1RF1C

Crystal structure of fragment d of gammae132a fibrinogen with the peptide ligand gly-his-arg-pro-amide
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
298
structure length
298
Chain Sequence
YEASILTHDSSIRYLQEIYNSNNQKIVNLKEKVAQLAAQCQEPCKDTVQIHDITGKDCQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQSAIPYALRVELEDWNGRTSTADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEGNCAEQDGSGWWMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIPFNRLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Blood clotting
molecule keywords Fibrinogen alpha/alpha-E chain
publication title Calcium-Binding Site beta2, Adjacent to the "b" Polymerization Site, Modulates Lateral Aggregation of Protofibrils during Fibrin Polymerization.
pubmed doi rcsb
source organism Homo sapiens
total genus 91
structure length 298
sequence length 298
chains with identical sequence F
ec nomenclature
pdb deposition date 2003-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1rf1C01
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 1rf1C02
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 1rf1C03
4JYOX 4NYTA 1LT9C 4EPUA 3FIBA 1RE3C 2HODA 2J61B 1M1JC 1JY3P 1RE4B 1FZGC 1FZDA 1Z3UA 1RF0A 3E1IC 1FZEC 1FZFA 1JC9A 2J3GA 2J1GA 1Z3SA 1FZAA 3H32B 2JHKF 3BVHB 2OYHB 1LTJA 2Z4EC 1M1JB 1FZBC 4JZCA 1FZGB 3E1IB 1RE4C 2GY7A 2J3OA 2J0HA 1JY2O 1RE3A 2XNXC 2Z4EB 1LWUB 1FZBB 3H32C 3BVHC 2HLOA 2OYHC 2JHMF 1JY3O 1FZEA 2A45H 2XNXB 2Q9IB 1LWUC 2J61A 2J0YA 1RF1B 2J2PA 1RE4A 2FIBA 3HUSB 1T3UA 1FZCB 2OYIB 1N86B 2H43B 1LT9A 2FFDB 3H32A 2HPCB 1N73B 3BVHA 2OYHA 1M1JA 1FZGA 2Q9IC 2A45I 2JHHC 3E1IA 1RF0C 1RF1C 1JY2N 3GHGB 3HUSC 1FZCC 2OYIC 4M7FA 1FZAC 1FICA 1N86C 2HODB 2Z4EA 2H43C 1FZBA 1LWUA 1JY3N 2FFDC 1N73C 2HPCC 2D39A 2J64A 2A45G 1RF0B 1FZFB 1W2EA 1FZAB 2XNXA 3GHGC 1LTJB 1FIDA 2J5ZA 2HLOC 2Q9IA 2HODC 2JHIF 2J60A 4ZFGA 1RF1A 1FIBA 2J0GA 3HUSA 2J3FA 2JHLF 1FZCA 2OYIA 1LT9B 4R9TA 1RE3B 1N86A 2WNPF 1FZFC 4M7HA 2H43A 2FFDA 1N73A 2HPCA 2HLOB 1LTJC 2J3UA 4R9JA 1FZEB 2J3FD 3GHGA 1JY2P
