1RF1C

Crystal structure of fragment d of gammae132a fibrinogen with the peptide ligand gly-his-arg-pro-amide
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
298
structure length
298
Chain Sequence
b'YEASILTHDSSIRYLQEIYNSNNQKIVNLKEKVAQLAAQCQEPCKDTVQIHDITGKDCQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQSAIPYALRVELEDWNGRTSTADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEGNCAEQDGSGWWMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIPFNRLT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibrinogen alpha/alpha-E chain
publication title Calcium-Binding Site beta2, Adjacent to the "b" Polymerization Site, Modulates Lateral Aggregation of Protofibrils during Fibrin Polymerization.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
total genus 91
structure length 298
sequence length 298
chains with identical sequence F
ec nomenclature
pdb deposition date 2003-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1rf1C01
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 1rf1C02
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 1rf1C03
1M1JA 2JHLF 1LTJB 4R9JA 3BVHC 1FZAC 3E1IC 1RE4C 2OYHA 2HODC 1FZFC 2WNPF 2J3FD 1RF1C 1N86B 3GHGC 3BVHA 2J3GA 1FZAA 2J60A 4R9TA 3E1IA 2Q9IB 1RE4A 4EPUA 2A45H 4JYOX 2Z4EB 1JY2N 1FZEB 4ZFGA 1N73B 1FZBC 2Z4EA 2JHKF 1LT9C 2JHHC 2OYIB 2J61A 3H32B 2OYIA 1FZCB 1W2EA 3H32A 4M7HA 2HLOB 1LT9B 2OYHB 2HLOA 1FZBA 1LT9A 1FZGC 3HUSC 2HPCC 2D39A 2J0YA 1T3UA 3BVHB 1FZAB 3E1IB 2J0HA 2FFDC 2J64A 1JY2O 1RE4B 2HODB 1FZFB 2J0GA 2HODA 3HUSA 1FZFA 2HPCA 2JHIF 1JY2P 1RF1B 2J3UA 3GHGB 4NYTA 2J61B 2FFDA 1RF1A 3GHGA 1FIBA 2J2PA 2GY7A 2H43C 1LWUC 2XNXC 1FZBB 1RE3C 1JC9A 2J3OA 2JHMF 2XNXA 1RF0C 1JY3O 1M1JC 1RE3A 1FZGB 3HUSB 2HPCB 1LTJC 1FZGA 1JY3P 1JY3N 2A45G 2FFDB 1Z3UA 1RF0A 2J3FA 4JZCA 2J1GA 1LTJA 1N86C 1FZDA 2Q9IC 2Z4EC 1FZEC 2H43B 1N73C 1LWUB 2XNXB 2H43A 1LWUA 1N86A 2OYIC 2FIBA 2J5ZA 2A45I 1FIDA 1Z3SA 1RE3B 2Q9IA 1FZCC 3H32C 1FICA 2HLOC 1FZEA 2OYHC 1N73A 1RF0B 1M1JB 3FIBA 4M7FA 1FZCA
chains in the Genus database with same CATH superfamily
2IBZG 1N7SB 3Q5PA 1GZLA 3HE5A 3AE6C 2CK3H 2C9LY 2YMYA 3GHGC 3H1IG 1N7SD 5CJ0A 2WPVB 2E74D 3I56P 2O3JA 1LTTC 2JR8A 1J1EC 3H32A 3L72G 1SQPE 1EDIA 2LR2A 3AE9C 3A0HH 1IK7A 1SQBD 3KDPB 2ZXXA 4I1LA 3L70E 1BGYD 4D6TJ 1NTKE 3TF5A 1NTMK 1HVVA 3S4RA 1USDA 2WQYC 2GUVA 3GHGB 4HH2A 3FWNA 3CXHH 4U3FD 2WWWA 2K37A 3FXDA 1P84I 1FBMA 2KP8A 2Y9YA 1EDKA 4ASVA 1GK6A 1J1EB 3NFQA 4XE5B 1AV1A 1J2JB 3VYIA 1X9VA 1J1DC 3GG2A 1X22A 3CMEP 2FYUG 4WY4A 4IFFA 2J1GA 2AEFA 1FZDA 1EXIA 3H1KD 1MFTA 1SQXK 2ZJSE 1Z3SA 2Q9IA 1FZCC 1JCDA 3EFFK 2KNCA 1L0NG 1K05A 1SQBJ 2BASA 4Y99C 4D6TE 1BGYJ 1J1DB 3AECC 1MKMA 1YHQP 1KB9D 3OAKA 4K35A 1JMMA 1S9KE 1HGVA 1K04A 3EFGA 4EPUA 1M8OB 4U3FJ 3CMAP 2WVRA 3MZWB 1EZVI 1NKNA 1FZCB 5AW2B 3F5HA 4YPCA 1USEA 3HUSC 4N3YB 1RH5B 4DOJA 4Y99B 3FGAD 2LXBA 4PD4I 5L8RJ 1VQPP 3QWOC 1LT1A 3WUVA 1KN7A 2J0GA 1FZFA 2OQQA 1VQ4P 3HD7A 4ZKUA 5CCGA 3H1KJ 1N7LA 4IL6H 2B89A 3V6IA 2H88C 1QEXA 1YITP 4K3AA 3A7OA 1OWAA 1SQBE 4C7NB 3HUSB 1BGYE 2RMZA 1FZGA 2KLUA 4EDFA 4KT0J 2A06D 3D6YA 2J5UA 5AVWB 4JYBA 1P84H 4U3FE 4WB4A 2WPSA 2IBZD 1CI6A 1ZLLA 1VDFA 2WSFJ 3D6ZA 3H1ID 2QEXP 1PZQA 3JCUE 1YTZI 5KAIE 1BCCG 3CCRP 3HRNA 2Q3IA 3L72D 3L73E 4NPDA 3H1KE 2ITAA 3E1IA 3D70A 1SQQK 1SQVK 2W90A 1FDOA 3CX5D 1FDIA 1R5LA 3S9OA 3U1AA 1IK9A 3WU2H 2W6AA 3B8EB 1M57D 1DD3A 2XV5A 1IZNB 3FX0A 1QLED 4EI2A 1KYOD 3BRTB 1SQPG 1SP4A 2IZ1A 2YO2A 3B5NA 1M90Q 5B66E 1NTZD 1X0TA 5AW1B 1SVFA 4L73A 3KQGA 2FYUD 1EC5A 1NH4A 3H25A 4PD4H 1RE3A 2ZYAA 1LTJC 3AE5C 3AE3C 3V5BA 1UIIA 1VQ8P 1W2BO 3AE2C 3L72J 3T97B 1N7SA 1L0ND 3S1KA 4HJGH 4ZMDA 1YIJP 3JC22 4YTPC 1Y47A 2KUBA 2KOGA 5CMZA 3Q5SA 4HYTB 1LTJB 5EFWB 4N78D 2HODC 3AEGC 2A06E 1SQXG 5AVZB 1DEEG 2IPPA 2IYOA 2Z5IA 3C1LA 2MKVA 1KQLA 2KXPB 1Y8AA 2B87B 2OTLP 3B4SA 2FYUJ 1LGHB 3VP8A 3H1IE 1NWQA 1OX3A 2KZJA 2ZYDA 3MP7B 2WMMA 1PPJG 1R5SA 4DCKA 3GF3A 3BRVB 1RY3A 4IFMA 2JWAA 2HODB 3VP9A 3L72E 3ABVC 1JY2P 1K9MQ 3RK2C 1L0NJ 1RF1A 2QJKC 2IX7C 2R44A 1JC9A 3AEDC 3TGUG 1KFNA 5KLVG 1EQ7A 1ZV8A 1KYOE 4GODA 1NAFA 4I6MC 3KZIH 3A0BE 2ZFCA 2KS1A 3RK2B 1PGPA 1NTZE 2KLVA 2Z4EC 1E79H 2QJKB 1ZR4A 1PGOA 5APTA 1BCCD 1AA0A 2O01J 3H6PA 2POHA 2YKPA 2HLOC 3QH9A 1GL2C 1FZCA 5BU5A 2GUSA 1IFDA 1FZAC 2PGDA 1RE4C 3SWKA 1L0NE 2J3GA 4R9TA 3VMYA 1HF9A 1BE3G 1VF5D 1EDLA 2I1JA 1WMKA 5DJUB 1JY2N 2Z4EB 3CD6P 1HH0A 2AXCA 3L73G 2GM4A 1SQPD 2FBWC 