 A;  5APX A;  5CCG D;  1Z56 A;  3RL0 D;  3KYQ A;  3A2A A;  3T97 A;  3VYI A;  1FOS E;  1FZC A;  2Z5I A;  2GUV A;  1GL2 C;  2R32 A;  3A3Y B;  5AW8 B;  4EPU A;  2KYV A;  1KIL C;  3RK3 D;  2HPC B;  2O1K A;  2JHI F;  1HGZ A;  2NPS B;  2GUS A;  1HUC A;  1AFO A;  3P8M C;  2HOD A;  5CJ0 A;  1T3U A;  3M9B A;  3HUS C;  4JYO X;  3HE4 A;  1G2C B;  1LT9 C;  2N1T A;  5KLV K;  2GY7 A;  1LT9 A;  3B5N B;  1Z3U A;  3L37 A;  2J64 A;  1SQP K;  1N86 C;  1FZA A;  1SFC B;  5AVQ B;  5CCH D;  1T2K C;  1G1J A;  2XNX A;  2WNP F;  3A5T A;  2XNX C;  1RE4 B;  2OYH A;  1L4A B;  5AW7 B;  5CCG A;  1FZG B;  1M7L A;  5AVT B;  1ZR2 A;  1NTZ K;  1URQ A;  2N1T D;  3RK2 B;  1OXZ A;  2J0H A;  2VRS A;  2WTY A;  4GKG A;  3L35 A;  4JYB A;  3BRV B;  1FU1 A;  1GK6 A;  2PAJ A;  1FIB A;  3LIE A;  1LTA C;  2M3B A;  3VMY A;  2P2U A;  3TNU B;  1FZG A;  1FZC C;  2H8P D;  5CCH C;  2FFD C;  1L4A A;  1GK4 A;  2J3F A;  5AVZ B;  4JYC A;  1SQB K;  3IFM A;  5APS A;  2A45 H;  5CCH A;  3NXS A;  1VPC A;  3VP9 A;  3BVH A;  2H43 C;  1FZB B;  2N9B A;  1WRG A;  4C7N B;  1EQ7 A;  2FKW B;  2NPS D;  1FZB C;  1N86 B;  2A45 G;  4IFD K;  1H89 A;  1N86 A;  3V2R A;  3U1A A;  1IFM A;  2ZXE B;  1GL2 D;  4AUW A;  5KJ7 D;  1ZV8 A;  2WPS A;  2OYH C;  1HTL C;  2WWW A;  2C9N Y;  1J1E B;  4WB4 A;  1H8A A;  2HPC C;  1KIL B;  1FZC B;  3HE5 B;  2WIT A;  3P8C E;  1GDT A;  4AQR D;  1RE3 B;  3VP8 A;  3VMZ A;  1L4A D;  3TNU A;  3HTK B;  4W80 A;  1JY3 O;  3E1I A;  2J3U A;  1GL2 A;  2P1J A;  1LTB C;  4W7Y A;  1JNM A;  2Q9I C;  3MIW A;  1N73 C;  3RK2 D;  4OH8 B;  5CJ4 A;  4B86 A;  2XV5 A;  2J60 A;  2E43 A;  1IK9 A;  4HYT B;  1KFM A;  3OAK A;  1LGH B;  3C9I A;  2H43 A;  1NTM K;  3BVH C;  4XA4 A;  1N7S B;  1N7L A;  1KFN A;  5APV A;  1IFN A;  4JZC A;  1RF0 B;  2N1T C;  1G1I A;  1NKN A;  3V2P A;  3OJA B;  1FID A;  5AW2 B;  3SWY A;  2HLO A;  1A02 J;  3HUS B;  1IJD B;  1L0N K;  4N6J A;  4IFF A;  5AVU B;  1JCD A;  4R9T A;  2R5B A;  3VOP A;  3N4X A;  2HFE D;  1MFZ A;  2W6B A;  1HGV A;  4LC1 A;  4WY4 B;  2OYI C;  1FZE C;  1IFI A;  1J2J B;  2OAR A;  1GL2 B;  2YKO A;  1SQX K;  1N73 A;  5APW A;  3E1I C;  2R3C A;  4HH2 A;  1LTS C;  1M1J C;  2WSF H;  1KIL D;  3RK3 C;  1LWU A;  3E1I B;  1X8Y A;  3HE5 A;  1JCC A;  3MGN A;  1HJB A;  1KIL A;  4M3L A;  1SP4 A;  2KSJ A;  3CLQ A;  1DEB A;  1NWQ A;  5CHX A;  5KJ7 A;  2HOD C;  3RL0 C;  1W2E A;  2J5Z A;  1NTK K;  1SQQ K;  2JHH C;  1CI6 A;  2IPP A;  5APY A;  