chains in the Genus database with same CATH superfamily
3CCMP 2KI7B 1EDLA 1U7MA 2PGDA 2FYZA 1L4AA 3B5NB 3MUDA 3S9OA 4ASWA 3M9HA 3MD0A 3Q5PA 2BCCJ 2M5AB 2E5YA 3C9IA 2OTJP 2RN0A 3USSA 3IR9A 2YNYA 2FYUG 2IFMA 2YO2A 1OW7A 1E79H 5CJ4A 3EQ2A 3AEAC 3M9QA 2N1TC 3U1CA 2R32A 1L4AD 1EQ7A 3Q1MA 1SLQA 2XZRA 4EIJA 2WPRA 1RQVA 2YIUC 3Q3DA 1PP9E 5APXA 1Y8AA 2Z5HA 2IBZI 1VF5B 4HB1A 3PLNA 1RF0B 1N8RQ 1NTZK 2B87B 4PJ0H 1HGZA 2J5ZA 2HLOC 1PPJD 2Y9YA 2CPBA 3CXHH 1BE3J 2OYIA 4R9TA 1SQXD 3WUUA 1N73A 2HFED 2QJKB 3GW6A 1GTWA 2IYPA 1LT9C 2H89C 2ZT9B 3AEEC 1Q81Q 4OGQD 1D7MA 1L0LE 2KS1A 5B5EH 1FZEC 2H88C 1ZMEC 2FYUK 4AUWA 1X8YA 4IFDK 4CPGA 1FC2C 1KILD 1K05A 2XNXC 1SQQJ 1LWUB 4I7ZB 4ZKUA 4EDFA 4AQRD 1GU5A 5KJ7A 3IN6A 3H1JJ 2QM8A 4BRYA 3L73D 3OA7A 2I8DA 3AE7C 4IL6H 1NTKJ 3H1IG 1SQXE 2WSEJ 1QL2A 2YMYA 1NU1J 3CX5H 4N78D 1KB9I 1GW4A 2O3JA 5KJ7D 5AW3B 1FDOA 3SSUA 1PPJG 2KOGA 1S2EA 2CK3H 4LLHA 4W7YA 1S5LE 3HUSA 4H44B 4A7PA 3SWYA 1KYOD 2J3UA 1KILE 3EFFK 3CCRP 2N1TA 4YXDC 2NPSA 3L74D 4GT1A 5AVTB 2C9LY 5CMZA 2B89A 3E1RA 1JY3P 1JEKA 2WSCJ 3TDKA 3E1IC 3L73E 1HWTC 5AVVB 1M1JB 2WVRA 3CCUP 1S5LX 2E75B 2O1JA 3T97B 4GDOA 4NPFX 1L0LK 3MP7B 3HE5A 2FXMA 2C9NY 1SS1A 3S4RA 1T3JA 3H32C 3AE6C 3M0AA 2HLOA 3VMZA 2KIKA 3CWBJ 1HGVA 2NPSD 4N78E 2Y9ZA 1N7SC 2AEFA 2UWJE 4YPCA 5KLVG 1FOSF 1M7LA 5H2FH 3S1KA 2RH0A 5APUA 1LT9A 1YITP 3BCCD 4JYCA 1KYOE 3GHGB 1FZCC 1NTZJ 2E74D 1VQKP 1KTMA 3A3YB 2E76C 1SQXK 1NTME 1NWQA 3VMYA 2XNXA 1NO4A 1OW8A 1K9MQ 1XTGB 3RL0B 2Q9IA 2WSEH 4I6MC 4MN4C 1ZRTD 2JHLF 5E79E 3H1LJ 3MIWA 2M3BA 1MZ9A 3UIAA 1URQD 2GM4A 1VQ7P 1QVGO 1KD1Q 3L74G 2K9JA 2QVAA 1QLED 3F89A 3HD7A 3Q2YA 2FYUJ 1JC9A 2J1GA 1LTJA 1W5CE 1OFCX 1IFDA 1M90Q 2QEXP 2WSSH 1ZV8A 1NKNA 2WSCH 4DCKA 3AE3C 2QIWA 5GTIH 3L70E 1BGYE 2MKVA 1BE3G 3HD7D 2IDBA 5CJ0A 3V6IA 1U7JA 1N86B 2LR2A 2W90A 3L72E 1H0TB 1ZRTE 3BCCG 3RK3B 1NH4A 1J1EB 3OAKA 3E1IA 2M0BA 1JNMA 2ZAEB 1BSNA 4WBAA 1WRGA 1OXZA 4WB4A 1SQQG 1R5LA 4GOFA 3OW2O 2J59M 1L4AC 1NTMK 3G71P 3MUDC 