1RF1C

Crystal structure of fragment d of gammae132a fibrinogen with the peptide ligand gly-his-arg-pro-amide
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
298
structure length
298
Chain Sequence
YEASILTHDSSIRYLQEIYNSNNQKIVNLKEKVAQLAAQCQEPCKDTVQIHDITGKDCQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQSAIPYALRVELEDWNGRTSTADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEGNCAEQDGSGWWMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIPFNRLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Calcium-Binding Site beta2, Adjacent to the "b" Polymerization Site, Modulates Lateral Aggregation of Protofibrils during Fibrin Polymerization.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
molecule keywords Fibrinogen alpha/alpha-E chain
total genus 91
structure length 298
sequence length 298
chains with identical sequence F
ec nomenclature
pdb deposition date 2003-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1rf1C01
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 1rf1C02
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 1rf1C03
4R9TA 2HODA 2JHLF 2J0YA 2J64A 3FIBA 1FZGB 1T3UA 2H43A 2OYIC 2HPCC 1RF0A 2OYHA 3HUSA 3E1IB 2J0GA 1FZGC 1RE3C 3H32B 1RF1C 1N86B 2OYIB 2J3OA 1JY2P 1M1JA 2HODC 1FZBB 2HPCB 4R9JA 1FZCC 4JYOX 2H43C 1JC9A 2OYIA 1FZFA 1RF1B 2J3UA 2J5ZA 3H32C 1FIDA 1JY3N 1LT9C 2FFDC 1W2EA 2FIBA 2HLOA 2HODB 2J3FD 2J60A 1FZBC 1LWUB 1Z3UA 2WNPF 1LTJC 1LT9B 1Z3SA 1FZAA 2Z4EA 2HLOB 2J61B 3HUSC 3GHGB 3BVHA 1LT9A 1LWUC 2OYHB 1N73B 1RE4B 1FZBA 1JY3P 1RE3B 2JHMF 1FZCA 3E1IA 3HUSB 2Q9IA 1FZAC 4JZCA 4M7FA 3H32A 2J1GA 2JHKF 1FZFC 2A45H 2OYHC 1N73C 1N86A 1RE4C 1FZGA 1FZEC 1JY2N 2J2PA 2J61A 1JY3O 2D39A 1LTJA 1JY2O 2H43B 1FZEB 1RE3A 3E1IC 2Q9IC 4NYTA 4M7HA 1RF0C 1M1JC 2J3GA 1RE4A 1N86C 1FZEA 3BVHB 2JHIF 2A45I 1RF0B 1FZCB 2HPCA 2Q9IB 1FZDA 2FFDA 1M1JB 3GHGC 1RF1A 2Z4EB 2FFDB 2J3FA 1N73A 1FIBA 4ZFGA 3BVHC 2XNXB 2XNXA 1LTJB 4EPUA 2Z4EC 1FZAB 2GY7A 2J0HA 1FICA 1FZFB 1LWUA 2XNXC 3GHGA 2JHHC 2A45G 2HLOC
chains in the Genus database with same CATH superfamily
5APVA 1H89A 4IFMA 2E75D 2J64A 3AE4C 4L76A 5TISE 2J58A 1PGOA 3W67A 3WU2E 2E75B 3H1HD 5AW2B 2FYZA 3MTUE 2IBZD 2J3OA 1JY2P 3V2QA 4D6TD 1FZBB 1AVYA 1NH4A 1TU3F 4PD4D 2H7HA 1OW6A 1OXZA 2LKMA 1SVFA 4UB8H 3JCUE 1IC2A 3H1JG 2P10A 3KZIE 2B89A 1L0ND 1NO4A 2CK3H 1FZBA 2XKMA 4GDOA 4Y99C 1R8EA 4HYTB 1NWQA 1L4AD 2KOGA 4JQ0D 1JMMA 4EI2A 1HGVA 3RL0g 2N1TA 3A0HH 1GMJA 2M0BA 4U7JA 1EC5A 1RE3A 3E1IC 3EFFK 2Q9IC 1JO5A 1PL5A 1QVGO 4OGQB 1UIXA 2YIUB 3H1JE 1NAYA 3MHVA 2IFNA 4UB6E 2FFDA 1EDJA 2Z4EB 1NTZD 2ZT9B 1M7LA 2FYNB 3R2PA 3M0DC 4UB8E 5AVWB 1SQXE 3L72J 3CMEP 2Q6QA 4NPEA 1EQ7A 3M0AA 1AFOA 1GL2C 2E42A 2H43A 5CBOA 4C7NB 4W7ZA 1JOCA 2IBZG 4W80A 2W6BA 2ZYAA 1N86B 1OW7A 3HD7B 2H43C 2I8DA 2QRXA 2RH0A 1KB9D 1X79B 3CCRP 5AVSB 1U7JA 3L74J 1OMIA 5CCGC 1N7SD 3AE3C 3KDPB 1LNQA 1IFMA 2C9NY 1E5WA 1L2PA 3V4QA 2Q3EA 1GL2D 1OFCX 2JHKF 2J2PA 4BRYB 2KB7P 3GLMA 4UB6H 3WUUA 3H6PA 4PD4H 1JY2O 1S5LH 4HH2A 4PJ0E 1LGHB 4PJ0H 3AE9C 3PTZA 3VTPC 2PP6A 1FZEA 3PH0A 1KC8Q 3V4WA 1P84D 1VQ6P 5AW0B 1CSBA 2NPSB 3ABVC 1DEEG 3BRVB 1SQPE 1KILD 1SQVG 3BCCJ 3P32A 3C1LA 1FZFB 1KYOE 3CCSP 4NPFX 2JHLF 3L37A 4PV1C 4LGDE 3E1IB 4JPZB 2GUSA 4N6JA 4OH8B 3TGUE 1NU1G 2HODC 4JYOX 1EZVE 1FZFA 1JUNA 1EDLA 1HGZA 1KFMA 1L4AC 3AE5C 1Q90D 1LT9B 2N1TB 3USSA 3IAOA 3GHGB 2WPQA 5CBNA 1SQQJ 2Q9IA 1YBKA 2FXMA 3H32A 4OVNF 3VOPA 1YIJP 3S9OA 1T6AA 2D39A 1X8YA 1BDDA 4I7ZB 1VQ5P 3CC4P 3CXHE 1KYOD 1NTKK 1PZQA 2E76B 4IFDK 3QWOC 3L4FA 3E7KA 5KLVD 2Q9IB 3L75G 4K3AA 5AW8B 1JCCA 2IDBA 1N7SB 3NTNA 1KB9E 1KB9H 3S1KA 3AEAC 3GW6A 5B66H 5AVQB 4M3LA 3R4YA 2XV5A 2J0YA 2KZIA 2L91A 1BCCD 4I2LC 1JTHB 2HPCC 3RK3B 2UWJE 2K9JA 2HPCB 2Q7CA 3RL0B 1FZCC 1IFPA 3VMYA 3PJSK 1BSNA 3WU2H 3A0BE 4L73A 5APSA 1S5LX 2A06E 3BCCE 2KS1B 1YTZT 2E43A 1Z3SA 1S1CX 1ZV8A 1T8ZA 4BRYA 1KZUB 2KUBA 2JO1A 2XZRA 3B5NB 3CCLP 5GTIH 2KP8A 5GTHE 3CWBJ 1FAVA 3IFMA 1RE3B 1BSHA 4JBZA 2JJLA 3FWLA 1FZEC 2AXTH 1BCCJ 3RK3D 1JEKA 3V2RA 2E74B 2DW3A 3AECC 1VL2A 1PV3A 2BEZF 3P8CE 2J3GA 1VF5B 2PFXA 4C7RA 3RK2B 1G2CA 5B5EE 2BCCJ 3GHGC 1LJ2A 3BVHC 1S4XA 2B87A 3LW5J 2MKVA 3L75J 2JDIH 5CHXA 1CI6B 2FXOA 2HODA 5BU5A 1OVUA 1IK9A 4DT0A 3L70G 2FYUK 1PGQA 2OYHA 2RMZA 3AE7C 2H88C 2D2CC 3L71J 2OYIB 5APTA 3TNUA 2E74D 3LIEA 1SQQD 3P8MC 3V6IA 2PRRA 1K8AQ 5APYA 2KZJA 2HODB 3RGUA 4WVZA 3T97B 2W27A 1T2KD 3CD6P 2GM4A 2YKPA 1N73B 5BVZA 3V2PA 