3CCLP 2HLOB 1GL2B 2M3EA 1HTLC 1JB0J 4XFJA 5BU8B 1FZAB 2FFDC 1RE4B 4C7NA 1GL2D 3HUSA 1BSHA 1MFZA 3AE8C 3P8CE 1BCCJ 1YYCA 1VL2A 3HE4B 4IFDK 1DIPA 3C9IA 3N4XA 2IYPA 2FFDB 1Z3UA 2Y0DA 4JZCA 1NU1K 2NRGA 5APXA 3V2RA 4C7RA 1MUUA 1AQTA 3CXHD 2AEJA 2J5ZA 2RH0A 1KD1Q 1SQXD 1SQPJ 3MD0A 2R5DA 1T8ZA 2QIWA 1EZVG 2JHLF 1NTKJ 1VQ7P 1S9KD 1ZXGA 3SWFA 1JOCA 1EDJA 1GTWA 3CL3D 1PPJD 2LXCB 4ZFGA 1BCCE 2JHKF 2KZIA 2K9JB 3KXDA 3M0AA 1W5CE 1ZRTD 2Q1KA 2QSIA 3W67A 4YXDC 3Q5RA 4EIJA 3P7KA 1VQ5P 1T3JA 2JHIF 3LW5H 1PL5A 3U59A 2JO1A 5BVZA 3TGUD 1NO4A 2WSCH 5KLVD 2QE7H 3EQ2A 2D2CC 3T97A 2WSEH 3H1JG 1NYHA 1LJ2A 4MN4C 2J3OA 4W7ZA 3C8VA 4N6JA 4KHXA 3WUUA 1JY3N 2N1TC 4NPEA 1ZOYC 3FXEA 1LTJA 3ZDMA 1JEKA 3L71G 2JJLA 2OTJP 1LWUA 2D2CB 3PRJA 3CLQA 1TU3F 5CCHC 1NTZG 2OYHC 5CHXA 1HJ0A 4HB1A 2D2CD 1BE3D 4PV1C 5AW0B 2CPSA 4I7ZC 1AFOA 1OVUA 1HJBA 4JYCA 2N1TB 2Y0EA 1KQSO 3L73D 1HBWA 1JCCA 1L0LG 2E42A 5GTHE 1FDMA 1VQ6P 1JUNA 3TGUJ 2N1TD 1JM0A 5KLVJ 3CXHE 5APQA 1P84D 2PAJA 1SQXE 4CPGA 2KSEA 3IAOA 2QM7A 2OYHB 2QG4A 2E75C 4PV1B 5CCHD 1GW4A 1SLQA 4I7ZB 5APWA 2E43A 1ZW0A 2O01N 1GW3A 3G9RA 1IO4A 2J3UA 1KC8Q 4BRYB 1PPJE 1AJYA 2H43C 4W7YA 3U1CA 1UIXA 3VMAA 1KZUB 4PJ0E 1ZRTE 1PV3A 2Y0CA 4M3LA 5KJ7C 4AYCA 2IFMA 2W8ZA 4L74A 1BE3J 1H88A 2B88A 2E75B 3CCJP 3L73J 1PP9G 1YQ3C 2E75D 2W27A 3TGUE 3PTZA 4EYYQ 3GF7A 5KLVE 4I2LC 2H43B 1EZVD 2OYIC 2LKMA 3FWLA 3F89A 2BCCG 1SQBK 1NU1G 3FIBA 4TT3H 2O1KA 4M7FA 4GT1A 1M1JA 1AQ5A 3JSVC 4PD4D 3TNUA 1U57A 1BDDA 1GL2A 2M5AB 5KAIH 2WITA 1IFMA 1VQNP 3M91A 2IDBA 3CWBE 1FZAA 2J60A 1RE4A 1Q82Q 1PFIA 4L76A 2J58A 2H89C 2OYIB 3MUDC 1MZ9A 4DJGA 1S4XA 2OTKE 1LT9B 1BE3E 1XTCC 1CZQA 1S5LE 3HE4A 3Q2YA 3M9QA 5TISE 3H1JD 1FU1A 1KB9H 3CC2P 5KAFE 2Q6QA 3AEFC 1U7JA 2QVAA 3SSUA 2FFDA 1P84E 1L4AC 4UB6H 3Q3DA 1PGQA 1K73Q 1GDTA 5H2FH 1URQC 2WSFH 3GMAA 3PHLA 1EXJA 2IFNA 3L71D 3M0DC 5AW3B 3M9HA 1PIXA 2SPZA 3SFEC 3VN0A 2Q5UA 3OJAB 5AVQB 3N7NA 1L4AB 2Q7CA 2FXOA 2FIBA 3H1IJ 5AW9B 3H32C 4R4MA 1NTMG 3L75G 3H1HG 4C46A 1OW6A 1URQB 1L0LD 2FYNC 2K9JA 2JKVA 2XU6A 3WU2E 1JTHB 4DT0A 2N9YB 1CSBA 3H1LE 1HGZA 3HE5B 3G71P 3H1JJ 2AEMA 1HWTC 2Q3EA 2J3FD 5AW4B 1KQFB 4UB8E 1EZVE 2XZRA 4JYOX 1FZBC 2KSJA 4EOTA 3B71A 5KLIC 3H32B 2I1KA 2FKWB 3USSA 4AUWA 3TYYA 3TK1A 2FYNB 3L71J 1GD2E 2P7JA 4PD4E 5AW7B 1KORA 3P8CD 1QGKB 2Y9ZA 1CW5A 2YXQB 1NTZJ 2QRXA 2H8PD 3GW6A 5APVA 3GHGA 5AVYB 1ZR2A 1FZBB 4OH8B 4Y28J 5KLIB 3CX5H 1PP9D 4H0LC 1L0LJ 1QL1A 1NAYA 1XTGB 2C9NY 2V7QH 2I8DA 1OW7A 3AE4C 1LNQA 2BEZF 3TSIA 3H1JE 3IN6A 2PP6A 1OXZA 4GOEA 1DX7A 2R3SA 2AXTH 3V4QA 4RJTA 5AW8B 2BCCD 2C0WA 2N1TA 3II6A 3A0BH 1NU1D 2FXPA 4WBAA 3P8MC 1Q7YQ 2IZ0A 3BCCG 4JBZA 4H0LB 3L71E 4W80A 3OA7A 5CCHA 1RQUA 2QJYC 4H0LD 2OYHA 3LIEA 1FZFC 4H44C 3D71A 1NOHA 5AVRB 1JNMA 1S1CX 2YKOA 1M7LA 2HR3A 3RK2D 2WT7B 1OFCX 1FJPA 4BRYA 2ZVOB 3CWBG 2FYUK 1PP9J 1YJWP 1L0LE 2W6JH 1S72P 4QMAA 2YXRB 1FOSF 1FZGC 5E79H 5B5EH 4ASWA 3AE1C 2QJYB 2J0HA 1FZFB 2WPQA 4H44B 1Q81Q 1QVGO 2BCCJ 3CCEP 1L0NK 1L2PA 3V4WA 1NU1J 1KILC 3L74G 3R2PA 4GIFA 4JPZB 2FYZA 2K3RA 1RHZB 2FY8A 1FZGB 3LIDA 1SQQG 1SQVG 3MIWA 4DZOA 4ZNCA 1NTMD 3L75D 3H1HD 1U7MA 2ZVNB 1K8AQ 3WMM0 2M5AA 1FZEC 2P58A 1KILB 3PLNA 2M3BA 1PP9E 3RL0g 1FICA 3IFMA 1DEBA 1KILD 2H7HA 3VOPA 1OZHA 2MJZA 1YJ9P 4R9JA 2YNYA 2C0XA 3CC4P 1BSNA 3B5NC 2BCCE 1T6AA 5GTIH 1KQGB 1NU1E 2PFXA 3H1LG 1FZEB 1SFCC 3CI9A 1R8EA 4OGQC 4JQ0D 1HUCA 2NPSC 1S5LX 2HPCC 3AE7C 3O6QB 3MUDA 1PGJA 5DJTB 1NTMJ 3B5NB 3H1HJ 3L75J 2JEEA 2P10A 1GK4A 2E74C 1KTMA 2J61B 4TLFA 3SWYA 1A02F 2XNXC 3B5ND 1SFCB 2WSCJ 1QVFO 2ZAEB 3CCUP 3IF4A 4OGQB 1Z56A 1FE6A 1SFCD 2NPSB 4KJMA 2HPCB 2YMKA 4OGQD 2ZYGA 5M1BA 2CPBA 2NPSD 3BCCD 2J3FA 2DW3A 1JTHA 1QX8A 2WSSH 1KFMA 2E74B 3L37A 3M0DA 1SQXJ 1N73C 2ZXEB 2XNXB 5AVXB 3MHVA 2A45I 1NKZB 1Q86Q 2P1JA 2WZ7A 1SQPK 2BEQD 2B9BA 3HTKB 3CPWO 2P2UA 1IC2A 3KYQA 3BVHC 1OVRA 1NTKK 2E5TA 1NTME 3L75E 3H1HE 3CWBD 2XDJA 1FC2C 1RF1C 4BXLA 5AVTB 1NJIQ 3G3ZA 4LLHA 3KPEA 5GTHH 1N73B 3L4FA 2B87A 2W6BA 2ZT9C 3A0HE 1KILE 1YQ4C 2L91A 4B86A 1FZBA 3L74D 3BVHB 2J64A 3W68A 3BCCJ 1KB9I 2HODA 3AEEC 1IFPA 1RF1B 1VQLP 3G6EP 1S3JA 1SQQD 1SQVD 1VQKP 1X79B 1NGMB 2ZT9B 5AVVB 2HG5D 5AVSB 3CCQP 4PJ0H 1E5WA 1RF0C 1JY3O 2R32A 1LTSC 2ZT9D 2FXMA 1M56D 4PV1D 2G8YA 5TJHA 3CWBJ 3BASA 1N86C 2KS1B 2JWDA 1VQ9P 3RL0C 3V2PA 2OARA 1DH3A 1FIDA 3OW2O 1YJNP 2WT7A 3EWKA 3G4SP 2XKMA 4WWIA 2KI7B 2KK7A 3NXSA 1RF0B 3H1LD 1IFIA 3L74J 1QL2A 4GOFA 3BATA 3BCCE 2RN0A 1N86B 1ZP0C 5KKZC 1KV4A 3K5BA 2A45H 