3MHVA 3CPWO 1L0ND 3L71D 3H1JG 2J3FD 2M8RA 3VP8A 5AW8B 2V7QJ 3KXDA 2AXTH 1EZVG 1FOSE 1FZGC 1NTKG 1KMIZ 1LP1A 4L74A 1EDJA 3H1HD 1VF5D 1P84I 1Q90D 2PAJA 2VRSA 3D6YA 4BXLA 3FXEA 2Z4EB 1SFCA 2HYNA 4IOIH 2D2CB 1FDMA 3AEDC 3GF3A 3O6QB 2JWDA 1J2JB 2L91A 3RK2D 4OGQC 3AEBC 3C8VA 3TNUB 1KQGB 3VMAA 1NAFA 1VQLP 3NXSA 2OYHA 4PD4D 1LTTC 2K9YA 3I5CA 1L0NE 1SQXJ 1GMJA 3L71E 1KILC 2OYIC 5APWA 1UIXA 1GL2A 2P10A 2JKVA 1N73C 2QA4P 3PP5A 3M91A 1MKMA 4DZOA 1VQ9P 3H1KD 1HJ0A 5KLIC 4H0LD 5KAFE 1OIPA 3V2QA 1PGPA 4EI2A 1VQNP 1NHLA 5AW4B 1S3JA 3H1HE 1LT9B 1Q7YQ 3CWBG 4D6TD 3SFEC 2HPCA 4JQ0D 1FZEB 2JR8A 2WSFJ 1AFOA 3AECC 5AW6B 2YKPA 1GL2D 1A02J 1PFIA 3VN0A 3GLMA 3CXHI 1OWAA 2P58A 2DW3A 2FYNC 3L73J 5KJ7C 1PP9D 1NTZG 2V7QH 4PD4E 2OYOA 1VL2A 3HTKB 3P8CD 2M3EA 1IFNA 1FS0E 2K9JB 2A45H 2KB7P 2YMKA 5KKZB 5TISE 3H1KE 3H1LG 3MGNA 5CCGD 3ABVC 1T3UA 1HH0A 1YIJP 5APTA 2GA1A 2IPPA 1FZGA 1NAYA 1RY3A 4D6TE 4W7ZA 3KQGA 3KZIE 3HUSC 2O01J 4M7FA 1FZAC 2W83C 1FICA 2QJPC 3SWFA 1K73Q 3L37A 4GODA 1L0LD 3L74J 2Q5UA 3GG2A 1DX7A 1L0NK 2NPSC 3G3ZA 4OVNF 4XE5B 4ASVA 3LIDA 4KHXA 1RF1A 1OW6A 2J0GA 1LGHB 5AVZB 3CX5I 2LXBA 1JO5A 3RGUA 3RBZA 2W6AA 4EYYQ 3U1AA 3P8CE 5AVQB 3CCLP 4JBZA 1YQ3C 1GD2E 1T2KD 2E74C 3HE4B 1Z3UA 1KILA 1QL1A 3H32B 3L75D 1PP9G 1FZBC 3KYQA 2WSFH 1J1DC 1CI6B 2POHA 3CCQP 1VPCA 1RH5B 2BASA 1N7SB 1KN7A 3BCCJ 3WU2H 1JY2O 2KNCA 1GK6A 3H6PA 3A2AA 3CL3D 3TK1A 1ZN5A 1MUUA 5DJUB 4C7NB 5CCHA 5CBNA 1RE4A 3A7OA 1FZCB 4N3YB 1S9KE 4JYBA 3AEGC 2V4HA 3BVHA 2IZ0A 1DEEG 2Q9IC 1HTLC 4L73A 2JHHC 4HJGH 2WT7A 1JMMA 4K35A 4WVZA 2IZ1A 2R5DA 5CBOA 4PV1D 1L0LG 2A45G 3H1IE 3CMEP 2KSEA 3L36A 1AQ5A 1X9VA 3CI9A 2KP8A 3AE5C 1OX3A 5CCHD 4WY4A 1KYOH 3L75E 3HD7C 2O01H 2H43A 4I1LA 1LTJC 1G2CA 1EZVI 1CW5A 1WT6A 1LTSC 2OGUA 3VMXA 2CPSA 4JYOX 2HG5D 3CLQA 4H13D 5KAIH 2HODA 3RK3D 3L4FA 4AYCA 5L8RJ 4UB8E 3R2PA 5E79H 3CCSP 1FZFA 1FZAA 3W67A 2O01N 1SQXG 4JZCA 1BCCD 1PGQA 4WY4D 4RO0A 1QEXA 3MZWB 5APVA 3SWKA 2GY7A 1RE3A 3IFMA 2G3AA 1NTMD 3VTPC 3CXHE 1W2BO 3PHLA 1JCDA 3BRTB 2Q6QA 1Q86Q 2J61A 