3VMZA 2C9LY 1GU4A 1FBMA 1SQBD 5APXA 4KT0J 5KLVJ 2FYUJ 5AVXB 4WB4A 1S9KE 3TF5A 4IL6X 1ZRTD 1GL2B 1R5SA 4H44C 3V5BA 3T97A 2O3JA 1L4AB 2O01N 3N7NA 1E79H 3CMAP 2N1TC 5CMZA 2ZT9C 2JR8A 3B4SA 1P84H 1PPJE 1NTZG 3HD7C 4H13B 3H1LG 5AW6B 3I56P 1L0NK 1SQBJ 1WMKA 3CWBE 3U1CA 4XA4A 3L35A 3CCEP 2ZYGA 3G9RA 3OJAB 1YI2P 1FICA 1RF0A 2QSIA 3CL3D 1H8AA 1SFCD 3G6EP 2Z5IA 2Q3IA 3BCCD 1G1JA 1VF5C 1J1EB 4RKUJ 3F5HA 3H1JJ 2IFMA 2W8ZA 4BXLA 3KXDA 3L73G 1QLED 2W90A 3FX0A 1BCCE 1KILA 2M8RA 1NTKG 3KQGA 3NXSA 1IFIA 1SQBG 1LWUC 1X0TA 2LR2A 2ITAA 1Y8AA 4AUWA 1N7SC 1SQBK 1L0NJ 3VYIA 3CX5D 2JWDA 2A45H 1AJYA 1N86A 4WY4C 1KQSO 2J59M 3O6QA 3CC7P 3Q2YA 2KK7A 5K5GB 2QJKB 4WY4B 3AE2C 4NYTA 4M7HA 3JCUH 1NVOA 1KQGB 1GK6A 3H1LD 3RBZA 1NTMK 1DD3A 3M9QA 1VPCA 1KILC 4ZFGA 1FIBA 4ZKPA 3AE1C 3L71E 2XNXA 2FKWB 5AVTB 3L70J 3B5ND 2BEQD 2E5YA 2J0HA 2A45G 2OGUA 4TLFA 3OAKA 3BCCG 2G3AA 2ZXEB 3IN6A 4JF7A 3K5BA 3SSUA 1M90Q 2P58A 4Y28J 1SQXG 2AEFA 4WY4D 3S4RA 5AW3B 3H1JD 1IK7A 4K35A 4W7YA 3L73D 3MP7B 5APUA 2J3FD 4QMAA 3TDKA 1NYHA 1NTKD 1Q86Q 1BGYJ 4OGQD 5AVVB 3Q5SA 4U3FE 3EFGA 3W68A 1WRGA 1NTMJ 1ZOYC 1JY3P 4XE5B 2O01H 3E1IA 1EZVI 5KLVK 3H1HJ 3HE5B 4AYCA 1PP9G 2WSEH 3TSIA 4RO0A 1NTKE 1GZLA 1KB9I 1UIIA 2YIUC 2R3CA 1MFTA 2B87B 3L75D 3VMAA 1FJKA 2FYUD 1RF0B 1YJNP 5B66E 1K73Q 4R4LA 1RF1A 1Q82Q 2I1KA 1H88A 2P1JA 2JEEA 3CX5H 3FGAD 2OTLP 1S2EA 1R5LA 2HLOC 1RHZB 2YKOA 2N1TD 2QE7H 3N4XA 2XNDH 4N78E 2BCCE 5KKZB 5AW4B 2P67A 1SQPG 2R44A 2WSFH 2YMKA 4U3FG 2I1JA 4KHXA 2WPSA 1U57A 2NRGA 2J5ZA 1JY3N 2M3EA 2FFDC 1SQXJ 5KJ7A 2QVAA 2ZYDA 1N7SA 3HTKB 5AW7B 4XFJA 1D7MA 3SFEC 2FYUE 3HRNA 1PFIA 2Q1KA 5AVUB 1RE4B 3Q1MA 3A2AA 1YITP 5GTHH 1GL2A 3V2NA 1PP9D 1VQ4P 2WSSH 3H1IJ 2E74C 1L0NG 1LP1B 3AEDC 3HTKA 1BE3G 2CPBA 3CWBG 2XU6A 4GOEA 2W83C 1SQPK 1FZEB 3MUDA 3H1LE 3L70E 1JCDA 3IF4A 1RE4A 4AQRD 1RQUA 3C8VA 1Q7YQ 3U59A 1HWTC 1SQQK 3B5NA 2KIKA 3Q5PA 4GODA 2FY8A 2YNYA 1RY3A 3PRJA 4CPGA 3L70D 4PV1B 1IFJA 3B5NC 4HKZH 3Q3DA 1NU1D 5C39A 1KV4A 1FZGC 1PIXA 4OGQC 3G71P 2WT7B 1G2CB 3H1KJ 1YJWP 5CCGA 4IFFA 2IZ0A 1LT9C 2IBZE 2QJPB 5KAIE 1PGJA 2V4HA 2AXCA 1QEXA 4YTPC 1SQVJ 3HE4A 2Y9YA 3VP9A 4H13C 4LC1A 2QM8A 2OYHB 3LW5H 1QL1A 4JYCA 1NTZK 1CW5A 2FYNC 1GK4A 1M56D 1YHQP 1LTSC 1VQ7P 1FZGA 1XTCC 1JY2N 5AVYB 1HH0A 2M5AB 4YXDC 2K1AA 3CXHH 1A02J 4I7ZC 2KI7B 3M9HA 1L0NE 2JHIF 2OTKE 1L0LK 1ZRTE 2O1JA 3L74E 3WUTA 3UIAA 1M1JB 3F89A 3IR9A 1S9KD 1N73A 2QIWA 4R4MA 4LLHA 1S72P 1LTBC 1HTLC 2IYPA 1KYOH 3P8CD 1Z56A 1JTHA 3KHUA 3RK3C 1FDMA 3FXEA 1J1DB 2ZFCA 3L72E 2J0GA 5H2FH 3GF7A 1LTGC 3C9IA 1SFCB 1BGYE 1JC9A 5CCHD 2J3UA 2LXCB 4U3FJ 5KTBA 3G3ZA 1Z3UA 1GTWA 1GU5A 1LTJC 1NOHA 4DJGA 2HLOB 3VP8A 1IJDB 1KMIZ 3BVHA 1H0TB 1K05A 1JNMA 1EZVG 3TYYA 1G1IA 4MN4C 2YO2A 1URQD 1HVVA 3CXHD 4JZCA 1PPJG 1MUUA 2GA1A 5CCHC 2XDJA 4N3YB 1Q81Q 2WITA 1NTME 5BU8B 3RK2C 2GUVA 1HF9A 4NPDA 4EOTA 1VQPP 3H1ID 1AVOA 3L71D 2WPVB 3H1HE 3SWYA 2C0XA 2WSCH 2AEJA 2HYNA 1OIPA 4RJTA 2OYOA 1KQLA 2FFDB 5KLVE 4EPUA 3MUDC 1FZAB 2H89C 3L75E 4DCKA 3I5CA 1QL2A 3CCJP 3KZIH 3TGUD 1S3JA 5APWA 3VN0A 1HUCA 2OYIC 1GW3A 2A06D 4D6TJ 3CPWO 5E79E 1EDIA 4L74A 1ZXGA 2K37A 1BCCG 2QJKC 5DJUB 4ZKUA 3H32C 2P7JA 3AEGC 1USEA 3AEEC 2IYOA 1GDTA 2J60A 3L36A 3O8ZA 4GIFA 5AW1B 4Y99B 5KJ7C 5AW5B 1OVVA 1VDFA 4ZNCA 1EZVD 2KNCA 2R5BA 1LTIC 3A7OA 2Q5UA 1FZFC 3RK3E 2WMMA 4HB1A 2OYHC 1N73C 2N9BA 1L4AA 3MZWB 2MJZA 2POHA 3AE8C 1S5LE 5TISH 1W2BO 3Q5RA 1EDKA 3JSVC 1FS0E 4H44B 2O1KA 3L71G 2A45I 1X9VA 1URQB 3B8EB 2R3SA 5KAFE 2YXQB 3ZDMA 3H1KG 1KYOI 3HE5A 2FBWC 3II6A 3E1RA 2Z4EC 2KLVA 4PD4I 1CI6A 1W5CE 4EYYQ 1LWUA 3CI9A 2PGDA 1NU1J 1URQA 3O6QB 1T3JA 3HUSA 3H1KE 1RE3C 4B86A 1RF1C 3U1AA 1ZR2A 1CZQA 1KN7A 1SQBE 3WMM0 1NTZJ 2JWAA 1RF1B 4H0LD 4ASVA 1GW4A 3QH9A 2E76C 2FIBA 3CXHI 4GOFA 1DH3A 5CCHA 1N8RQ 5CCGD 3A3YB 3BATA 4RESB 1SQQG 1K9MQ 2Z4EA 2RKLA 4ZMDA 3MD0A 3CC2P 2HFED 1MFZA 1JM0A 1YYCA 2WZ7A 2Y9ZA 3D6ZA 2JHMF 1FZCA 1NTMG 1BE3D 3CWBD 1A02F 2YMYA 3ITKA 1QX8A 1ZMEC 2NPSD 2V7QH 4WBAA 1LTJA 5KLVG 4TT3H 5KKZC 2OQQA 4A7PA 3FXDA 1J2JB 3M06A 2QA4P 4EDFA 2D2CB 2VRSA 1FZCB 3G4SP 1FZDA 1L0LD 4I6MC 3M9BA 2WPRA 3H1KD 2K88A 4DZOA 2BASA 5KAIH 5M1BA 1LTJB 1WT6A 1LTTC 1NTKJ 2HG5D 1MV8A 1BGYG 4H44D 3FIBA 1T3UA 4JYBA 1SLQA 1Q2NA 1IO4A 5KLIC 1FDOA 1L0LE 1NHLA 3H1HG 1Y9BA 1NKZB 2QJYC 2IBZI 2KYVA 1FC2C 2L5GB 3BASA 3GG2A 4H13D 1KTMA 1FZBC 1Y47A 2LXBA 4EIJA 1AQ5A 3AE6C 1BE3E 3SWKA 4N78D 3PHLA 3L74G 1LT9A 3CLQA 1M1KQ 1QVFO 2M3BA 2WTYA 1NTMD 2K3RA 1IZNB 1SQQE 1FZAC 5APQA 