1JTH A;  5AVX B;  2M8R A;  5AVR B;  5BVZ A;  1N7S D;  1NKZ B;  3MTU E;  1SLQ A;  1RY3 A;  2W6A A;  1JY2 N;  1HWT C;  3U59 A;  2KB7 P;  3G3Z A;  2J59 M;  4I2L C;  4R9J A;  3RL0 B;  2JHM F;  1XTC C;  2YKP A;  2GM4 A;  1XTG B;  3OA7 A;  1N7S C;  3H32 A;  5AVY B;  3H6P A;  3BVH B;  2FYZ A;  1X79 B;  1JOC A;  5AW0 B;  1NU1 K;  1LWU B;  2CPS A;  3GHG C;  1AQ5 A;  1X9V A;  1YTZ T;  3RK3 B;  1GW4 A;  5AW4 B;  4EOT A;  4M7H A;  1JY3 N;  5AVW B;  1N73 B;  2L5G B;  2Q9I B;  2YNY A;  3NFQ A;  1LTT C;  3BAS A;  4GT1 A;  5KJ7 C;  1SVF A;  2J0Y A;  1FIC A;  3P32 A;  4RES B;  2HYN A;  3WMM 0;  1HBW A;  3M91 A;  4LLH A;  4WY4 C;  1RE4 A;  2OYI B;  3FIB A;  3BAT A;  1SFC D;  1CW5 A;  2C0W A;  2QM7 A;  5BU8 B;  5AVV B;  1JUN A;  1MV8 A;  1ZN5 A;  2OYH B;  3V2N A;  3MD0 A;  1FAV A;  4N78 D;  2J3O A;  2CPB A;  1Z3S A;  1L0L K;  2J3F D;  2XZR A;  2E42 A;  2WSE H;  4C7R A;  4M7F A;  2Q7C A;  1FZA B;  1YTZ I;  2J61 A;  1RF0 C;  1CI6 B;  1IFJ A;  2WZ7 A;  2Q5U A;  4C7N A;  1JY3 P;  1JTH B;  3NTN A;  4ZFG A;  2H43 B;  2A45 I;  1H88 A;  2HG5 D;  2J0G A;  2Z5H A;  2NPS A;  1URQ D;  2I1K A;  3U1C A;  1FDM A;  1JY2 P;  1ZLL A;  3M0D A;  3TSI A;  2WSC H;  1FZF C;  1URQ C;  2FIB A;  2J58 A;  1HVV A;  3TYY A;  2JJL A;  4ZKP A;  5KTB A;  4Y99 C;  1RE3 C;  2KP8 A;  1GTW A;  3P8C D;  1DH3 A;  1FZF B;  5APT A;  1M1J A;  3RK2 C;  3NMD A;  4I1L A;  3CI9 A;  2LKM A;  1J1E C;  2P67 A;  1QL2 A;  4JF7 A;  1L4A C;  1S9K E;  3M9Q A;  2J61 B;  3HUS A;  3HRN A;  2FXM A;  2W27 A;  2XU6 A;  3VTP C;  2FYU K;  1IC2 A;  1GW3 A;  2Q3I A;  1SFC C;  4C46 A;  5AW1 B;  1QL1 A;  1NHL A;  2I1J A;  3VMX A;  1GD2 E;  4AYC A;  5AW3 B;  1N7S A;  1LT9 B;  1FZE A;  2MJZ A;  3HE4 B;  2IFM A;  1JC9 A;  2WPR A;  1T3J A;  2P7J A;  3KPE A;  3II6 A;  3O8Z A;  5AVS B;  5CCG C;  2NPS C;  3V4Q A;  1LTG C;  2FFD B;  4IFM A;  2IX7 C;  5BU5 A;  1LTJ A;  1HH0 A;  1JY2 O;  3HTK A;  4XE5 B;  4O9B A;  3L36 A;  1SQV K;  4Y99 B;  1FZF A;  2Z4E A;  3EQ2 A;  5AW6 B;  1DX7 A;  1VDF A;  1URQ B;  4N78 E;  1E5W A;  2J2P A;  1T8Z A;  3H32 B;  1FZG C;  1GZL A;  1FJP A;  4I6M C;  4W7Z A;  1NH4 A;  3LW5 H;  3V2Q A;  1RE4 C;  2XNX B;  2IFN A;  2WT7 B;  2BAS A;  3A7O A;  1FJK A;  1MUU A;  3KQG A;  3R2P A;  3IR9 A;  1FZA C;  1NO4 A;  2R5D A;  1KQL A;  3B5N C;  1G2C A;  1CSB A;  2KLV A;  4GIF A;  5APU A;  2O1J A;  3B8E B;  3I5C A;  1FOS F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...