3GF7A 2E42A 1AVOA 1SQVD 3NTNA 1VQOP 4Y99C 2KXPB 2IBZD 3WMM0 4IFFA 5KLVE 1VF5C 2ZYDA 5CHXA 1RF0C 1IJDB 1L0NJ 3L71J 5KTBA 2XU6A 3AE1C 1FZBA 1ZLLA 3R4YA 3CD6P 3L73G 3LW5J 1QVFO 3RK3E 5APSA 1L4AB 3NMDA 2AEMA 3RK2C 2QJKC 1URQA 2D2CD 2BEZF 1BCCE 4NPDA 3EWKA 3H1HJ 2FFDA 2BCCE 4ZMDA 3L70D 1BGYD 1VQ8P 2RMZA 1YI2P 2NRGA 1EDKA 4NYTA 1LTIC 2Q7CA 1KZUB 1SFCC 4O9BA 3FWNA 3N7NA 1IO4A 3L72D 3WUTA 2GUSA 1LT1A 4UB6H 1GU4A 3CX5E 1SQVE 1S72P 1JTHA 4I7ZC 2IBZE 4H0LC 3LIEA 2XDJA 2PRRA 1SQPD 1UIIA 4OGQB 2OYHC 4TT3H 3JC22 4Y28J 1NTMG 3FXDA 2AEJA 5B66E 2I1KA 4U3FD 2R44A 1GL2C 1H89A 3RBXA 3H1KJ 4L76A 2OYIB 1WMKA 5BU5A 3B5NA 1N73B 1U57A 3AEFC 1KB9D 4D6TJ 2M5AA 1M56D 3P8MC 1BDCA 2Q3EA 5KLIB 2HPCC 4U7JA 1RQUA 2KS1B 1ZR4A 2N9YB 4RJTA 1NKZB 2JO1A 1VQ4P 2QJYB 2JHIF 2I1JA 2J3FA 1PP9J 3AE4C 1IZNB 1FE6A 2ZXXA 3B5ND 2XV5A 3LW5H 3L70G 3ITKA 1SQBD 5H2FE 1SQPE 3FGAD 3V4WA 1GDTA 2FYNB 2ZYAA 3A0BE 2K3RA 4BRYB 3MTUE 4U3FE 2QM7A 1FBMA 1M1JC 2K37A 1FJKA 1OVVA 1M57D 1RF0A 3L72G 3H1JE 1AJYA 1MFZA 2B87A 1USEA 1Q2NA 2ITAA 3TGUD 3K5BA 1KB9E 1YYCA 1SQVK 3L35A 1IK7A 3H25A 2JDIH 4M3LA 1NU1E 1L0LJ 3SFDC 3C1LA 1T2KC 3A0HE 3M0DA 3HUSB 4PD4H 2RKLA 2QSIA 4HH2A 1X79B 2QJPB 2A06E 2WZ7A 2N1TB 2A45I 4R4MA 2NPSB 4QMAA 1RF1C 1FU1A 3IAOA 1SQBE 1YJWP 5TISH 1LWUA 4KT0J 2KYVA 2YIUB 3D70A 3PJSK 2ZT9D 1PGOA 5GTIE 3KZIH 5AW7B 3TGUE 3TSIA 3L75J 2KLVA 3HE5B 4M7HA 3WUVA 1IC2A 2E74B 2JJLA 3VYIA 1JUNA 1LTBC 2HLOB 1GW3A 3W68A 3KPEA 1YJNP 2QRXA 1KORA 4EPUA 1GK4A 4ZNCA 4PV1C 3CCEP 3KHUA 1FZDA 2ZVNB 3PTZA 1SQPK 2ZVOB 3CCVP 1K8AQ 1Z3SA 2JHKF 2N9BA 1L0NG 3L71G 5CCHC 1RE4C 1YJ9P 1ZXGA 1HUCA 1S4XA 5GTHE 3F5HA 3BVHC 5AW0B 2JHMF 1JY3O 5CCGA 3V5BA 2XNXB 1H88A 3II6A 4OH8B 5AW9B 4H13C 2Y0CA 2XNDH 5M1BA 2Q9IB 3E7KA 3H1HG 2O1KA 1CSBA 1NU1K 1H8AA 1JB0J 1KV4A 1M1JA 2R3CA 2Q1KA 2YO3A 3T97A 2H7HA 4WY4C 2OARA 1ZP0C 5AW2B 4H44D 3CC7P 1AQTA 2E5TA 2H43C 1AV1A 3VP9A 4N6JA 3HD7B 2J64A 1VQPP 1HBWA 1IFJA 1EDIA 1LTJB 5C39A 1SQBK 1OMIA 2J58A 2FYUE 2NZ2A 2HODC 1PIXA 2W27A 3Q5SA 2QE7H 1FIBA 2WPSA 3V2RA 