1GD2E 1NTZE 2Y0CA 3M0DA 3A0HE 1JY3O 2H43B 2O01J 3L73J 3CCVP 1YTZI 1J1DC 1RF0C 1AV1A 1M1JC 2ZVNB 3OA7A 1L0LG 2WSCJ 3D71A 3BRTB 4YPCA 3CCMP 2W6AA 2WQYC 2XNXB 4GKGA 4O9BA 4HJGH 3A0BH 1HBWA 1VQLP 3RBXA 1DIPA 5CJ0A 2H8PD 2XNXC 4R9TA 2P2UA 5TJHA 4Z1MH 1BDCA 4U3FD 3GMAA 1OZHA 2R32A 1SS1A 1LP1A 5CJ4A 3RL0D 2OARA 3PLNA 1M1JA 1PP9E 1OW8A 1VQMP 2N9YB 2IZ1A 3TNUB 3AEBC 4IOIH 1VQ9P 2K9JB 1FIDA 4DOJA 1MKMA 3P7KA 1K04A 1YQ3C 1URQC 2C0WA 2QEXP 3L72D 5KJ7D 3L74D 1VQNP 1VF5D 1NU1E 2KS1A 4YXWH 1LTAC 1M57D 5B5EH 1N7LA 2E76D 1RH5B 5GTIE 4C46A 3VMXA 1U7MA 1DEBA 3SWFA 1SP4A 4L75A 1T2KC 5AVZB 2NPSA 1RE4C 2WWWA 3A5TA 2J61A 1SFCA 1KORA 3TGUJ 2ZJSE 1FU1A 1NKNA 5KAFH 1X22A 3H1LJ 1KQFB 3CX5I 2AEMA 2JKVA 1KILE 1USDA 2OTJP 3BVHB 1HJBA 1FOSF 3M91A 3KYQA 2ZT9D 4WWIA 1H0TA 1NGMB 1SFCC 3HE4B 2Y0DA 2J5UA 1JB0J 1L0LJ 1NAFA 1N2DC 2ZVOB 2GY7A 1SQVD 1YJ9P 3GHGA 1P84I 1DD4A 2K9YA 4D6TE 3TGUG 2NPSC 2WSFJ 3MGNA 1FZGB 3B71A 3KPEA 3RK2D 3OW2O 2KSJA 4OWFA 2A06G 2WT7A 3H32B 5EFWB 3H25A 2ZXXA 2QJPC 4R9JA 1IFNA 4C7NA 2IX7C 2OYIA 5KLIB 2E5TA 3L72G 2WNPF 2FXPA 3HD7A 1FZAA 4H0LC 1VQOP 3JC22 1KILB 2YXRB 2KSEA 4GT1A 1JMBA 5AVRB 2JP3A 2E75C 4M7FA 2KLUA 3D6YA 2V7QJ 2Z5HA 1AQTA 1P84E 2QJYB 3RL0C 4PD4E 1SQVE 1KFNA 3EWKA 3WUVA 4ASWA 1NU1K 2IPPA 1BE3J 2W6JH 1NJIQ 2HPCA 1EXIA 3NMDA 1VQ8P 4I1LA 2J3FA 4BWNA 1LT1A 2BCCG 3AEFC 1DX7A 2WSEJ 5AW9B 5DJTB 4IL6H 1SQVK 1OX3A 2JHHC 1M8OB 1SQXD 2R5DA 1FE6A 1IFDA 4KJMA 1RQVA 2Y0EA 1J1EC 3EQ2A 1SQPJ 1OWAA 3PP5A 1ZR4A 2KXPB 3SFDC 2YKQA 2CPSA 1MZ9A 1ZLLA 1PGPA 1ZW0A 1HJ0A 4D6TG 1XTGB 1FOSE 1FJPA 2G8YA 3LIDA 1W2EA 3GF3A 2HLOA 2D2CD 1ZP0C 1LWUB 1QGKB 5L8RJ 1ZN5A 1KD1Q 2RN0A 2HR3A 3MIWA 2J61B 3CCQP 3HUSC 3H1IE 1SQXK 1PPJD 1PP9J 1AA0A 1OVRA 3I55P 3NFQA 3HUSB 2B9BA 2J1GA 5E79H 2QM7A 1EXJA 1VQKP 2FYUG 3H1IG 2M5AA 2PAJA 3CCUP 1N86C 4WY4A 3FWNA 2SPZA 2AXTE 1YQ4C 4H0LB 4IL6E 2NZ2A 2QG4A 4PV1D 2BCCD 3D70A 3CX5E 2YO3A 2WVRA 3HD7D 3L73E 2B88A 2ZAEB 5H2FE 3TK1A 2KNCB 1BGYD 1FDIA 1SQPD
chains in the Genus database with same CATH topology
2HODA 1IFJA 3B5NC 5APVA 4IFMA 1H89A 5BU5A 2J64A 3FIBA 1IK9A 1T3UA 4JYBA 2FYUK 1SLQA 2J58A 1IO4A 2OYHA 1FZGC 5AW2B 2FYZA 2OYIB 3MTUE 2J3OA 1JY2P 1NHLA 3V2QA 5APTA 3TNUA 1FZBB 2WT7B 1G2CB 3LIEA 1NKZB 3P8MC 5CCGA 4IFFA 1NH4A 1LT9C 2KYVA 2L5GB 5APYA 3BASA 2H7HA 1OXZA 2HODB 2LKMA 1SVFA 1FZBC 1IC2A 4EIJA 3HE4A 1AQ5A 3VP9A 2W27A 1T2KD 4N78D 2GM4A 1LT9A 3CLQA 2YKPA 4LC1A 2QM8A 2OYHB 3LW5H 1N73B 1NO4A 1QL1A 4JYCA 5BVZA 3V2PA 2M3BA 3VMZA 1FZBA 2XKMA 2WTYA 1FBMA 4Y99C 5APXA 1GU4A 1NTZK 2C9LY 1CW5A 1GK4A 4HYTB 1NWQA 1FZAC 5APQA 1L4AD 2KOGA 1GD2E 1LTSC 5AVXB 1JMMA 4WB4A 1HGVA 1XTCC 1FZGA 2N1TA 1S9KE 1JY2N 3M0DA 5AVYB 1JY3O 1GL2B 1HH0A 2H43B 1RE3A 3V5BA 3T97A 3E1IC 2Q9IC 1JO5A 1L4AB 1YTZI 1J1DC 1RF0C 1M1JC 1A02J 3N7NA 3M9HA 2N1TC 5CMZA 3OA7A 2JHIF 1L0LK 2O1JA 3HD7C 5AW6B 3BRTB 3UIAA 2IFNA 2FFDA 1M1JB 1L0NK 3IR9A 2Z4EB 1S9KD 1N73A 3U1CA 2W6AA 4XA4A 2XNXB 1M7LA 4GKGA 3L35A 4O9BA 3R2PA 3M0DC 1HBWA 4LLHA 5AVWB 3OJAB 1LTBC 1HTLC 3P8CD 1FICA 1Z56A 1EQ7A 5CJ0A 2H8PD 2XNXC 1JTHA 1RF0A 3M0AA 1AFOA 1GL2C 4R9TA 2P2UA 3RK3C 3CL3D 2E42A 2H43A 1H8AA 1SFCD 2R32A 4C7NB 1FDMA 5CJ4A 1J1DB 2ZFCA 4W7ZA 2Z5IA 2Q3IA 2J0GA 1JOCA 3RL0D 2OARA 4W80A 2W6BA 1G1JA 1N86B 1M1JA 1J1EB 1LTGC 3HD7B 3C9IA 3TNUB 1SFCB 2H43C 1JC9A 5CCHD 2J3UA 1FIDA 2IFMA 4DOJA 1X79B 5KTBA 3G3ZA 5AVSB 1Z3UA 3P7KA 1GTWA 1GU5A 1LTJC 5CCGC 1NOHA 1URQC 2C0WA 5KJ7D 1KILA 1N7SD 2HLOB 2M8RA 3KDPB 3VP8A 1IJDB 1IFMA 1LTAC 3KQGA 3NXSA 3BVHA 2C9NY 1IFIA 1N7LA 1LWUC 1E5WA 3V4QA 4AUWA 1JNMA 1N7SC 1SQBK 3TYYA 1G1IA 4C46A 3VMXA 2YO2A 1URQD 3VYIA 1HVVA 4JZCA 1DEBA 1GL2D 3SWFA 1SP4A 1T2KC 2JHKF 5AVZB 2NPSA 2A45H 1N86A 1RE4C 1MUUA 2WWWA 4WY4C 3A5TA 2J59M 2J2PA 5CCHC 2J61A 2KB7P 2XDJA 3H6PA 1SFCA 4N3YB 1JY2O 4WY4B 1FU1A 1NKNA 4NYTA 2WITA 4HH2A 4M7HA 5BU8B 1LGHB 3RK2C 3VTPC 2PP6A 2GUVA 1FZEA 3BVHB 1HJBA 1FOSF 3M91A 1GK6A 3KYQA 4EOTA 1NTMK 1SFCC 3SWYA 2C0XA 2WSCH 3M9QA 3V4WA 2HYNA 3HE4B 1VPCA 1KILC 5AW0B 1KQLA 2FFDB 4ZFGA 1FIBA 4ZKPA 1CSBA 2NPSB 2XNXA 2FKWB 1NAFA 5AVTB 4EPUA 3BRVB 3B5ND 1N2DC 1KILD 1FZAB 2GY7A 3P32A 2J0HA 1FZFB 3GHGA 2A45G 3I5CA 2NPSC 1QL2A 2JHLF 3L37A 3MGNA 1FZGB 3KPEA 3RK2D 2KSJA 3OAKA 3VN0A 5APWA 2OYIC 1HUCA 1GW3A 2ZXEB 4LGDE 3E1IB 2WT7A 4JF7A 2GUSA 4N6JA 3H32B 4OH8B 4WY4D 2HODC 5AW3B 4R9JA 4JYOX 1IFNA 4C7NA 4ZKUA 4W7YA 2IX7C 2OYIA 1FZFA 3H32C 2P7JA 1JUNA 5APUA 1HGZA 1KFMA 2J3FD 1GDTA 2J60A 1L4AC 3L36A 2WNPF 3O8ZA 