5KLVK 3RL0B 1G2CB 1SQQJ 3PJSK 1FOSE 1SQVJ 2Z4EA 2IBZI 1LT9C 3AEBC 1YBKA 3M06A 4M7HA 4Z1MH 3RL0D 2HLOA 2PRRA 3JCUH 5KJ7D 4XA4A 1S5LH 4IL6E 4AQRD 5C39A 3R4YA 5TISH 4NYTA 1LTIC 4BWNA 5KKZB 1G1IA 1FIBA 2GY7A 5KAFH 1VQMP 3CX5I 2KIKA 1IFNA 1Q90D 1KILA 4RO0A 5AW5B 3H1LJ 3L74E 4A7PA 2YO3A 1OIPA 1KYOI 1A02J 3IR9A 2P67A 5B66H 1FAVA 1H8AA 4RKUJ 1OW8A 3WUTA 1SQQE 1SQVE 2N9BA 1ZN5A 1VPCA 1FZEA 2HYNA 1D7MA 2QJPC 3UIAA 3CCSP 2R5BA 2WNPF 1IFJA 3O6QA 3VMZA 1KB9E 1LP1B 1YTZT 3RK3C 2QM8A 1M1KQ 4OWFA 1BDCA 4UB6E 4WVZA 4UB8H 3L70G 1L4AD 1H0TB 2JHHC 2J61A 3I5CA 5H2FE 1NTKG 1VQOP 1SFCA 1URQD 5CBOA 1T3UA 4U7JA 3L35A 2M8RA 2QJPB 2NPSA 2HPCA 2WPRA 3RK3B 4O9BA 2J2PA 1G1JA 1LWUC 5APYA 1MV8A 1OVVA 3RK3D 4R4LA 1LTAC 4IOIH 2WTYA 2XNXA 1N2DC 2J59M 4WY4C 1X8YA 3TDKA 2V7QJ 3HTKA 2NZ2A 2Z5HA 3E1RA 4RESB 3CCVP 2Q9IC 4LC1A 1LWUB 3AEAC 4D6TG 2QA4P 1WRGA 1H89A 4ZKPA 4HKZH 2IBZE 4GDOA 2JP3A 1N73A 3VTPC 2VRSA 4WY4B 2K9YA 1YI2P 1KYOH 3CC7P 4WY4D 2M0BA 3GLMA 1RQVA 3BVHA 2Q9IB 3O8ZA 2YKQA 2KNCB 1LTGC 2OYOA 2K88A 4LGDE 1W2EA 3CX5E 2JDIH 1GU5A 2D39A 2J0YA 3A5TA 3HD7C 3A3YB 5CCGC 1ZMEC 3SFDC 5CBNA 5K5GB 2GA1A 2AXTE 1VF5C 1NTZK 2OGUA 1SQBG 2W83C 1BGYG 1OMIA 2RKLA 3RBXA 2JHMF 1L0LK 2FYUE 2KB7P 1M1JC 4L75A 4U3FG 3KZIE 3HD7B 2A45G 3MGNA 3I55P 1RF0A 1KMIZ 1NHLA 3P32A 3HD7D 1VF5B 5AVUB 4H44D 3E7KA 5CCGD 1GU4A 1AVYA 3PH0A 3L36A 2H43A 2O01H 3RGUA 3RK3E 1N86A 1LTBC 1SS1A 1FS0E 1G2CA 3H1KG 5KJ7A 1M1JB 1NVOA 3TNUB 5E79E 5B5EE 2K1AA 3A2AA 3E1IC 4YXWH 3L70D 3NTNA 2YIUC 5APSA 4N78E 3VMXA 1NTKD 2E5YA 2HFED 1CI6B 1FJKA 5APUA 1Q2NA 4JF7A 4GKGA 1JO5A 3CXHI 3KHUA 2OYIA 3M9BA 1T2KC 5AW6B 1DD4A 2L5GB 4H13C 1N8RQ 1LT9A 1JMBA 3E1IB 4IL6X 1JY2O 1IJDB 2G3AA 2YIUB 1WT6A 2UWJE 4NPFX 5KTBA 3V2QA 5CJ4A 3V2NA 1RE3C 2E76C 3Q1MA 1AVOA 3ITKA 3NMDA 1Y9BA 3RBZA 1S2EA 2O1JA 4H13B 3MTUE 2XNDH 1N7SC 1JY3P 3CCMP 3L70J 4D6TD 1T2KD 3LW5J 4H13D 2R3CA 5GTIE 3PP5A 2KYVA 2WSEJ 1L4AA 1LP1A 1RE3B 1GMJA 2E76B 2A06G 2V4HA 1URQA 4OVNF 1H0TA 2E76D
chains in the Genus database with same CATH topology
5BU5A 2GUSA 1IFDA 1FZAC 1N7SB 1QL2A 1CSBA 1HGZA 1RE4C 3BATA 1GZLA 3HE5B 1HWTC 3HE5A 2J3FD 2C9LY 2YMYA 3GHGC 5AW4B 1N7SD 1N86B 2J3GA 4R9TA 3VMYA 5CJ0A 2XZRA 2I1JA 2A45H 5KLVK 4JYOX 2Z4EB 1JY2N 3RL0B 1G2CB 1FOSE 1FZBC 2Z4EA 1LT9C 2KSJA 1HH0A 4EOTA 1LTTC 2GM4A 3H32B 2I1KA 1J1EC 3M06A 2FKWB 3H32A 4M7HA 4AUWA 3RL0D 3TYYA 2HLOB 3TK1A 2HLOA 1GL2B 1GD2E 5KJ7D 2P7JA 3KDPB 5AW7B 1HTLC 4XA4A 4I1LA 5BU8B 1FZAB 2FFDC 1RE4B 4C7NA 1GL2D 3P8CD 3HUSA 1NTMK 1CW5A 1MFZA 4AQRD 1HVVA 3P8CE 2H8PD 1LTIC 2GUVA 3GHGB 4HH2A 5APVA 4NYTA 1G1IA 3GHGA 5AVYB 1FIBA 2GY7A 1ZR2A 2WWWA 1FBMA 1FZBB 2KP8A 4OH8B 1YYCA 1IFNA 1GK6A 1J1EB 3HE4B 1KILA 1QL1A 3NFQA 1XTGB 4XE5B 1J2JB 3VYIA 2C9NY 4IFDK 5AW5B 1X9VA 3C9IA 3N4XA 1J1DC 3TSIA 2PP6A 2YO3A 1OXZA 1DX7A 2FFDB 4WY4A 1A02J 4IFFA 1Z3UA 4JZCA 1NU1K 2J1GA 3IR9A 2P67A 3V4QA 5AW8B 1FZDA 1FAVA 5APXA 3V2RA 4C7RA 1H8AA 2C0WA 2N1TA 3II6A 1MUUA 1SQXK 4WBAA 3P8MC 2J5ZA 2N9BA 1Z3SA 2Q9IA 1FZCC 1JCDA 1ZN5A 1VPCA 1FZEA 3MD0A 4W80A 2R5DA 2HYNA 2BASA 1T8ZA 4Y99C 3OA7A 2JHLF 5CCHA 1J1DB 1S9KD 3UIAA 2OYHA 3LIEA 2R5BA 1FZFC 3OAKA 2WNPF 1IFJA 1JMMA 3SWFA 1S9KE 1HGVA 1NOHA 5AVRB 3VMZA 1JOCA 1JNMA 1YTZT 3RK3C 2QM8A 2YKOA 1M7LA 3EFGA 1GTWA 4EPUA 3CL3D 3RK2D 2WT7B 4ZFGA 2JHKF 1FJPA 1L4AD 1NKNA 2JHHC 3M0AA 2J61A 2FYUK 1FZCB 3I5CA 5AW2B 1SFCA 1URQD 1FOSF 1FZGC 3HUSC 4N3YB 4DOJA 1T3UA 4Y99B 3L35A 2J0HA 4EIJA 2M8RA 3P7KA 1T3JA 2NPSA 2J0GA 1FZFB 2HPCA 1FZFA 2WPQA 2JHIF 3LW5H 3U59A 2WPRA 3HD7A 4ZKUA 5BVZA 1L0NK 3RK3B 5CCGA 4O9BA 1N7LA 3V4WA 1NO4A 1G1JA 2J2PA 2WSCH 1KILC 1LWUC 3R2PA 5APYA 4GIFA 3EQ2A 3T97A 1MV8A 2WSEH 3RK3D 2FYZA 1LTAC 2J3OA 3A7OA 2WTYA 2XNXA 1FZCA 1OWAA 1N2DC 4W7ZA 2J59M 4WY4C 4N6JA 1X8YA 4C7NB 4KHXA 1FZGB 3HUSB 3LIDA 1FZGA 3HTKA 1JY3N 2N1TC 3MIWA 4DZOA 2Z5HA 1LTJA 4RESB 2Q9IC 3WMM0 5AVWB 2JJLA 4JYBA 4WB4A 4LC1A 1FZEC 1KILB 1LWUB 2WPSA 2M3BA 1LWUA 1CI6A 1WRGA 1H89A 4ZKPA 3CLQA 1ZLLA 5CCHC 1VDFA 1FICA 3IFMA 1DEBA 1KILD 2OYHC 1N73A 2H7HA 5CHXA 3VTPC 3VOPA 2VRSA 4WY4B 5AW0B 2CPSA 1YTZI 2MJZA 4R9JA 2YNYA 2C0XA 1AFOA 1HJBA 4JYCA 2N1TB 3HRNA 2Q3IA 3B5NC 4WY4D 1HBWA 1JCCA 2E42A 3BVHA 1FDMA 3E1IA 1JUNA 2Q9IB 2N1TD 3O8ZA 2YKQA 5APQA 1FZEB 1LTGC 1SFCC 1SQQK 1SQVK 2PAJA 4LGDE 3CI9A 1W2EA 2QM7A 1GU5A 1HUCA 2OYHB 2NPSC 3U1AA 1IK9A 2HPCC 2W6AA 2D39A 2J0YA 3MUDA 3A5TA 3B8EB 3HD7C 3A3YB 2XV5A 5CCHD 1GW4A 1SLQA 5APWA 5CCGC 2E43A 3BRTB 1GW3A 1SP4A 3B5NB 1IO4A 2YO2A 