2WTYA 1FZFC 1BCCJ 4R4LA 2E75D 2FBWC 3GHGA 2E43A 2FY8A 2WITA 3H1KG 1RE3C 1NTMJ 5APYA 1KYOI 1P84D 1S9KD 1CZQA 4K3AA 1KFMA 2KK7A 1VQ5P 2IYOA 4D6TG 1A02F 2Z4EC 1SQVJ 1OVRA 2C0XA 3E1IB 2YXRB 1NGMB 2D2CC 1OVUA 4L75A 3H1ID 1AA0A 5AW1B 4UB8H 4RESB 1S5LH 4Y99B 2K1AA 2W6BA 1JMBA 3Q5RA 2J0YA 3FX0A 2J2PA 2FIBA 5TJHA 1SP4A 5AVUB 2ZFCA 3RL0D 1IFPA 1JY2N 1MFTA 1URQC 3JCUE 2OTLP 1G1JA 3BASA 3L70J 3RK2B 1BGYJ 2P2UA 2FFDC 3QWOC 1DD3A 1P84E 5BU8B 1LP1B 1BDDA 4XFJA 1JOCA 2KSJA 3VOPA 3L72J 4HKZH 4ZFGA 3A5TA 2E76B 1N86A 2AXCA 4DOJA 1SFCB 4YXWH 1H0TA 1IK9A 2ZXEB 3CXHD 3NFQA 4DJGA 4GOEA 1SQPJ 2LKMA 1R8EA 2WMMA 4GKGA 3QH9A 4H0LB 2FKWB 4U3FJ 1N2DC 2J5UA 3FWLA 4WWIA 4W80A 5DJTB 2OYHB 3PH0A 5KLVD 2WPVB 1PPJE 3G4SP 2MJZA 1GL2B 3D6ZA 5KKZC 3B5NC 2FXPA 1PGJA 2PFXA 3B4SA 3L75G 3G9RA 3O8ZA 2WWWA 2BCCD 2HPCB 2GUVA 4PJ0E 4C7RA 3V2PA 1HJBA 2BEQD 5B66H 2OQQA 4DT0A 5EFWB 3ZDMA 2KUBA 3P7KA 1SQBJ 3IF4A 2Z4EA 4HYTB 2JP3A 3CX5D 3WU2E 1LTAC 5AVYB 3O6QA 2PP6A 3CMAP 5AVXB 2YKQA 1M8OB 5APQA 4YTPC 3TNUA 5B5EE 3TGUJ 1Z56A 1ZW0A 2K88A 1T8ZA 3FIBA 3B8EB 2N1TD 1BE3D 3TYYA 3CC4P 2ZT9C 3KDPB 1FZGB 1X0TA 3M0DC 4BWNA 1KFNA 1OZHA 3A0BH 5AVSB 4OWFA 1JCCA 3P32A 4IL6E 1Y9BA 2YKOA 1FZEA 3B71A 2IX7C 1YHQP 3L74E 1YBKA 3AE9C 1LWUC 4RKUJ 1BCCG 1RF1B 1KB9H 2BCCG 1NJIQ 2JWAA 5KAIE 2P67A 1VQ6P 1SQQD 3JSVC 1R5SA 3G6EP 5BVZA 4IL6X 2HR3A 3HTKA 3A0HH 3V2NA 4TLFA 3U59A 4PD4I 3H1JD 1EXIA 2Z5IA 1KILB 1SQVG 1NOHA 1N7LA 3D71A 1EZVD 2B88A 2IBZG 1G1IA 2W8ZA 2LXCB 1JM0A 1L2PA 1BE3E 1NTKD 1S1CX 1FJPA 2QG4A 2KNCB 1IFMA 2G8YA 4PV1B 1FDIA 4JPZB 3BATA 2R3SA 1NU1D 3BCCE 4JF7A 4NPEA 5KLVK 4H44C 1JY2P 1RHZB 3OJAB 1NVOA 1RE4B 2L5GB 5CCGC 2XKMA 2A06D 3BVHB 1LTGC 3I55P 4B86A 1BGYG 2WT7B 2KZIA 1SQQE 2J0HA 2R5BA 4H13B 2Y0DA 1DIPA 1LNQA 1PL5A 1X22A 1QGKB 5KAFH 2E75C 1E5WA 1XTCC 1GZLA 1FAVA 2P7JA 1P84H 4WY4B 2YXQB 1EZVE 3HE4A 1DEBA 1KQSO 2H43B 1NTKE 3H32A 5GTHH 1G2CB 1SQPG 3HRNA 1BSHA 4I2LC 4EOTA 1CI6A 3RL0g 1VQMP 1Q82Q 1N7SA 3CWBD 4UB6E 2H8PD 4U3FG 2HODB 1EXJA 3M06A 2D39A 3PRJA 3V4QA 1FZFB 