1LT9B 4GIFA 5AW1B 3HD7A 2N1TB 1FZAA 4Y99B 5AVVB 5KJ7C 1KILB 5AW5B 3GHGB 1VDFA 2WPQA 3EFGA 1WRGA 4GT1A 2R5BA 1JY3P 4XE5B 5AVRB 1LTIC 3A7OA 2O01H 3E1IA 2Q5UA 2Q9IA 2FXMA 4M7FA 3H32A 5KLVK 1FZFC 3HE5B 4AYCA 2OYHC 1N73C 3VOPA 2N9BA 2WSEH 2Z5HA 3TSIA 1L4AA 1GZLA 2MJZA 2D39A 2POHA 1X8YA 3RL0C 2R3CA 1KFNA 1NTKK 4IFDK 2O1KA 1NU1K 2IPPA 1FJKA 2A45I 1X9VA 3L4FA 1RF0B 1URQB 3B8EB 2HPCA 2Q9IB 3NMDA 1RF1A 5AW8B 1JCCA 4I1LA 2I1KA 2J3FA 1H88A 2P1JA 2JEEA 3HE5A 3II6A 1N7SB 3NTNA 2Z4EC 1DX7A 2KLVA 5AW9B 1CI6A 1LWUA 1SQVK 2JHHC 2HLOC 5AVQB 4M3LA 2YKOA 3CI9A 2R5DA 2N1TD 1IFDA 2XV5A 2J0YA 3N4XA 4N78E 1J1EC 3EQ2A 1URQA 1OWAA 4I2LC 3PP5A 1JTHB 2HPCC 1T3JA 1ZR4A 3RK3B 3HUSA 5AW4B 1RE3C 2P67A 4B86A 1RF1C 2YKQA 2CPSA 3U1AA 1ZR2A 2WSFH 1CZQA 1MZ9A 1ZLLA 2I1JA 4KHXA 2HPCB 3WMM0 2Q7CA 3RL0B 2WPSA 1FZCC 3VMYA 1XTGB 1RF1B 2J5ZA 1FOSE 1FJPA 1JY3N 1GW4A 3LIDA 2FFDC 1W2EA 2FIBA 2HLOA 1DH3A 5APSA 5KJ7A 5CCHA 1N7SA 1LWUB 1YTZT 5CCGD 3A3YB 3BATA 3HTKB 4RESB 5AW7B 2E43A 1Z3SA 1ZN5A 2Z4EA 1ZV8A 3MIWA 1T8ZA 2J61B 3HUSC 1KZUB 1SQXK 1PFIA 3HRNA 5AVUB 2XZRA 3MD0A 1RE4B 3A2AA 2HFED 3B5NB 1GL2A 3V2NA 2KP8A 1MFZA 1FAVA 3IFMA 3NFQA 1YYCA 2WZ7A 1RE3B 2JHMF 1FZCA 3HUSB 2J1GA 2JJLA 1A02F 1FZEC 2YMYA 2QM7A 3HTKA 2NPSD 2CPBA 2XU6A 4WBAA 1LTJA 3RK3D 1SQPK 1FZEB 3MUDA 3V2RA 1J2JB 3M06A 2PAJA 1JCDA 3P8CE 2J3GA 1RE4A 4AQRD 1N86C 4WY4A 2VRSA 4C7RA 3RK2B 1FZCB 1G2CA 1FZDA 4I6MC 3M9BA 3U59A 2WPRA 3GHGC 1HWTC 1SQQK 4DZOA 3B5NA 2BASA 3BVHC 2YO3A 1LTJB 3HD7D 2YNYA 1WT6A 3TK1A 1LTTC 1RY3A 5CHXA 1CI6B 2HG5D 1MV8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R9T A;  2HOD A;  2JHL F;  2J0Y A;  2J64 A;  3FIB A;  1FZG B;  1T3U A;  2H43 A;  2OYI C;  2HPC C;  1RF0 A;  2OYH A;  3HUS A;  3E1I B;  2J0G A;  1FZG C;  1RE3 C;  3H32 B;  1RF1 C;  1N86 B;  2OYI B;  2J3O A;  1JY2 P;  1M1J A;  2HOD C;  1FZB B;  2HPC B;  4R9J A;  1FZC C;  4JYO X;  2H43 C;  1JC9 A;  2OYI A;  1FZF A;  1RF1 B;  2J3U A;  2J5Z A;  3H32 C;  1FID A;  1JY3 N;  1LT9 C;  2FFD C;  1W2E A;  2FIB A;  2HLO A;  2HOD B;  2J3F D;  2J60 A;  1FZB C;  1LWU B;  1Z3U A;  2WNP F;  1LTJ C;  1LT9 B;  1Z3S A;  1FZA A;  2Z4E A;  2HLO B;  2J61 B;  3HUS C;  3GHG B;  3BVH A;  1LT9 A;  1LWU C;  2OYH B;  1N73 B;  1RE4 B;  1FZB A;  1JY3 P;  1RE3 B;  2JHM F;  1FZC A;  3E1I A;  3HUS B;  2Q9I A;  1FZA C;  4JZC A;  4M7F A;  3H32 A;  2J1G A;  2JHK F;  1FZF C;  2A45 H;  2OYH C;  1N73 C;  1N86 A;  1RE4 C;  1FZG A;  1FZE C;  1JY2 N;  2J2P A;  2J61 A;  1JY3 O;  2D39 A;  1LTJ A;  1JY2 O;  2H43 B;  1FZE B;  1RE3 A;  3E1I C;  2Q9I C;  4NYT A;  4M7H A;  1RF0 C;  1M1J C;  2J3G A;  1RE4 A;  1N86 C;  1FZE A;  3BVH B;  2JHI F;  2A45 I;  1RF0 B;  1FZC B;  2HPC A;  2Q9I B;  1FZD A;  2FFD A;  1M1J B;  3GHG C;  1RF1 A;  2Z4E B;  2FFD B;  2J3F A;  1N73 A;  1FIB A;  4ZFG A;  3BVH C;  2XNX B;  2XNX A;  1LTJ B;  4EPU A;  2Z4E C;  1FZA B;  2GY7 A;  2J0H A;  1FIC A;  1FZF B;  1LWU A;  2XNX C;  3GHG A;  2JHH C;  2A45 G;  2HLO C; 
#chains in the Genus database with same CATH topology
 5APV A;  1H89 A;  4IFM A;  2E75 D;  2J64 A;  3AE4 C;  4L76 A;  5TIS E;  2J58 A;  1PGO A;  3W67 A;  3WU2 E;  2E75 B;  3H1H D;  5AW2 B;  2FYZ A;  3MTU E;  2IBZ D;  2J3O A;  1JY2 P;  3V2Q A;  4D6T D;  1FZB B;  1AVY A;  1NH4 A;  1TU3 F;  4PD4 D;  2H7H A;  1OW6 A;  1OXZ A;  2LKM A;  1SVF A;  4UB8 H;  3JCU E;  1IC2 A;  3H1J G;  2P10 A;  3KZI E;  2B89 A;  1L0N D;  1NO4 A;  2CK3 H;  1FZB A;  2XKM A;  4GDO A;  4Y99 C;  1R8E A;  4HYT B;  1NWQ A;  1L4A D;  2KOG A;  4JQ0 D;  1JMM A;  4EI2 A;  1HGV A;  3RL0 g;  2N1T A;  3A0H H;  1GMJ A;  2M0B A;  4U7J A;  1EC5 A;  1RE3 A;  3E1I C;  3EFF K;  2Q9I C;  1JO5 A;  1PL5 A;  1QVG O;  4OGQ B;  1UIX A;  2YIU B;  3H1J E;  1NAY A;  3MHV A;  2IFN A;  4UB6 E;  2FFD A;  1EDJ A;  2Z4E B;  1NTZ D;  2ZT9 B;  1M7L A;  2FYN B;  3R2P A;  3M0D C;  4UB8 E;  5AVW B;  1SQX E;  3L72 J;  3CME P;  2Q6Q A;  4NPE A;  1EQ7 A;  3M0A A;  1AFO A;  1GL2 C;  2E42 A;  2H43 A;  5CBO A;  4C7N B;  4W7Z A;  1JOC A;  2IBZ G;  4W80 A;  2W6B A;  2ZYA A;  1N86 B;  1OW7 A;  3HD7 B;  2H43 C;  2I8D A;  2QRX A;  2RH0 A;  1KB9 D;  1X79 B;  3CCR P;  5AVS B;  1U7J A;  3L74 J;  1OMI A;  5CCG C;  1N7S D;  3AE3 C;  3KDP B;  1LNQ A;  1IFM A;  2C9N Y;  1E5W A;  1L2P A;  3V4Q A;  2Q3E A;  1GL2 D;  1OFC X;  2JHK F;  2J2P A;  4BRY B;  2KB7 P;  3GLM A;  4UB6 H;  3WUU A;  3H6P A;  4PD4 H;  1JY2 O;  1S5L H;  4HH2 A;  4PJ0 E;  1LGH B;  4PJ0 