2JEEA 3B5NA 1NTZK 1GK4A 2J3UA 2J61B 3SWYA 2H43C 4W7YA 1A02F 3U1CA 2XNXC 3B5ND 1SFCB 5AW1B 1SVFA 1KZUB 3KQGA 4M3LA 2JHMF 1Z56A 1L0LK 5KJ7C 2KB7P 2IFMA 4AYCA 1SFCD 1NH4A 1M1JC 2NPSB 1RE3A 1H88A 2HPCB 1LTJC 3HD7B 2A45G 3V5BA 3MGNA 2CPBA 1RF0A 2NPSD 2J3FA 1NHLA 1JTHA 3P32A 2W27A 1KFMA 1N7SA 3HD7D 5AVUB 5CCGD 1GU4A 3L37A 3M0DA 4I2LC 2H43B 1N73C 2ZXEB 3L36A 2XNXB 5AVXB 2H43A 2O01H 1N86A 2OYIC 2A45I 2LKMA 1NKZB 1LTBC 2P1JA 2WZ7A 1SQPK 3HTKB 2P2UA 1G2CA 1IC2A 1SQBK 5KJ7A 1M1JB 3FIBA 2KOGA 2O1KA 5CMZA 4M7FA 3TNUB 3KYQA 1M1JA 4GT1A 4HYTB 1AQ5A 1LTJB 3BVHC 3TNUA 3A2AA 3E1IC 1NTKK 4N78D 2HODC 3NTNA 5AVZB 1GL2A 2WITA 1IFMA 5APSA 4N78E 2XDJA 3VMXA 3M91A 2HFED 1CI6B 1RF1C 2IPPA 1FJKA 2Z5IA 1FZAA 2J60A 5APUA 5AVTB 1RE4A 1KQLA 3G3ZA 4LLHA 3KPEA 1PFIA 4JF7A 1N73B 4GKGA 3L4FA 1JO5A 2J58A 2OYIB 2W6BA 1MZ9A 2OYIA 1LGHB 3VP8A 3M9BA 1NWQA 1T2KC 4B86A 1LT9B 5AW6B 2L5GB 1FZBA 1LT9A 1XTCC 1CZQA 3BRVB 3HE4A 3BVHB 3E1IB 1RY3A 4IFMA 2J64A 3M9QA 1JY2O 2HODB 1FU1A 3VP9A 1IJDB 2HODA 1WT6A 1JY2P 3RK2C 1RF1B 2FFDA 1RF1A 1L4AC 5KTBA 2IX7C 1X79B 3V2QA 5CJ4A 3V2NA 1GDTA 1RE3C 3NMDA 1JC9A 1URQC 5AVVB 2HG5D 5AVSB 2WSFH 1E5WA 2R32A 1JY3O 1RF0C 2O1JA 1LTSC 2IFNA 1KFNA 3MTUE 1EQ7A 1N7SC 1JY3P 2FXMA 1ZV8A 1NAFA 1T2KD 3M0DC 4I6MC 5AW3B 3M9HA 3BASA 1N86C 2R3CA 3VN0A 2ZFCA 2Q5UA 3OJAB 3RK2B 5AVQB 3PP5A 2KYVA 2KLVA 3N7NA 3RL0C 2Z4EC 3V2PA 1L4AB 2OARA 1ZR4A 2Q7CA 1L4AA 1DH3A 5APTA 2FIBA 5AW9B 1FIDA 1RE3B 3H32C 3H6PA 2WT7A 4C46A 2POHA 2YKPA 2HLOC 1URQB 2XKMA 3NXSA 1URQA 1GL2C 1RF0B 2XU6A 1JTHB 1IFIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M1J A;  2JHL F;  1LTJ B;  4R9J A;  3BVH C;  1FZA C;  3E1I C;  1RE4 C;  2OYH A;  2HOD C;  1FZF C;  2WNP F;  2J3F D;  1RF1 C;  1N86 B;  3GHG C;  3BVH A;  2J3G A;  1FZA A;  2J60 A;  4R9T A;  3E1I A;  2Q9I B;  1RE4 A;  4EPU A;  2A45 H;  4JYO X;  2Z4E B;  1JY2 N;  1FZE B;  4ZFG A;  1N73 B;  1FZB C;  2Z4E A;  2JHK F;  1LT9 C;  2JHH C;  2OYI B;  2J61 A;  3H32 B;  2OYI A;  1FZC B;  1W2E A;  3H32 A;  4M7H A;  2HLO B;  1LT9 B;  2OYH B;  2HLO A;  1FZB A;  1LT9 A;  1FZG C;  3HUS C;  2HPC C;  2D39 A;  2J0Y A;  1T3U A;  3BVH B;  1FZA B;  3E1I B;  2J0H A;  2FFD C;  2J64 A;  1JY2 O;  1RE4 B;  2HOD B;  1FZF B;  2J0G A;  2HOD A;  3HUS A;  1FZF A;  2HPC A;  2JHI F;  1JY2 P;  1RF1 B;  2J3U A;  3GHG B;  4NYT A;  2J61 B;  2FFD A;  1RF1 A;  3GHG A;  1FIB A;  2J2P A;  2GY7 A;  2H43 C;  1LWU C;  2XNX C;  1FZB B;  1RE3 C;  1JC9 A;  2J3O A;  2JHM F;  2XNX A;  1RF0 C;  1JY3 O;  1M1J C;  1RE3 A;  1FZG B;  3HUS B;  2HPC B;  1LTJ C;  1FZG A;  1JY3 P;  1JY3 N;  2A45 G;  2FFD B;  1Z3U A;  1RF0 A;  2J3F A;  4JZC A;  2J1G A;  1LTJ A;  1N86 C;  1FZD A;  2Q9I C;  2Z4E C;  1FZE C;  2H43 B;  1N73 C;  1LWU B;  2XNX B;  2H43 A;  1LWU A;  1N86 A;  2OYI C;  2FIB A;  2J5Z A;  2A45 I;  1FID A;  1Z3S A;  1RE3 B;  2Q9I A;  1FZC C;  3H32 C;  1FIC A;  2HLO C;  1FZE A;  2OYH C;  1N73 A;  1RF0 B;  1M1J B;  3FIB A;  4M7F A;  1FZC A; 
#chains in the Genus database with same CATH topology
 2IBZ G;  1N7S B;  3Q5P A;  1GZL A;  3HE5 A;  3AE6 C;  2CK3 H;  2C9L Y;  2YMY A;  3GHG C;  3H1I G;  1N7S D;  5CJ0 A;  2WPV B;  2E74 D;  3I56 P;  2O3J A;  1LTT C;  2JR8 A;  1J1E C;  3H32 A;  3L72 G;  1SQP E;  1EDI A;  2LR2 A;  3AE9 C;  3A0H H;  1IK7 A;  1SQB D;  3KDP B;  2ZXX A;  4I1L A;  3L70 E;  1BGY D;  4D6T J;  1NTK E;  3TF5 A;  1NTM K;  1HVV A;  3S4R A;  1USD A;  2WQY C;  2GUV A;  3GHG B;  4HH2 A;  3FWN A;  3CXH H;  4U3F D;  2WWW A;  2K37 A;  3FXD A;  1P84 I;  1FBM A;  2KP8 A;  2Y9Y A;  1EDK A;  4ASV A;  1GK6 A;  1J1E B;  3NFQ A;  4XE5 B;  1AV1 A;  1J2J B;  3VYI A;  1X9V A;  1J1D C;  3GG2 A;  1X22 A;  3CME P;  2FYU G;  4WY4 A;  4IFF A;  2J1G A;  2AEF A;  1FZD A;  1EXI A;  3H1K D;  1MFT A;  1SQX K;  2ZJS E;  1Z3S A;  2Q9I A;  1FZC C;  1JCD A;  3EFF K;  2KNC A;  1L0N G;  1K05 A;  1SQB J;  2BAS A;  4Y99 C;  4D6T E;  1BGY J;  1J1D B;  3AEC C;  1MKM A;  1YHQ P;  1KB9 D;  3OAK A;  4K35 A;  1JMM A;  1S9K E;  1HGV A;  1K04 A;  3EFG A;  4EPU A;  1M8O B;  4U3F J;  3CMA P;  2WVR A;  3MZW B;  1EZV I;  1NKN A;  1FZC B;  5AW2 B;  3F5H A;  4YPC A;  1USE A;  3HUS C;  4N3Y B;  1RH5 B;  4DOJ A;  4Y99 B;  3FGA D;  2LXB A;  4PD4 I;  5L8R J;  1VQP P;  3QWO C;  1LT1 A;  3WUV A;  1KN7 A;  2J0G A;  1FZF A;  2OQQ A;  1VQ4 P;  3HD7 A;  4ZKU A;  5CCG A;  3H1K J;  1N7L A;  4IL6 H;  2B89 A;  3V6I A;  2H88 C;  1QEX A;  1YIT P;  4K3A A;  3A7O