1W2EA 1DH3A 1FZAB 3GHGC 1PZQA 1FIDA 3N4XA 4C7NA 5AVWB 1ZOYC 1YTZT 3I56P 3CCJP 1FZCA 1RE3B 1USDA 1T6AA 1KQFB 1NTZD 1NU1G 3RL0C 3H1IJ 1N7SD 4Z1MH 2J61B 1TU3F 2SPZA 2ZJSE 1VDFA 1HF9A 4GIFA 2KZJA 2J3GA 1M1KQ 1AVYA 2A06G 2B9BA 2W6JH 4KJMA 2FXOA 3H1LD 3GMAA 4XA4A 3BRVB 1SQBG 1Y47A 2J3OA 4LGDE 3EFGA 1FZBB 1J1DB 2WQYC 3CWBE 4ZKPA 1NYHA 2E76D 5AW5B 2FYUD 1SQQK 1KC8Q 1SFCD 4IFMA 3TGUG 1QX8A 1URQB 2JEEA 1YTZI 2P1JA 5K5GB 1YQ4C 3CC2P 2FFDB 5AVRB 1KQLA 1NTZE 1MV8A 1N86C 1DD4A 1NTKK 1JY3N 3TF5A 3RK3C 2QJYC 2Y0EA 2ZYGA 1J1EC 2AXTE 1K04A 2WPQA 1IFIA 1PV3A 1JTHB 4LC1A 2J60A 2OTKE 1HVVA 2Q3IA 3AE2C 3H1LE 3JCUH 2IFNA 5KLVJ 2WNPF 3AE8C 4C46A 1LJ2A 1ZR2A 1SVFA 4R9JA 2KLUA 3M9BA 2C0WA 1EC5A
chains in the Genus database with same CATH topology
4NYTA 1LTIC 2Q7CA 4GKGA 1KZUB 1SFCC 1FOSE 2FKWB 4O9BA 1FZGC 1N2DC 3N7NA 1IO4A 2FYZA 1L4AA 2GUSA 4W80A 3B5NB 3MUDA 1GU4A 2OYHB 1JTHA 3M9HA 3MD0A 3LIEA 2XDJA 2PAJA 2VRSA 3C9IA 2MJZA 1GL2B 2Z4EB 1SFCA 2HYNA 3B5NC 2OYHC 3IR9A 2YNYA 1FDMA 2I1KA 2IFMA 2YO2A 5CJ4A 3EQ2A 1J2JB 1GL2C 3RK2D 1H89A 3O8ZA 2WWWA 3M9QA 2N1TC 3TNUB 2OYIB 3U1CA 2R32A 5BU5A 1L4AD 1EQ7A 1NAFA 1SLQA 3B5NA 2XZRA 3NXSA 4EIJA 2OYHA 2GUVA 2HPCB 1N73B 4C7RA 1LTTC 3V2PA 3I5CA 1HJBA 2WPRA 5APXA 1KILC 3P8MC 2OYIC 5APWA 2Z5HA 3P7KA 1GL2A 2Z4EA 1N73C 2HPCC 4HYTB 3PP5A 3M91A 1RF0B 4DZOA 1ZR4A 1LTAC 1NTZK 5AVYB 2PP6A 1NKZB 1HGZA 5AVXB 2J5ZA 2HLOC 2YKQA 5APQA 2JHIF 2CPBA 3V2QA 2I1JA 1NHLA 5AW4B 3TNUA 2J3FA 2OYIA 1LT9B 4R9TA 1Z56A 3B5ND 2XV5A 1N73A 2HPCA 3LW5H 2HFED 1GTWA 1FZEB 3V4WA 1GDTA 1AFOA 1T8ZA 1LT9C 3FIBA 5AW6B 2YKPA 1GL2D 1A02J 3MTUE 1PFIA 2QM7A 1FBMA 1M1JC 1FJKA 3VN0A 3B8EB 2N1TD 1RF0A 1OWAA 1FZEC 1MFZA 5KJ7C 3TYYA 3KDPB 1FZGB 2FYUK 4AUWA 1X8YA 3M0DC 4IFDK 1KFNA 1KILD 1YYCA 2XNXC 5AVSB 3HTKB 1LWUB 3P8CD 1JCCA 3P32A 1SQVK 4ZKUA 3L35A 4AQRD 1IFNA 2YKOA 1GU5A 1FZEA 4M3LA 2A45H 2IX7C 2KB7P 5KJ7A 2QM8A 1T2KC 1LWUC 3M0DA 1RF1B 5CCGD 3MGNA 3OA7A 3HUSB 1T3UA 1HH0A 4HH2A 1X79B 2P67A 5APTA 2WZ7A 2IPPA 1FZGA 1RY3A 2N1TB 4W7ZA 2A45I 3KQGA 