H;  3AE9 C;  3PTZ A;  3VTP C;  2PP6 A;  1FZE A;  3PH0 A;  1KC8 Q;  3V4W A;  1P84 D;  1VQ6 P;  5AW0 B;  1CSB A;  2NPS B;  3ABV C;  1DEE G;  3BRV B;  1SQP E;  1KIL D;  1SQV G;  3BCC J;  3P32 A;  3C1L A;  1FZF B;  1KYO E;  3CCS P;  4NPF X;  2JHL F;  3L37 A;  4PV1 C;  4LGD E;  3E1I B;  4JPZ B;  2GUS A;  4N6J A;  4OH8 B;  3TGU E;  1NU1 G;  2HOD C;  4JYO X;  1EZV E;  1FZF A;  1JUN A;  1EDL A;  1HGZ A;  1KFM A;  1L4A C;  3AE5 C;  1Q90 D;  1LT9 B;  2N1T B;  3USS A;  3IAO A;  3GHG B;  2WPQ A;  5CBN A;  1SQQ J;  2Q9I A;  1YBK A;  2FXM A;  3H32 A;  4OVN F;  3VOP A;  1YIJ P;  3S9O A;  1T6A A;  2D39 A;  1X8Y A;  1BDD A;  4I7Z B;  1VQ5 P;  3CC4 P;  3CXH E;  1KYO D;  1NTK K;  1PZQ A;  2E76 B;  4IFD K;  3QWO C;  3L4F A;  3E7K A;  5KLV D;  2Q9I B;  3L75 G;  4K3A A;  5AW8 B;  1JCC A;  2IDB A;  1N7S B;  3NTN A;  1KB9 E;  1KB9 H;  3S1K A;  3AEA C;  3GW6 A;  5B66 H;  5AVQ B;  4M3L A;  3R4Y A;  2XV5 A;  2J0Y A;  2KZI A;  2L91 A;  1BCC D;  4I2L C;  1JTH B;  2HPC C;  3RK3 B;  2UWJ E;  2K9J A;  2HPC B;  2Q7C A;  3RL0 B;  1FZC C;  1IFP A;  3VMY A;  3PJS K;  1BSN A;  3WU2 H;  3A0B E;  4L73 A;  5APS A;  1S5L X;  2A06 E;  3BCC E;  2KS1 B;  1YTZ T;  2E43 A;  1Z3S A;  1S1C X;  1ZV8 A;  1T8Z A;  4BRY A;  1KZU B;  2KUB A;  2JO1 A;  2XZR A;  3B5N B;  3CCL P;  5GTI H;  2KP8 A;  5GTH E;  3CWB J;  1FAV A;  3IFM A;  1RE3 B;  1BSH A;  4JBZ A;  2JJL A;  3FWL A;  1FZE C;  2AXT H;  1BCC J;  3RK3 D;  1JEK A;  3V2R A;  2E74 B;  2DW3 A;  3AEC C;  1VL2 A;  1PV3 A;  2BEZ F;  3P8C E;  2J3G A;  1VF5 B;  2PFX A;  4C7R A;  3RK2 B;  1G2C A;  5B5E E;  2BCC J;  3GHG C;  1LJ2 A;  3BVH C;  1S4X A;  2B87 A;  3LW5 J;  2MKV A;  3L75 J;  2JDI H;  5CHX A;  1CI6 B;  2FXO A;  2HOD A;  5BU5 A;  1OVU A;  1IK9 A;  4DT0 A;  3L70 G;  2FYU K;  1PGQ A;  2OYH A;  2RMZ A;  3AE7 C;  2H88 C;  2D2C C;  3L71 J;  2OYI B;  5APT A;  3TNU A;  2E74 D;  3LIE A;  1SQQ D;  3P8M C;  3V6I A;  2PRR A;  1K8A Q;  5APY A;  2KZJ A;  2HOD B;  3RGU A;  4WVZ A;  3T97 B;  2W27 A;  1T2K D;  3CD6 P;  2GM4 A;  2YKP A;  1N73 B;  5BVZ A;  3V2P A;  3VMZ A;  2C9L Y;  1GU4 A;  1FBM A;  1SQB D;  5APX A;  4KT0 J;  5KLV J;  2FYU J;  5AVX B;  4WB4 A;  1S9K E;  3TF5 A;  4IL6 X;  1ZRT D;  1GL2 B;  1R5S A;  4H44 C;  3V5B A;  3T97 A;  2O3J A;  1L4A B;  2O01 N;  3N7N A;  1E79 H;  3CMA P;  2N1T C;  5CMZ A;  2ZT9 C;  2JR8 A;  3B4S A;  1P84 H;  1PPJ E;  1NTZ G;  3HD7 C;  4H13 B;  3H1L G;  5AW6 B;  3I56 P;  1L0N K;  1SQB J;  1WMK A;  3CWB E;  3U1C A;  4XA4 A;  3L35 A;  3CCE P;  2ZYG A;  3G9R A;  3OJA B;  1YI2 P;  1FIC A;  1RF0 A;  2QSI A;  3CL3 D;  1H8A A;  1SFC D;  3G6E P;  2Z5I A;  2Q3I A;  3BCC D;  1G1J A;  1VF5 C;  1J1E B;  4RKU J;  3F5H A;  3H1J J;  2IFM A;  2W8Z A;  4BXL A;  3KXD A;  3L73 G;  1QLE D;  2W90 A;  3FX0 A;  1BCC E;  1KIL A;  2M8R A;  1NTK G;  3KQG A;  3NXS A;  1IFI A;  1SQB G;  1LWU C;  1X0T A;  2LR2 A;  2ITA A;  1Y8A A;  4AUW A;  1N7S C;  1SQB K;  1L0N J;  3VYI A;  3CX5 D;  2JWD A;  2A45 H;  1AJY A;  1N86 A;  4WY4 C;  1KQS O;  2J59 M;  3O6Q A;  3CC7 P;  3Q2Y A;  2KK7 A;  5K5G B;  2QJK B;  4WY4 B;  3AE2 C;  4NYT A;  4M7H A;  3JCU H;  1NVO A;  1KQG B;  1GK6 A;  3H1L D;  3RBZ A;  1NTM K;  1DD3 A;  3M9Q A;  1VPC A;  1KIL C;  4ZFG A;  1FIB A;  4ZKP A;  3AE1 C;  3L71 E;  2XNX A;  2FKW B;  5AVT B;  3L70 J;  3B5N D;  2BEQ D;  2E5Y A;  2J0H A;  2A45 G;  2OGU A;  4TLF A;  3OAK A;  3BCC G;  2G3A A;  2ZXE B;  3IN6 A;  4JF7 A;  3K5B A;  3SSU A;  1M90 Q;  2P58 A;  4Y28 J;  1SQX G;  2AEF A;  4WY4 D;  3S4R A;  5AW3 B;  3H1J D;  1IK7 A;  4K35 A;  4W7Y A;  3L73 D;  3MP7 B;  5APU A;  2J3F D;  4QMA A;  3TDK A;  1NYH A;  1NTK D;  1Q86 Q;  1BGY J;  4OGQ D;  5AVV B;  3Q5S A;  4U3F E;  3EFG A;  3W68 A;  1WRG A;  1NTM J;  1ZOY C;  1JY3 P;  4XE5 B;  2O01 H;  3E1I A;  1EZV I;  5KLV K;  3H1H J;  3HE5 B;  4AYC A;  1PP9 G;  2WSE H;  3TSI A;  4RO0 A;  1NTK E;  1GZL A;  1KB9 I;  1UII A;  2YIU C;  2R3C A;  1MFT A;  2B87 B;  3L75 D;  3VMA A;  1FJK A;  2FYU D;  1RF0 B;  1YJN P;  5B66 E;  1K73 Q;  4R4L A;  1RF1 A;  1Q82 Q;  2I1K A;  1H88 A;  2P1J A;  2JEE A;  3CX5 H;  3FGA D;  2OTL P;  1S2E A;  1R5L A;  2HLO C;  1RHZ B;  2YKO A;  2N1T D;  2QE7 H;  3N4X A;  2XND H;  4N78 E;  2BCC E;  5KKZ B;  5AW4 B;  2P67 A;  1SQP G;  2R44 A;  2WSF H;  2YMK A;  4U3F G;  2I1J A;  4KHX A;  2WPS A;  1U57 A;  2NRG A;  2J5Z A;  1JY3 N;  2M3E A;  2FFD C;  1SQX J;  5KJ7 A;  2QVA A;  2ZYD A;  1N7S