A;  1OWA A;  1SQB E;  4C7N B;  3HUS B;  1BGY E;  2RMZ A;  1FZG A;  2KLU A;  4EDF A;  4KT0 J;  2A06 D;  3D6Y A;  2J5U A;  5AVW B;  4JYB A;  1P84 H;  4U3F E;  4WB4 A;  2WPS A;  2IBZ D;  1CI6 A;  1ZLL A;  1VDF A;  2WSF J;  3D6Z A;  3H1I D;  2QEX P;  1PZQ A;  3JCU E;  1YTZ I;  5KAI E;  1BCC G;  3CCR P;  3HRN A;  2Q3I A;  3L72 D;  3L73 E;  4NPD A;  3H1K E;  2ITA A;  3E1I A;  3D70 A;  1SQQ K;  1SQV K;  2W90 A;  1FDO A;  3CX5 D;  1FDI A;  1R5L A;  3S9O A;  3U1A A;  1IK9 A;  3WU2 H;  2W6A A;  3B8E B;  1M57 D;  1DD3 A;  2XV5 A;  1IZN B;  3FX0 A;  1QLE D;  4EI2 A;  1KYO D;  3BRT B;  1SQP G;  1SP4 A;  2IZ1 A;  2YO2 A;  3B5N A;  1M90 Q;  5B66 E;  1NTZ D;  1X0T A;  5AW1 B;  1SVF A;  4L73 A;  3KQG A;  2FYU D;  1EC5 A;  1NH4 A;  3H25 A;  4PD4 H;  1RE3 A;  2ZYA A;  1LTJ C;  3AE5 C;  3AE3 C;  3V5B A;  1UII A;  1VQ8 P;  1W2B O;  3AE2 C;  3L72 J;  3T97 B;  1N7S A;  1L0N D;  3S1K A;  4HJG H;  4ZMD A;  1YIJ P;  3JC2 2;  4YTP C;  1Y47 A;  2KUB A;  2KOG A;  5CMZ A;  3Q5S A;  4HYT B;  1LTJ B;  5EFW B;  4N78 D;  2HOD C;  3AEG C;  2A06 E;  1SQX G;  5AVZ B;  1DEE G;  2IPP A;  2IYO A;  2Z5I A;  3C1L A;  2MKV A;  1KQL A;  2KXP B;  1Y8A A;  2B87 B;  2OTL P;  3B4S A;  2FYU J;  1LGH B;  3VP8 A;  3H1I E;  1NWQ A;  1OX3 A;  2KZJ A;  2ZYD A;  3MP7 B;  2WMM A;  1PPJ G;  1R5S A;  4DCK A;  3GF3 A;  3BRV B;  1RY3 A;  4IFM A;  2JWA A;  2HOD B;  3VP9 A;  3L72 E;  3ABV C;  1JY2 P;  1K9M Q;  3RK2 C;  1L0N J;  1RF1 A;  2QJK C;  2IX7 C;  2R44 A;  1JC9 A;  3AED C;  3TGU G;  1KFN A;  5KLV G;  1EQ7 A;  1ZV8 A;  1KYO E;  4GOD A;  1NAF A;  4I6M C;  3KZI H;  3A0B E;  2ZFC A;  2KS1 A;  3RK2 B;  1PGP A;  1NTZ E;  2KLV A;  2Z4E C;  1E79 H;  2QJK B;  1ZR4 A;  1PGO A;  5APT A;  1BCC D;  1AA0 A;  2O01 J;  3H6P A;  2POH A;  2YKP A;  2HLO C;  3QH9 A;  1GL2 C;  1FZC A;  5BU5 A;  2GUS A;  1IFD A;  1FZA C;  2PGD A;  1RE4 C;  3SWK A;  1L0N E;  2J3G A;  4R9T A;  3VMY A;  1HF9 A;  1BE3 G;  1VF5 D;  1EDL A;  2I1J A;  1WMK A;  5DJU B;  1JY2 N;  2Z4E B;  3CD6 P;  1HH0 A;  2AXC A;  3L73 G;  2GM4 A;  1SQP D;  2FBW C;  3CCL P;  2HLO B;  1GL2 B;  2M3E A;  1HTL C;  1JB0 J;  4XFJ A;  5BU8 B;  1FZA B;  2FFD C;  1RE4 B;  4C7N A;  1GL2 D;  3HUS A;  1BSH A;  1MFZ A;  3AE8 C;  3P8C E;  1BCC J;  1YYC A;  1VL2 A;  3HE4 B;  4IFD K;  1DIP A;  3C9I A;  3N4X A;  2IYP A;  2FFD B;  1Z3U A;  2Y0D A;  4JZC A;  1NU1 K;  2NRG A;  5APX A;  3V2R A;  4C7R A;  1MUU A;  1AQT A;  3CXH D;  2AEJ A;  2J5Z A;  2RH0 A;  1KD1 Q;  1SQX D;  1SQP J;  3MD0 A;  2R5D A;  1T8Z A;  2QIW A;  1EZV G;  2JHL F;  1NTK J;  1VQ7 P;  1S9K D;  1ZXG A;  3SWF A;  1JOC A;  1EDJ A;  1GTW A;  3CL3 D;  1PPJ D;  2LXC B;  4ZFG A;  1BCC E;  2JHK F;  2KZI A;  2K9J B;  3KXD A;  3M0A A;  1W5C E;  1ZRT D;  2Q1K A;  2QSI A;  3W67 A;  4YXD C;  3Q5R A;  4EIJ A;  3P7K A;  1VQ5 P;  1T3J A;  2JHI F;  3LW5 H;  1PL5 A;  3U59 A;  2JO1 A;  5BVZ A;  3TGU D;  1NO4 A;  2WSC H;  5KLV D;  2QE7 H;  3EQ2 A;  2D2C C;  3T97 A;  2WSE H;  3H1J G;  1NYH A;  1LJ2 A;  4MN4 C;  2J3O A;  4W7Z A;  3C8V A;  4N6J A;  4KHX A;  3WUU A;  1JY3 N;  2N1T C;  4NPE A;  1ZOY C;  3FXE A;  1LTJ A;  3ZDM A;  1JEK A;  3L71 G;  2JJL A;  2OTJ P;  1LWU A;  2D2C B;  3PRJ A;  3CLQ A;  1TU3 F;  5CCH C;  1NTZ G;  2OYH C;  5CHX A;  1HJ0 A;  4HB1 A;  2D2C D;  1BE3 D;  4PV1 C;  5AW0 B;  2CPS A;  4I7Z C;  1AFO A;  1OVU A;  1HJB A;  4JYC A;  2N1T B;  2Y0E A;  1KQS O;  3L73 D;  1HBW A;  1JCC A;  1L0L G;  2E42 A;  5GTH E;  1FDM A;  1VQ6 P;  1JUN A;  3TGU J;  2N1T D;  1JM0 A;  5KLV J;  3CXH E;  5APQ A;  1P84 D;  2PAJ A;  1SQX E;  4CPG A;  2KSE A;  3IAO A;  2QM7 A;  2OYH B;  2QG4 A;  2E75 C;  4PV1 B;  5CCH D;  1GW4 A;  1SLQ A;  4I7Z B;  5APW A;  2E43 A;  1ZW0 A;  2O01 N;  1GW3 A;  3G9R A;  1IO4 A;  2J3U A;  1KC8 Q;  4BRY B;  1PPJ E;  1AJY A;  2H43 C;  4W7Y A;  3U1C A;  1UIX A;  3VMA A;  1KZU B;  4PJ0 E;  1ZRT E;  1PV3 A;  2Y0C A;  4M3L A;  5KJ7 C;  4AYC A;  2IFM A;  2W8Z A;  4L74 A;  1BE3 J;  1H88 A;  2B88 A;  2E75 B;  3CCJ P;  3L73 J;  1PP9 G;  1YQ3 C;  2E75 D;  2W27 A;  3TGU E;  3PTZ A;  4EYY Q;  3GF7 A;  5KLV E;  4I2L C;  2H43 B;  1EZV D;  2OYI C;  2LKM A;  3FWL A;  3F89 A;  2BCC G;  1SQB K;  1NU1 G;  3FIB A;  4TT3 H;  2O1K A;  4M7F A;  4GT1 A;  1M1J A;  1AQ5 A;  3JSV C;  4PD4 D;  3TNU A;  1U57 A;  1BDD A;  1GL2 A;  2M5A B;  5KAI H;  2WIT A;  1IFM A;  1VQN P;  3M91 A;  2IDB A;  3CWB E;  1FZA A;  2J60 A;  1RE4 A;  1Q82 Q;  1PFI