2NPSB 1QL2A 1RF1C 2YMYA 3HUSC 5BVZA 1FU1A 4M7FA 1FZAC 1FICA 3HTKA 1LWUA 3SWFA 3L37A 3V2NA 2KYVA 3U59A 4N78D 2Q5UA 1DX7A 2Z5IA 1KILB 1GW4A 1L0NK 2NPSC 1NOHA 3G3ZA 1N7LA 5KJ7D 5AW3B 4XE5B 1G1IA 3LIDA 2KOGA 4KHXA 1RF1A 4LLHA 4W7YA 3HUSA 5AW7B 1FJPA 2J0GA 1LGHB 3TSIA 2KLVA 3HE5B 5AVZB 4M7HA 3SWYA 1JO5A 1IFMA 1IC2A 2JJLA 3VYIA 1JUNA 1LTBC 2J3UA 2HLOB 3BATA 1GW3A 3KPEA 2W6AA 3U1AA 2N1TA 3P8CE 4JF7A 5AVQB 2NPSA 5KLVK 4GT1A 5AVTB 1JY2P 3OJAB 2C9LY 4EPUA 5CMZA 1GK4A 1GD2E 1T2KD 1JY3P 1RE4B 3HE4B 2L5GB 1FZDA 1Z3UA 1SQPK 5CCGC 3E1IC 1KILA 2XKMA 1QL1A 1Z3SA 3H32B 2JHKF 3BVHB 2N9BA 1HWTC 5AVVB 1M1JB 1LTGC 1FZBC 3KYQA 2WSFH 1J1DC 1CI6B 2O1JA 4B86A 2POHA 5CCHC 1VPCA 1RE4C 2BASA 1N7SB 1HUCA 2WT7B 1L0LK 2J0HA 2R5BA 3HE5A 2FXMA 2C9NY 1JY2O 1GK6A 1T3JA 3H32C 3H6PA 3M0AA 3BVHC 2HLOA 3A2AA 3CL3D 3VMZA 5AW0B 3TK1A 2JHMF 1JY3O 1ZN5A 5CCGA 1E5WA 1HGVA 3V5BA 1XTCC 2NPSD 4N78E 1GZLA 2XNXB 1H88A 1MUUA 1N7SC 1FAVA 3II6A 4OH8B 5AW9B 2P7JA 4C7NB 2Q9IB 5CCHA 4WY4B 1RE4A 2O1KA 3HE4A 3A7OA 1FOSF 1M7LA 1CSBA 1DEBA 1FZCB 4N3YB 1S9KE 4JYBA 1NU1K 5APUA 1H8AA 1LT9A 2H43B 3H32A 3BVHA 1G2CB 3HRNA 1M1JA 4I2LC 4EOTA 2R3CA 1CI6A 2Q9IC 2YO3A 1HTLC 4JYCA 3T97A 2H7HA 4WY4C 2JHHC 2OARA 3GHGB 5AW2B 1N7SA 2WT7A 2H8PD 1FZCC 1JMMA 2HODB 2R5DA 2H43C 3VP9A 4N6JA 3HD7B 3M06A 2D39A 2J64A 2A45G 3A3YB 3V4QA 1SQXK 1HBWA 3L36A 1FZFB 1W2EA 1IFJA 1DH3A 1AQ5A 1FZAB 1NWQA 3VMYA 2XNXA 3GHGC 1LTJB 1SQBK 1NO4A 1X9VA 2J58A 3CI9A 1FIDA 3N4XA 4C7NA 1XTGB 2KP8A 3RL0B 2Q9IA 2HODC 2W27A 2WSEH 5AVWB 5CCHD 4WY4A 3HD7C 1FIBA 4I6MC 2O01H 2JHLF 1YTZT 1FZCA 2WPSA 3V2RA 2WTYA 1RE3B 1FZFC 2H43A 3MIWA 4I1LA 1LTJC 2M3BA 1G2CA 1MZ9A 1CW5A 3UIAA 3RL0C 1URQD 1WT6A 2GM4A 1LTSC 3GHGA 1N7SD 3VMXA 2CPSA 2E43A 4JYOX 2HG5D 2WITA 3CLQA 1RE3C 2HODA 3RK3D 5APYA 2J61B 3L4FA 3HD7A 4AYCA 1VDFA 1S9KD 1CZQA 4GIFA 1KFMA 3R2PA 1FZFA 1JC9A 2J3GA 2J1GA 1FZAA 1LTJA 1A02F 2Z4EC 4JZCA 2C0XA 4WY4D 4XA4A 3BRVB 3E1IB 1IFDA 5APVA 2GY7A 2J3OA 4LGDE 3EFGA 1ZV8A 1RE3A 1NKNA 1FZBB 2WSCH 1J1DB 3IFMA 5AW1B 4ZKPA 