A;  3HTK B;  5AW7 B;  4XFJ A;  1D7M A;  3SFE C;  2FYU E;  3HRN A;  1PFI A;  2Q1K A;  5AVU B;  1RE4 B;  3Q1M A;  3A2A A;  1YIT P;  5GTH H;  1GL2 A;  3V2N A;  1PP9 D;  1VQ4 P;  2WSS H;  3H1I J;  2E74 C;  1L0N G;  1LP1 B;  3AED C;  3HTK A;  1BE3 G;  2CPB A;  3CWB G;  2XU6 A;  4GOE A;  2W83 C;  1SQP K;  1FZE B;  3MUD A;  3H1L E;  3L70 E;  1JCD A;  3IF4 A;  1RE4 A;  4AQR D;  1RQU A;  3C8V A;  1Q7Y Q;  3U59 A;  1HWT C;  1SQQ K;  3B5N A;  2KIK A;  3Q5P A;  4GOD A;  2FY8 A;  2YNY A;  1RY3 A;  3PRJ A;  4CPG A;  3L70 D;  4PV1 B;  1IFJ A;  3B5N C;  4HKZ H;  3Q3D A;  1NU1 D;  5C39 A;  1KV4 A;  1FZG C;  1PIX A;  4OGQ C;  3G71 P;  2WT7 B;  1G2C B;  3H1K J;  1YJW P;  5CCG A;  4IFF A;  2IZ0 A;  1LT9 C;  2IBZ E;  2QJP B;  5KAI E;  1PGJ A;  2V4H A;  2AXC A;  1QEX A;  4YTP C;  1SQV J;  3HE4 A;  2Y9Y A;  3VP9 A;  4H13 C;  4LC1 A;  2QM8 A;  2OYH B;  3LW5 H;  1QL1 A;  4JYC A;  1NTZ K;  1CW5 A;  2FYN C;  1GK4 A;  1M56 D;  1YHQ P;  1LTS C;  1VQ7 P;  1FZG A;  1XTC C;  1JY2 N;  5AVY B;  1HH0 A;  2M5A B;  4YXD C;  2K1A A;  3CXH H;  1A02 J;  4I7Z C;  2KI7 B;  3M9H A;  1L0N E;  2JHI F;  2OTK E;  1L0L K;  1ZRT E;  2O1J A;  3L74 E;  3WUT A;  3UIA A;  1M1J B;  3F89 A;  3IR9 A;  1S9K D;  1N73 A;  2QIW A;  4R4M A;  4LLH A;  1S72 P;  1LTB C;  1HTL C;  2IYP A;  1KYO H;  3P8C D;  1Z56 A;  1JTH A;  3KHU A;  3RK3 C;  1FDM A;  3FXE A;  1J1D B;  2ZFC A;  3L72 E;  2J0G A;  5H2F H;  3GF7 A;  1LTG C;  3C9I A;  1SFC B;  1BGY E;  1JC9 A;  5CCH D;  2J3U A;  2LXC B;  4U3F J;  5KTB A;  3G3Z A;  1Z3U A;  1GTW A;  1GU5 A;  1LTJ C;  1NOH A;  4DJG A;  2HLO B;  3VP8 A;  1IJD B;  1KMI Z;  3BVH A;  1H0T B;  1K05 A;  1JNM A;  1EZV G;  3TYY A;  1G1I A;  4MN4 C;  2YO2 A;  1URQ D;  1HVV A;  3CXH D;  4JZC A;  1PPJ G;  1MUU A;  2GA1 A;  5CCH C;  2XDJ A;  4N3Y B;  1Q81 Q;  2WIT A;  1NTM E;  5BU8 B;  3RK2 C;  2GUV A;  1HF9 A;  4NPD A;  4EOT A;  1VQP P;  3H1I D;  1AVO A;  3L71 D;  2WPV B;  3H1H E;  3SWY A;  2C0X A;  2WSC H;  2AEJ A;  2HYN A;  1OIP A;  4RJT A;  2OYO A;  1KQL A;  2FFD B;  5KLV E;  4EPU A;  3MUD C;  1FZA B;  2H89 C;  3L75 E;  4DCK A;  3I5C A;  1QL2 A;  3CCJ P;  3KZI H;  3TGU D;  1S3J A;  5APW A;  3VN0 A;  1HUC A;  2OYI C;  1GW3 A;  2A06 D;  4D6T J;  3CPW O;  5E79 E;  1EDI A;  4L74 A;  1ZXG A;  2K37 A;  1BCC G;  2QJK C;  5DJU B;  4ZKU A;  3H32 C;  2P7J A;  3AEG C;  1USE A;  3AEE C;  2IYO A;  1GDT A;  2J60 A;  3L36 A;  3O8Z A;  4GIF A;  5AW1 B;  4Y99 B;  5KJ7 C;  5AW5 B;  1OVV A;  1VDF A;  4ZNC A;  1EZV D;  2KNC A;  2R5B A;  1LTI C;  3A7O A;  2Q5U A;  1FZF C;  3RK3 E;  2WMM A;  4HB1 A;  2OYH C;  1N73 C;  2N9B A;  1L4A A;  3MZW B;  2MJZ A;  2POH A;  3AE8 C;  1S5L E;  5TIS H;  1W2B O;  3Q5R A;  1EDK A;  3JSV C;  1FS0 E;  4H44 B;  2O1K A;  3L71 G;  2A45 I;  1X9V A;  1URQ B;  3B8E B;  2R3S A;  5KAF E;  2YXQ B;  3ZDM A;  3H1K G;  1KYO I;  3HE5 A;  2FBW C;  3II6 A;  3E1R A;  2Z4E C;  2KLV A;  4PD4 I;  1CI6 A;  1W5C E;  4EYY Q;  1LWU A;  3CI9 A;  2PGD A;  1NU1 J;  1URQ A;  3O6Q B;  1T3J A;  3HUS A;  3H1K E;  1RE3 C;  4B86 A;  1RF1 C;  3U1A A;  1ZR2 A;  1CZQ A;  1KN7 A;  1SQB E;  3WMM 0;  1NTZ J;  2JWA A;  1RF1 B;  4H0L D;  4ASV A;  1GW4 A;  3QH9 A;  2E76 C;  2FIB A;  3CXH I;  4GOF A;  1DH3 A;  5CCH A;  1N8R Q;  5CCG D;  3A3Y B;  3BAT A;  4RES B;  1SQQ G;  1K9M Q;  2Z4E A;  2RKL A;  4ZMD A;  3MD0 A;  3CC2 P;  2HFE D;  1MFZ A;  1JM0 A;  1YYC A;  2WZ7 A;  2Y9Z A;  3D6Z A;  2JHM F;  1FZC A;  1NTM G;  1BE3 D;  3CWB D;  1A02 F;  2YMY A;  3ITK A;  1QX8 A;  1ZME C;  2NPS D;  2V7Q H;  4WBA A;  1LTJ A;  5KLV G;  4TT3 H;  5KKZ C;  2OQQ A;  4A7P A;  3FXD A;  1J2J B;  3M06 A;  2QA4 P;  4EDF A;  2D2C B;  2VRS A;  1FZC B;  3G4S P;  1FZD A;  1L0L D;  4I6M C;  3M9B A;  2WPR A;  3H1K D;  2K88 A;  4DZO A;  2BAS A;  5KAI H;  5M1B A;  1LTJ B;  1WT6 A;  1LTT C;  1NTK J;  2HG5 D;  1MV8 A;  1BGY G;  4H44 D;  3FIB A;  1T3U A;  4JYB A;  1SLQ A;  1Q2N A;  1IO4 A;  5KLI C;  1FDO A;  1L0L E;  1NHL A;  3H1H G;  1Y9B A;  1NKZ B;  2QJY C;  2IBZ I;  2KYV A;  1FC2 C;  2L5G B;  3BAS A;  3GG2 A;  4H13 D;  1KTM A;  1FZB C;  1Y47 A;  2LXB A;  4EIJ A;  1AQ5 A;  3AE6 C;  1BE3 E;  3SWK A;  4N78 D;  3PHL A;  3L74 G;  1LT9 A;  3CLQ A;  1M1K Q;  1QVF O;  2M3B A;  2WTY A;  1NTM D;  2K3R A;  1IZN B;  1SQQ E;  1FZA C;  5APQ A;  1GD2 E;  1NTZ E;  2Y0C A;  3M0D A;  3A0H E;  1JY3 O;  2H43 B;  2O01 J;  3L73 J;  3CCV P;  1YTZ I;  1J1D C;  1RF0 C;  1AV1 