A;  4L76 A;  2J58 A;  2H89 C;  2OYI B;  3MUD C;  1MZ9 A;  4DJG A;  1S4X A;  2OTK E;  1LT9 B;  1BE3 E;  1XTC C;  1CZQ A;  1S5L E;  3HE4 A;  3Q2Y A;  3M9Q A;  5TIS E;  3H1J D;  1FU1 A;  1KB9 H;  3CC2 P;  5KAF E;  2Q6Q A;  3AEF C;  1U7J A;  2QVA A;  3SSU A;  2FFD A;  1P84 E;  1L4A C;  4UB6 H;  3Q3D A;  1PGQ A;  1K73 Q;  1GDT A;  5H2F H;  1URQ C;  2WSF H;  3GMA A;  3PHL A;  1EXJ A;  2IFN A;  3L71 D;  3M0D C;  5AW3 B;  3M9H A;  1PIX A;  2SPZ A;  3SFE C;  3VN0 A;  2Q5U A;  3OJA B;  5AVQ B;  3N7N A;  1L4A B;  2Q7C A;  2FXO A;  2FIB A;  3H1I J;  5AW9 B;  3H32 C;  4R4M A;  1NTM G;  3L75 G;  3H1H G;  4C46 A;  1OW6 A;  1URQ B;  1L0L D;  2FYN C;  2K9J A;  2JKV A;  2XU6 A;  3WU2 E;  1JTH B;  4DT0 A;  2N9Y B;  1CSB A;  3H1L E;  1HGZ A;  3HE5 B;  3G71 P;  3H1J J;  2AEM A;  1HWT C;  2Q3E A;  2J3F D;  5AW4 B;  1KQF B;  4UB8 E;  1EZV E;  2XZR A;  4JYO X;  1FZB C;  2KSJ A;  4EOT A;  3B71 A;  5KLI C;  3H32 B;  2I1K A;  2FKW B;  3USS A;  4AUW A;  3TYY A;  3TK1 A;  2FYN B;  3L71 J;  1GD2 E;  2P7J A;  4PD4 E;  5AW7 B;  1KOR A;  3P8C D;  1QGK B;  2Y9Z A;  1CW5 A;  2YXQ B;  1NTZ J;  2QRX A;  2H8P D;  3GW6 A;  5APV A;  3GHG A;  5AVY B;  1ZR2 A;  1FZB B;  4OH8 B;  4Y28 J;  5KLI B;  3CX5 H;  1PP9 D;  4H0L C;  1L0L J;  1QL1 A;  1NAY A;  1XTG B;  2C9N Y;  2V7Q H;  2I8D A;  1OW7 A;  3AE4 C;  1LNQ A;  2BEZ F;  3TSI A;  3H1J E;  3IN6 A;  2PP6 A;  1OXZ A;  4GOE A;  1DX7 A;  2R3S A;  2AXT H;  3V4Q A;  4RJT A;  5AW8 B;  2BCC D;  2C0W A;  2N1T A;  3II6 A;  3A0B H;  1NU1 D;  2FXP A;  4WBA A;  3P8M C;  1Q7Y Q;  2IZ0 A;  3BCC G;  4JBZ A;  4H0L B;  3L71 E;  4W80 A;  3OA7 A;  5CCH A;  1RQU A;  2QJY C;  4H0L D;  2OYH A;  3LIE A;  1FZF C;  4H44 C;  3D71 A;  1NOH A;  5AVR B;  1JNM A;  1S1C X;  2YKO A;  1M7L A;  2HR3 A;  3RK2 D;  2WT7 B;  1OFC X;  1FJP A;  4BRY A;  2ZVO B;  3CWB G;  2FYU K;  1PP9 J;  1YJW P;  1L0L E;  2W6J H;  1S72 P;  4QMA A;  2YXR B;  1FOS F;  1FZG C;  5E79 H;  5B5E H;  4ASW A;  3AE1 C;  2QJY B;  2J0H A;  1FZF B;  2WPQ A;  4H44 B;  1Q81 Q;  1QVG O;  2BCC J;  3CCE P;  1L0N K;  1L2P A;  3V4W A;  1NU1 J;  1KIL C;  3L74 G;  3R2P A;  4GIF A;  4JPZ B;  2FYZ A;  2K3R A;  1RHZ B;  2FY8 A;  1FZG B;  3LID A;  1SQQ G;  1SQV G;  3MIW A;  4DZO A;  4ZNC A;  1NTM D;  3L75 D;  3H1H D;  1U7M A;  2ZVN B;  1K8A Q;  3WMM 0;  2M5A A;  1FZE C;  2P58 A;  1KIL B;  3PLN A;  2M3B A;  1PP9 E;  3RL0 g;  1FIC A;  3IFM A;  1DEB A;  1KIL D;  2H7H A;  3VOP A;  1OZH A;  2MJZ A;  1YJ9 P;  4R9J A;  2YNY A;  2C0X A;  3CC4 P;  1BSN A;  3B5N C;  2BCC E;  1T6A A;  5GTI H;  1KQG B;  1NU1 E;  2PFX A;  3H1L G;  1FZE B;  1SFC C;  3CI9 A;  1R8E A;  4OGQ C;  4JQ0 D;  1HUC A;  2NPS C;  1S5L X;  2HPC C;  3AE7 C;  3O6Q B;  3MUD A;  1PGJ A;  5DJT B;  1NTM J;  3B5N B;  3H1H J;  3L75 J;  2JEE A;  2P10 A;  1GK4 A;  2E74 C;  1KTM A;  2J61 B;  4TLF A;  3SWY A;  1A02 F;  2XNX C;  3B5N D;  1SFC B;  2WSC J;  1QVF O;  2ZAE B;  3CCU P;  3IF4 A;  4OGQ B;  1Z56 A;  1FE6 A;  1SFC D;  2NPS B;  4KJM A;  2HPC B;  2YMK A;  4OGQ D;  2ZYG A;  5M1B A;  2CPB A;  2NPS D;  3BCC D;  2J3F A;  2DW3 A;  1JTH A;  1QX8 A;  2WSS H;  1KFM A;  2E74 B;  3L37 A;  3M0D A;  1SQX J;  1N73 C;  2ZXE B;  2XNX B;  5AVX B;  3MHV A;  2A45 I;  1NKZ B;  1Q86 Q;  2P1J A;  2WZ7 A;  1SQP K;  2BEQ D;  2B9B A;  3HTK B;  3CPW O;  2P2U A;  1IC2 A;  3KYQ A;  3BVH C;  1OVR A;  1NTK K;  2E5T A;  1NTM E;  3L75 E;  3H1H E;  3CWB D;  2XDJ A;  1FC2 C;  1RF1 C;  4BXL A;  5AVT B;  1NJI Q;  3G3Z A;  4LLH A;  3KPE A;  5GTH H;  1N73 B;  3L4F A;  2B87 A;  2W6B A;  2ZT9 C;  3A0H E;  1KIL E;  1YQ4 C;  2L91 A;  4B86 A;  1FZB A;  3L74 D;  3BVH B;  2J64 A;  3W68 A;  3BCC J;  1KB9 I;  2HOD A;  3AEE C;  1IFP A;  1RF1 B;  1VQL P;  3G6E P;  1S3J A;  1SQQ D;  1SQV D;  1VQK P;  1X79 B;  1NGM B;  2ZT9 B;  5AVV B;  2HG5 D;  5AVS B;  3CCQ P;  4PJ0 H;  1E5W A;  1RF0 C;  1JY3 O;  2R32 A;  1LTS C;  2ZT9 D;  2FXM A;  1M56 D;  4PV1 D;  2G8Y A;  5TJH A;  3CWB J;  3BAS A;  1N86 C;  2KS1 B;  2JWD A;  1VQ9 P;  3RL0 C;  3V2P A;  2OAR A;  1DH3 A;  1FID A;  3OW2 O;  1YJN P;  2WT7 A;  3EWK A;  3G4S P;  2XKM A;  4WWI A;  2KI7 B;  2KK7 A;  3NXS A;  1RF0 B;  3H1L D;  1IFI A;  3L74 J;  1QL2 A;  4GOF A;  3BAT A;  3BCC E;  2RN0 A;  1N86 B;  1ZP0 C;  5KKZ C;  1KV4 A;  3K5B A;  2A45 H;  5KLV K;  3RL0 B;  1G2C B;  1SQQ J;  3PJS K;  1FOS E;  1SQV J;  2Z4E A;  2IBZ I;  1LT9 C;  3AEB C;  1YBK A;  3M06 A;  4M7H A;  4Z1M H;  3RL0 D;  2HLO A;  2PRR A;  3JCU H;  5KJ7 D;  4XA4 A;  1S5L H;  4IL6 E;  4AQR D;  5C39 A;  3R4Y A;  5TIS H;  4NYT A;  1LTI C;  4BWN A;  5KKZ B;  1G1I A;  1FIB A;  2GY7 A;  5KAF H;  1VQM P;  3CX5 I;  2KIK A;  1IFN A;  1Q90 D;  1KIL A;  4RO0 A;  5AW5 B;  3H1L J;  3L74 E;  4A7P A;  2YO3 A;  1OIP A;  1KYO I;  1A02 J;  3IR9 A;  2P67 A;  5B66 H;  1FAV A;  1H8A A;  4RKU J;  1OW8 A;  3WUT A;  1SQQ E;  1SQV E;  2N9B A;  1ZN5 A;  1VPC A;  1FZE A;  2HYN A;  1D7M A;  2QJP C;  3UIA A;  3CCS P;  2R5B A;  2WNP F;  1IFJ A;  3O6Q A;  3VMZ A;  1KB9 E;  1LP1 B;  1YTZ T;  3RK3 C;  2QM8 A;  1M1K Q;  4OWF A;  1BDC A;  4UB6 E;  4WVZ A;  4UB8 H;  3L70 G;  1L4A D;  1H0T B;  2JHH C;  2J61 A;  3I5C A;  5H2F E;  1NTK G;  1VQO P;  1SFC A;  1URQ D;  5CBO A;  1T3U A;  4U7J A;  3L35 A;  2M8R A;  2QJP B;  2NPS A;  2HPC A;  2WPR A;  3RK3 B;  4O9B A;  2J2P A;  1G1J A;  1LWU C;  5APY A;  1MV8 A;  1OVV A;  3RK3 D;  4R4L A;  1LTA C;  4IOI H;  2WTY A;  2XNX A;  1N2D C;  2J59 M;  4WY4 C;  1X8Y A;  3TDK A;  2V7Q J;  3HTK A;  2NZ2 A;  2Z5H A;  3E1R A;  4RES B;  3CCV P;  2Q9I C;  4LC1 A;  1LWU B;  3AEA C;  4D6T G;  2QA4 P;  1WRG A;  1H89 A;  4ZKP A;  4HKZ H;  2IBZ E;  4GDO A;  2JP3 A;  1N73 A;  3VTP C;  2VRS A;  4WY4 B;  2K9Y A;  1YI2 P;  1KYO H;  3CC7 P;  4WY4 D;  2M0B A;  3GLM A;  1RQV A;  3BVH A;  2Q9I B;  3O8Z A;  2YKQ A;  2KNC B;  1LTG C;  2OYO A;  2K88 A;  4LGD E;  1W2E A;  3CX5 E;  2JDI H;  1GU5 A;  2D39 A;  2J0Y A;  3A5T A;  3HD7 C;  3A3Y B;  5CCG C;  1ZME C;  3SFD C;  5CBN A;  5K5G B;  2GA1 A;  2AXT E;  1VF5 C;  1NTZ K;  2OGU A;  1SQB G;  2W83 C;  1BGY G;  1OMI A;  2RKL A;  3RBX A;  2JHM F;  1L0L K;  2FYU E;  2KB7 P;  1M1J C;  4L75 A;  4U3F G;  3KZI E;  3HD7 B;  2A45 G;  3MGN A;  3I55 P;  1RF0 A;  1KMI Z;  1NHL A;  3P32 A;  3HD7 D;  1VF5 B;  5AVU B;  4H44 D;  3E7K A;  5CCG D;  1GU4 A;  1AVY A;  3PH0 A;  3L36 A;  2H43 A;  2O01 H;  3RGU A;  3RK3 E;  1N86 A;  1LTB C;  1SS1 A;  1FS0 E;  1G2C A;  3H1K G;  5KJ7 A;  1M1J B;  1NVO A;  3TNU B;  5E79 E;  5B5E E;  2K1A A;  3A2A A;  3E1I C;  4YXW H;  3L70 D;  3NTN A;  2YIU C;  5APS A;  4N78 E;  3VMX A;  1NTK D;  2E5Y A;  2HFE D;  1CI6 B;  1FJK A;  5APU A;  1Q2N A;  4JF7 A;  4GKG A;  1JO5 A;  3CXH I;  3KHU A;  2OYI A;  3M9B A;  1T2K C;  5AW6 B;  1DD4 A;  2L5G B;  4H13 C;  1N8R Q;  1LT9 A;  1JMB A;  3E1I B;  4IL6 X;  1JY2 O;  1IJD B;  2G3A A;  2YIU B;  1WT6 A;  2UWJ E;  4NPF X;  5KTB A;  3V2Q A;  5CJ4 A;  3V2N A;  1RE3 C;  2E76 C;  3Q1M A;  1AVO A;  3ITK A;  3NMD A;  1Y9B A;  3RBZ A;  1S2E A;  2O1J A;  4H13 B;  3MTU E;  2XND H;  1N7S C;  1JY3 P;  3CCM P;  3L70 J;  4D6T D;  1T2K D;  3LW5 J;  4H13 D;  2R3C A;  5GTI E;  3PP5 A;  2KYV A;  2WSE J;  1L4A A;  1LP1 A;  1RE3 B;  1GMJ A;  2E76 B;  2A06 G;  2V4H A;  1URQ A;  4OVN F;  1H0T A;  2E76 D; 
#chains in the Genus database with same CATH homology
 5BU5 A;  2GUS A;  1IFD A;  1FZA C;  1N7S B;  1QL2 A;  1CSB A;  1HGZ A;  1RE4 C;  3BAT A;  1GZL A;  3HE5 B;  1HWT C;  3HE5 A;  2J3F D;  2C9L Y;  2YMY A;  3GHG C;  5AW4 B;  1N7S D;  1N86 B;  2J3G A;  4R9T A;  3VMY A;  5CJ0 A;  2XZR A;  2I1J A;  2A45 H;  5KLV K;  4JYO X;  2Z4E B;  1JY2 N;  3RL0 B;  1G2C B;  1FOS E;  1FZB C;  2Z4E A;  1LT9 C;  2KSJ A;  1HH0 A;  4EOT A;  1LTT C;  2GM4 A;  3H32 B;  2I1K A;  1J1E C;  3M06 A;  2FKW B;  3H32 A;  4M7H A;  4AUW A;  3RL0 D;  3TYY A;  2HLO B;  3TK1 A;  2HLO A;  1GL2 B;  1GD2 E;  5KJ7 D;  2P7J A;  3KDP B;  5AW7 B;  1HTL C;  4XA4 A;  4I1L A;  5BU8 B;  1FZA B;  2FFD C;  1RE4 B;  4C7N A;  1GL2 D;  3P8C D;  3HUS A;  1NTM K;  1CW5 A;  1MFZ A;  4AQR D;  1HVV A;  3P8C E;  2H8P D;  1LTI C;  2GUV A;  3GHG B;  4HH2 A;  5APV A;  4NYT A;  1G1I A;  3GHG A;  5AVY B;  1FIB A;  2GY7 A;  1ZR2 A;  2WWW A;  1FBM A;  1FZB B;  2KP8 A;  4OH8 B;  1YYC A;  1IFN A;  1GK6 A;  1J1E B;  3HE4 B;  1KIL A;  1QL1 A;  3NFQ A;  1XTG B;  4XE5 B;  1J2J B;  3VYI A;  2C9N Y;  4IFD K;  5AW5 B;  1X9V A;  3C9I A;  3N4X A;  1J1D C;  3TSI A;  2PP6 A;  2YO3 A;  1OXZ A;  1DX7 A;  2FFD B;  4WY4 A;  1A02 J;  4IFF A;  1Z3U A;  4JZC A;  1NU1 K;  2J1G A;  3IR9 A;  2P67 A;  3V4Q A;  5AW8 B;  1FZD A;  1FAV A;  5APX A;  3V2R A;  4C7R A;  1H8A A;  2C0W A;  2N1T A;  3II6 A;  1MUU A;  1SQX K;  4WBA A;  3P8M C;  2J5Z A;  2N9B A;  1Z3S A;  2Q9I A;  1FZC C;  1JCD A;  1ZN5 A;  1VPC A;  1FZE A;  3MD0 A;  4W80 A;  2R5D A;  2HYN A;  2BAS A;  1T8Z A;  4Y99 C;  3OA7 A;  2JHL