A;  1M1J C;  2ZVN B;  3OA7 A;  1L0L G;  2WSC J;  3D71 A;  3BRT B;  4YPC A;  3CCM P;  2W6A A;  2WQY C;  2XNX B;  4GKG A;  4O9B A;  4HJG H;  3A0B H;  1HBW A;  1VQL P;  3RBX A;  1DIP A;  5CJ0 A;  2H8P D;  2XNX C;  4R9T A;  2P2U A;  5TJH A;  4Z1M H;  1BDC A;  4U3F D;  3GMA A;  1OZH A;  2R32 A;  1SS1 A;  1LP1 A;  5CJ4 A;  3RL0 D;  2OAR A;  3PLN A;  1M1J A;  1PP9 E;  1OW8 A;  1VQM P;  2N9Y B;  2IZ1 A;  3TNU B;  3AEB C;  4IOI H;  1VQ9 P;  2K9J B;  1FID A;  4DOJ A;  1MKM A;  3P7K A;  1K04 A;  1YQ3 C;  1URQ C;  2C0W A;  2QEX P;  3L72 D;  5KJ7 D;  3L74 D;  1VQN P;  1VF5 D;  1NU1 E;  2KS1 A;  4YXW H;  1LTA C;  1M57 D;  5B5E H;  1N7L A;  2E76 D;  1RH5 B;  5GTI E;  4C46 A;  3VMX A;  1U7M A;  1DEB A;  3SWF A;  1SP4 A;  4L75 A;  1T2K C;  5AVZ B;  2NPS A;  1RE4 C;  2WWW A;  3A5T A;  2J61 A;  1SFC A;  1KOR A;  3TGU J;  2ZJS E;  1FU1 A;  1NKN A;  5KAF H;  1X22 A;  3H1L J;  1KQF B;  3CX5 I;  2AEM A;  2JKV A;  1KIL E;  1USD A;  2OTJ P;  3BVH B;  1HJB A;  1FOS F;  3M91 A;  3KYQ A;  2ZT9 D;  4WWI A;  1H0T A;  1NGM B;  1SFC C;  3HE4 B;  2Y0D A;  2J5U A;  1JB0 J;  1L0L J;  1NAF A;  1N2D C;  2ZVO B;  2GY7 A;  1SQV D;  1YJ9 P;  3GHG A;  1P84 I;  1DD4 A;  2K9Y A;  4D6T E;  3TGU G;  2NPS C;  2WSF J;  3MGN A;  1FZG B;  3B71 A;  3KPE A;  3RK2 D;  3OW2 O;  2KSJ A;  4OWF A;  2A06 G;  2WT7 A;  3H32 B;  5EFW B;  3H25 A;  2ZXX A;  2QJP C;  4R9J A;  1IFN A;  4C7N A;  2IX7 C;  2OYI A;  5KLI B;  2E5T A;  3L72 G;  2WNP F;  2FXP A;  3HD7 A;  1FZA A;  4H0L C;  1VQO P;  3JC2 2;  1KIL B;  2YXR B;  2KSE A;  4GT1 A;  1JMB A;  5AVR B;  2JP3 A;  2E75 C;  4M7F A;  2KLU A;  3D6Y A;  2V7Q J;  2Z5H A;  1AQT A;  1P84 E;  2QJY B;  3RL0 C;  4PD4 E;  1SQV E;  1KFN A;  3EWK A;  3WUV A;  4ASW A;  1NU1 K;  2IPP A;  1BE3 J;  2W6J H;  1NJI Q;  2HPC A;  1EXI A;  3NMD A;  1VQ8 P;  4I1L A;  2J3F A;  4BWN A;  1LT1 A;  2BCC G;  3AEF C;  1DX7 A;  2WSE J;  5AW9 B;  5DJT B;  4IL6 H;  1SQV K;  1OX3 A;  2JHH C;  1M8O B;  1SQX D;  2R5D A;  1FE6 A;  1IFD A;  4KJM A;  1RQV A;  2Y0E A;  1J1E C;  3EQ2 A;  1SQP J;  1OWA A;  3PP5 A;  1ZR4 A;  2KXP B;  3SFD C;  2YKQ A;  2CPS A;  1MZ9 A;  1ZLL A;  1PGP A;  1ZW0 A;  1HJ0 A;  4D6T G;  1XTG B;  1FOS E;  1FJP A;  2G8Y A;  3LID A;  1W2E A;  3GF3 A;  2HLO A;  2D2C D;  1ZP0 C;  1LWU B;  1QGK B;  5L8R J;  1ZN5 A;  1KD1 Q;  2RN0 A;  2HR3 A;  3MIW A;  2J61 B;  3CCQ P;  3HUS C;  3H1I E;  1SQX K;  1PPJ D;  1PP9 J;  1AA0 A;  1OVR A;  3I55 P;  3NFQ A;  3HUS B;  2B9B A;  2J1G A;  5E79 H;  2QM7 A;  1EXJ A;  1VQK P;  2FYU G;  3H1I G;  2M5A A;  2PAJ A;  3CCU P;  1N86 C;  4WY4 A;  3FWN A;  2SPZ A;  2AXT E;  1YQ4 C;  4H0L B;  4IL6 E;  2NZ2 A;  2QG4 A;  4PV1 D;  2BCC D;  3D70 A;  3CX5 E;  2YO3 A;  2WVR A;  3HD7 D;  3L73 E;  2B88 A;  2ZAE B;  5H2F E;  3TK1 A;  2KNC B;  1BGY D;  1FDI A;  1SQP D; 
#chains in the Genus database with same CATH homology
 2HOD A;  1IFJ A;  3B5N C;  5APV A;  4IFM A;  1H89 A;  5BU5 A;  2J64 A;  3FIB A;  1IK9 A;  1T3U A;  4JYB A;  2FYU K;  1SLQ A;  2J58 A;  1IO4 A;  2OYH A;  1FZG C;  5AW2 B;  2FYZ A;  2OYI B;  3MTU E;  2J3O A;  1JY2 P;  1NHL A;  3V2Q A;  5APT A;  3TNU A;  1FZB B;  2WT7 B;  1G2C B;  3LIE A;  1NKZ B;  3P8M C;  5CCG A;  4IFF A;  1NH4 A;  1LT9 C;  2KYV A;  2L5G B;  5APY A;  3BAS A;  2H7H A;  1OXZ A;  2HOD B;  2LKM A;  1SVF A;  1FZB C;  1IC2 A;  4EIJ A;  3HE4 A;  1AQ5 A;  3VP9 A;  2W27 A;  1T2K D;  4N78 D;  2GM4 A;  1LT9 A;  3CLQ A;  2YKP A;  4LC1 A;  2QM8 A;  2OYH B;  3LW5 H;  1N73 B;  1NO4 A;  1QL1 A;  4JYC A;  5BVZ A;  3V2P A;  2M3B A;  3VMZ A;  1FZB A;  2XKM A;  2WTY A;  1FBM A;  4Y99 C;  5APX A;  1GU4 A;  1NTZ K;  2C9L Y;  1CW5 A;  1GK4 A;  4HYT B;  1NWQ A;  1FZA C;  5APQ A;  1L4A D;  2KOG A;  1GD2 E;  1LTS C;  5AVX B;  1JMM A;  4WB4 A;  1HGV A;  1XTC C;  1FZG A;  2N1T A;  1S9K E;  1JY2 N;  3M0D A;  5AVY B;  1JY3 O;  1GL2 B;  1HH0 A;  2H43 B;  1RE3 A;  3V5B A;  3T97 A;  3E1I C;  2Q9I C;  1JO5 A;  1L4A B;  1YTZ I;  1J1D C;  1RF0 C;  1M1J C;  1A02 J;  3N7N A;  3M9H A;  2N1T C;  5CMZ A;  3OA7 A;  2JHI F;  1L0L K;  2O1J A;  3HD7 C;  5AW6 B;  3BRT B;  3UIA A;  2IFN A;  2FFD A;  1M1J B;  1L0N K;  3IR9 A;  2Z4E B;  1S9K D;  1N73 A;  3U1C A;  2W6A A;  4XA4 A;  2XNX B;  1M7L A;  4GKG A;  3L35 A;  4O9B A;  3R2P A;  3M0D C;  1HBW A;  4LLH A;  5AVW B;  3OJA B;  1LTB C;  1HTL C;  3P8C D;  1FIC A;  1Z56 A;  1EQ7 A;  5CJ0 A;  2H8P D;  2XNX C;  1JTH A;  1RF0 A;  3M0A A;  1AFO A;  1GL2 C;  4R9T A;  2P2U A;  3RK3 C;  3CL3 D;  2E42 A;  2H43 A;  1H8A A;  1SFC D;  2R32 A;  4C7N B;  1FDM A;  5CJ4 A;  1J1D B;  2ZFC A;  4W7Z A;  2Z5I A;  2Q3I A;  2J0G A;  1JOC A;  3RL0 D;  2OAR A;  4W80 A;  2W6B A;  1G1J A;  1N86 B;  1M1J A;  1J1E B;  1LTG C;  3HD7 B;  3C9I A;  3TNU B;  1SFC B;  2H43 C;  1JC9 A;  5CCH D;  2J3U A;  1FID A;  2IFM A;  4DOJ A;  1X79 B;  5KTB A;  3G3Z A;  5AVS B;  1Z3U A;  3P7K A;  1GTW A;  1GU5 A;  1LTJ C;  5CCG C;  1NOH A;  1URQ C;  2C0W A;  5KJ7 D;  1KIL A;  1N7S D;  2HLO B;  2M8R A;  3KDP B;  3VP8 A;  1IJD B;  1IFM A;  1LTA C;  3KQG A;  3NXS A;  3BVH A;  2C9N Y;  1IFI A;  1N7L A;  1LWU C;  1E5W A;  3V4Q A;  4AUW A;  1JNM A;  1N7S C;  1SQB K;  3TYY A;  1G1I A;  4C46 A;  3VMX A;  2YO2 A;  1URQ D;  3VYI A;  1HVV A;  4JZC A;  1DEB A;  1GL2 D;  3SWF A;  1SP4 A;  1T2K C;  2JHK F;  5AVZ B;  2NPS A;  2A45 H;  1N86 A;  1RE4 C;  1MUU A;  2WWW A;  4WY4 C;  3A5T A;  2J59 M;  2J2P A;  5CCH C;  2J61 A;  2KB7 P;  2XDJ A;  3H6P A;  1SFC A;  4N3Y B;  1JY2 O;  4WY4 B;  1FU1 A;  1NKN A;  4NYT A;  2WIT A;  4HH2 A;  4M7H A;  5BU8 B;  1LGH B;  3RK2 C;  3VTP C;  2PP6 A;  2GUV A;  1FZE A;  3BVH B;  1HJB A;  1FOS F;  3M91 A;  1GK6 A;  3KYQ A;  4EOT A;  1NTM K;  1SFC C;  3SWY A;  2C0X A;  2WSC H;  3M9Q A;  3V4W A;  2HYN A;  3HE4 B;  1VPC A;  1KIL C;  5AW0 B;  1KQL A;  2FFD B;  4ZFG A;  1FIB A;  4ZKP A;  1CSB A;  2NPS B;  2XNX A;  2FKW B;  1NAF A;  5AVT B;  4EPU A;  3BRV B;  3B5N D;  1N2D C;  1KIL D;  1FZA B;  2GY7 A;  3P32 A;  2J0H A;  1FZF B;  3GHG A;  2A45 G;  3I5C A;  2NPS C;  1QL2 A;  2JHL F;  3L37 A;  3MGN A;  1FZG B;  3KPE A;  3RK2 D;  2KSJ A;  3OAK A;  3VN0 A;  5APW A;  2OYI C;  1HUC A;  1GW3 A;  2ZXE B;  4LGD E;  3E1I B;  2WT7 A;  4JF7 A;  2GUS A;  4N6J A;  3H32 B;  4OH8 B;  4WY4 D;  2HOD C;  5AW3 B;  4R9J A;  4JYO X;  1IFN A;  4C7N A;  4ZKU A;  4W7Y A;  2IX7 C;  2OYI A;  1FZF A;  3H32 C;  2P7J A;  1JUN A;  5APU A;  1HGZ A;  1KFM A;  2J3F D;  1GDT A;  2J60 A;  1L4A C;  3L36 A;  2WNP F;  3O8Z A;  1LT9 B;  4GIF A;  5AW1 B;  3HD7 A;  2N1T B;  1FZA A;  4Y99 B;  5AVV B;  5KJ7 C;  1KIL B;  5AW5 B;  3GHG B;  1VDF A;  2WPQ A;  3EFG A;  1WRG A;  4GT1 A;  2R5B A;  1JY3 P;  4XE5 B;  5AVR B;  1LTI C;  3A7O A;  2O01 H;  3E1I A;  2Q5U A;  2Q9I A;  2FXM A;  4M7F A;  3H32 A;  5KLV K;  1FZF C;  3HE5 B;  4AYC A;  2OYH C;  1N73 C;  3VOP A;  2N9B A;  2WSE H;  2Z5H A;  3TSI A;  1L4A A;  1GZL A;  2MJZ A;  2D39 A;  2POH A;  1X8Y A;  3RL0 C;  2R3C A;  1KFN A;  1NTK K;  4IFD K;  2O1K A;  1NU1 K;  2IPP A;  1FJK A;  2A45 I;  1X9V A;  3L4F A;  1RF0 B;  1URQ B;  3B8E B;  2HPC A;  2Q9I B;  3NMD A;  1RF1 A;  5AW8 B;  1JCC A;  4I1L A;  2I1K A;  2J3F A;  1H88 A;  2P1J A;  2JEE A;  3HE5 A;  3II6 A;  1N7S B;  3NTN A;  2Z4E C;  1DX7 A;  2KLV A;  5AW9 B;  1CI6 A;  1LWU A;  1SQV K;  2JHH C;  2HLO C;  5AVQ B;  4M3L A;  2YKO A;  3CI9 A;  2R5D A;  2N1T D;  1IFD A;  2XV5 A;  2J0Y A;  3N4X A;  4N78 E;  1J1E C;  3EQ2 A;  1URQ A;  1OWA A;  4I2L C;  3PP5 A;  1JTH B;  2HPC C;  1T3J A;  1ZR4 A;  3RK3 B;  3HUS A;  5AW4 B;  1RE3 C;  2P67 A;  4B86 A;  1RF1 C;  2YKQ A;  2CPS A;  3U1A A;  1ZR2 A;  2WSF H;  1CZQ A;  1MZ9 A;  1ZLL A;  2I1J A;  4KHX A;  2HPC B;  3WMM 0;  2Q7C A;  3RL0 B;  2WPS A;  1FZC C;  3VMY A;  1XTG B;  1RF1 B;  2J5Z A;  1FOS E;  1FJP A;  1JY3 N;  1GW4 A;  3LID A;  2FFD C;  1W2E A;  2FIB A;  2HLO A;  1DH3 A;  5APS A;  5KJ7 A;  5CCH A;  1N7S A;  1LWU B;  1YTZ T;  5CCG D;  3A3Y B;  3BAT A;  3HTK B;  4RES B;  5AW7 B;  2E43 A;  1Z3S A;  1ZN5 A;  2Z4E A;  1ZV8 A;  3MIW A;  1T8Z A;  2J61 B;  3HUS C;  1KZU B;  1SQX K;  1PFI A;  3HRN A;  5AVU B;  2XZR A;  3MD0 A;  1RE4 B;  3A2A A;  2HFE D;  3B5N B;  1GL2 A;  3V2N A;  2KP8 A;  1MFZ A;  1FAV A;  3IFM A;  3NFQ A;  1YYC A;  2WZ7 A;  1RE3 B;  2JHM F;  1FZC A;  3HUS B;  2J1G A;  2JJL A;  1A02 F;  1FZE C;  2YMY A;  2QM7 A;  3HTK A;  2NPS D;  2CPB A;  2XU6 A;  4WBA A;  1LTJ A;  3RK3 D;  1SQP K;  1FZE B;  3MUD A;  3V2R A;  1J2J B;  3M06 A;  2PAJ A;  1JCD A;  3P8C E;  2J3G A;  1RE4 A;  4AQR D;  1N86 C;  4WY4 A;  2VRS A;  4C7R A;  3RK2 B;  1FZC B;  1G2C A;  1FZD A;  4I6M C;  3M9B A;  3U59 A;  2WPR A;  3GHG C;  1HWT C;  1SQQ K;  4DZO A;  3B5N A;  2BAS A;  3BVH C;  2YO3 A;  1LTJ B;  3HD7 D;  2YNY A;  1WT6 A;  3TK1 A;  1LTT C;  1RY3 A;  5CHX A;  1CI6 B;  2HG5 D;  1MV8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...