F;  5CCH A;  1J1D B;  1S9K D;  3UIA A;  2OYH A;  3LIE A;  2R5B A;  1FZF C;  3OAK A;  2WNP F;  1IFJ A;  1JMM A;  3SWF A;  1S9K E;  1HGV A;  1NOH A;  5AVR B;  3VMZ A;  1JOC A;  1JNM A;  1YTZ T;  3RK3 C;  2QM8 A;  2YKO A;  1M7L A;  3EFG A;  1GTW A;  4EPU A;  3CL3 D;  3RK2 D;  2WT7 B;  4ZFG A;  2JHK F;  1FJP A;  1L4A D;  1NKN A;  2JHH C;  3M0A A;  2J61 A;  2FYU K;  1FZC B;  3I5C A;  5AW2 B;  1SFC A;  1URQ D;  1FOS F;  1FZG C;  3HUS C;  4N3Y B;  4DOJ A;  1T3U A;  4Y99 B;  3L35 A;  2J0H A;  4EIJ A;  2M8R A;  3P7K A;  1T3J A;  2NPS A;  2J0G A;  1FZF B;  2HPC A;  1FZF A;  2WPQ A;  2JHI F;  3LW5 H;  3U59 A;  2WPR A;  3HD7 A;  4ZKU A;  5BVZ A;  1L0N K;  3RK3 B;  5CCG A;  4O9B A;  1N7L A;  3V4W A;  1NO4 A;  1G1J A;  2J2P A;  2WSC H;  1KIL C;  1LWU C;  3R2P A;  5APY A;  4GIF A;  3EQ2 A;  3T97 A;  1MV8 A;  2WSE H;  3RK3 D;  2FYZ A;  1LTA C;  2J3O A;  3A7O A;  2WTY A;  2XNX A;  1FZC A;  1OWA A;  1N2D C;  4W7Z A;  2J59 M;  4WY4 C;  4N6J A;  1X8Y A;  4C7N B;  4KHX A;  1FZG B;  3HUS B;  3LID A;  1FZG A;  3HTK A;  1JY3 N;  2N1T C;  3MIW A;  4DZO A;  2Z5H A;  1LTJ A;  4RES B;  2Q9I C;  3WMM 0;  5AVW B;  2JJL A;  4JYB A;  4WB4 A;  4LC1 A;  1FZE C;  1KIL B;  1LWU B;  2WPS A;  2M3B A;  1LWU A;  1CI6 A;  1WRG A;  1H89 A;  4ZKP A;  3CLQ A;  1ZLL A;  5CCH C;  1VDF A;  1FIC A;  3IFM A;  1DEB A;  1KIL D;  2OYH C;  1N73 A;  2H7H A;  5CHX A;  3VTP C;  3VOP A;  2VRS A;  4WY4 B;  5AW0 B;  2CPS A;  1YTZ I;  2MJZ A;  4R9J A;  2YNY A;  2C0X A;  1AFO A;  1HJB A;  4JYC A;  2N1T B;  3HRN A;  2Q3I A;  3B5N C;  4WY4 D;  1HBW A;  1JCC A;  2E42 A;  3BVH A;  1FDM A;  3E1I A;  1JUN A;  2Q9I B;  2N1T D;  3O8Z A;  2YKQ A;  5APQ A;  1FZE B;  1LTG C;  1SFC C;  1SQQ K;  1SQV K;  2PAJ A;  4LGD E;  3CI9 A;  1W2E A;  2QM7 A;  1GU5 A;  1HUC A;  2OYH B;  2NPS C;  3U1A A;  1IK9 A;  2HPC C;  2W6A A;  2D39 A;  2J0Y A;  3MUD A;  3A5T A;  3B8E B;  3HD7 C;  3A3Y B;  2XV5 A;  5CCH D;  1GW4 A;  1SLQ A;  5APW A;  5CCG C;  2E43 A;  3BRT B;  1GW3 A;  1SP4 A;  3B5N B;  1IO4 A;  2YO2 A;  2JEE A;  3B5N A;  1NTZ K;  1GK4 A;  2J3U A;  2J61 B;  3SWY A;  2H43 C;  4W7Y A;  1A02 F;  3U1C A;  2XNX C;  3B5N D;  1SFC B;  5AW1 B;  1SVF A;  1KZU B;  3KQG A;  4M3L A;  2JHM F;  1Z56 A;  1L0L K;  5KJ7 C;  2KB7 P;  2IFM A;  4AYC A;  1SFC D;  1NH4 A;  1M1J C;  2NPS B;  1RE3 A;  1H88 A;  2HPC B;  1LTJ C;  3HD7 B;  2A45 G;  3V5B A;  3MGN A;  2CPB A;  1RF0 A;  2NPS D;  2J3F A;  1NHL A;  1JTH A;  3P32 A;  2W27 A;  1KFM A;  1N7S A;  3HD7 D;  5AVU B;  5CCG D;  1GU4 A;  3L37 A;  3M0D A;  4I2L C;  2H43 B;  1N73 C;  2ZXE B;  3L36 A;  2XNX B;  5AVX B;  2H43 A;  2O01 H;  1N86 A;  2OYI C;  2A45 I;  2LKM A;  1NKZ B;  1LTB C;  2P1J A;  2WZ7 A;  1SQP K;  3HTK B;  2P2U A;  1G2C A;  1IC2 A;  1SQB K;  5KJ7 A;  1M1J B;  3FIB A;  2KOG A;  2O1K A;  5CMZ A;  4M7F A;  3TNU B;  3KYQ A;  1M1J A;  4GT1 A;  4HYT B;  1AQ5 A;  1LTJ B;  3BVH C;  3TNU A;  3A2A A;  3E1I C;  1NTK K;  4N78 D;  2HOD C;  3NTN A;  5AVZ B;  1GL2 A;  2WIT A;  1IFM A;  5APS A;  4N78 E;  2XDJ A;  3VMX A;  3M91 A;  2HFE D;  1CI6 B;  1RF1 C;  2IPP A;  1FJK A;  2Z5I A;  1FZA A;  2J60 A;  5APU A;  5AVT B;  1RE4 A;  1KQL A;  3G3Z A;  4LLH A;  3KPE A;  1PFI A;  4JF7 A;  1N73 B;  4GKG A;  3L4F A;  1JO5 A;  2J58 A;  2OYI B;  2W6B A;  1MZ9 A;  2OYI A;  1LGH B;  3VP8 A;  3M9B A;  1NWQ A;  1T2K C;  4B86 A;  1LT9 B;  5AW6 B;  2L5G B;  1FZB A;  1LT9 A;  1XTC C;  1CZQ A;  3BRV B;  3HE4 A;  3BVH B;  3E1I B;  1RY3 A;  4IFM A;  2J64 A;  3M9Q A;  1JY2 O;  2HOD B;  1FU1 A;  3VP9 A;  1IJD B;  2HOD A;  1WT6 A;  1JY2 P;  3RK2 C;  1RF1 B;  2FFD A;  1RF1 A;  1L4A C;  5KTB A;  2IX7 C;  1X79 B;  3V2Q A;  5CJ4 A;  3V2N A;  1GDT A;  1RE3 C;  3NMD A;  1JC9 A;  1URQ C;  5AVV B;  2HG5 D;  5AVS B;  2WSF H;  1E5W A;  2R32 A;  1JY3 O;  1RF0 C;  2O1J A;  1LTS C;  2IFN A;  1KFN A;  3MTU E;  1EQ7 A;  1N7S C;  1JY3 P;  2FXM A;  1ZV8 A;  1NAF A;  1T2K D;  3M0D C;  4I6M C;  5AW3 B;  3M9H A;  3BAS A;  1N86 C;  2R3C A;  3VN0 A;  2ZFC A;  2Q5U A;  3OJA B;  3RK2 B;  5AVQ B;  3PP5 A;  2KYV A;  2KLV A;  3N7N A;  3RL0 C;  2Z4E C;  3V2P A;  1L4A B;  2OAR A;  1ZR4 A;  2Q7C A;  1L4A A;  1DH3 A;  5APT A;  2FIB A;  5AW9 B;  1FID A;  1RE3 B;  3H32 C;  3H6P A;  2WT7 A;  4C46 A;  2POH A;  2YKP A;  2HLO C;  1URQ B;  2XKM A;  3NXS A;  1URQ A;  1GL2 C;  1RF0 B;  2XU6 A;  1JTH B;  1IFI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...