5AW5B 4RESB 3VTPC 4Y99B 1JCDA 3BRTB 2W6BA 1SQQK 1SFCD 4IFMA 2J61A 2J0YA 3HD7D 2J2PA 5CJ0A 1URQB 2FIBA 2JEEA 1YTZI 2P1JA 2E42A 3NTNA 1N86B 4Y99C 2FFDB 3RK3B 1SP4A 3WMM0 4IFFA 1NH4A 5AVUB 5AVRB 1KQLA 2ZFCA 3RL0D 1J1EB 3OAKA 5CHXA 3E1IA 1RF0C 1JY2N 1URQC 1IJDB 1G1JA 3BASA 1MV8A 1JNMA 5KTBA 2XU6A 1N86C 3RK2B 1FZBA 1NTKK 1ZLLA 1JY3N 2P2UA 2FFDC 3RK3C 4WBAA 1WRGA 5APSA 1OXZA 1L4AB 1J1EC 5BU8B 4WB4A 2WPQA 1IFIA 3NMDA 1JOCA 1JTHB 2KSJA 4LC1A 3VOPA 3RK2C 2J60A 4ZFGA 3A5TA 1URQA 1HVVA 2Q3IA 2IFNA 1N86A 2WNPF 2J59M 1L4AC 1NTMK 4DOJA 4C46A 1SFCB 2FFDA 1IK9A 2ZXEB 1ZR2A 1SVFA 4R9JA 3NFQA 3M9BA 2J3FD 2C0WA 2M8RA 3VP8A 2LKMA 5AW8B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JYO X;  4NYT A;  1LT9 C;  4EPU A;  3FIB A;  1RE3 C;  2HOD A;  2J61 B;  1M1J C;  1JY3 P;  1RE4 B;  1FZG C;  1FZD A;  1Z3U A;  1RF0 A;  3E1I C;  1FZE C;  1FZF A;  1JC9 A;  2J3G A;  2J1G A;  1Z3S A;  1FZA A;  3H32 B;  2JHK F;  3BVH B;  2OYH B;  1LTJ A;  2Z4E C;  1M1J B;  1FZB C;  4JZC A;  1FZG B;  3E1I B;  1RE4 C;  2GY7 A;  2J3O A;  2J0H A;  1JY2 O;  1RE3 A;  2XNX C;  2Z4E B;  1LWU B;  1FZB B;  3H32 C;  3BVH C;  2HLO A;  2OYH C;  2JHM F;  1JY3 O;  1FZE A;  2A45 H;  2XNX B;  2Q9I B;  1LWU C;  2J61 A;  2J0Y A;  1RF1 B;  2J2P A;  1RE4 A;  2FIB A;  3HUS B;  1T3U A;  1FZC B;  2OYI B;  1N86 B;  2H43 B;  1LT9 A;  2FFD B;  3H32 A;  2HPC B;  1N73 B;  3BVH A;  2OYH A;  1M1J A;  1FZG A;  2Q9I C;  2A45 I;  2JHH C;  3E1I A;  1RF0 C;  1RF1 C;  1JY2 N;  3GHG B;  3HUS C;  1FZC C;  2OYI C;  4M7F A;  1FZA C;  1FIC A;  1N86 C;  2HOD B;  2Z4E A;  2H43 C;  1FZB A;  1LWU A;  1JY3 N;  2FFD C;  1N73 C;  2HPC C;  2D39 A;  2J64 A;  2A45 G;  1RF0 B;  1FZF B;  1W2E A;  1FZA B;  2XNX A;  3GHG C;  1LTJ B;  1FID A;  2J5Z A;  2HLO C;  2Q9I A;  2HOD C;  2JHI F;  2J60 A;  4ZFG A;  1RF1 A;  1FIB A;  2J0G A;  3HUS A;  2J3F A;  2JHL F;  1FZC A;  2OYI A;  1LT9 B;  4R9T A;  1RE3 B;  1N86 A;  2WNP F;  1FZF C;  4M7H A;  2H43 A;  2FFD A;  1N73 A;  2HPC A;  2HLO B;  1LTJ C;  2J3U A;  4R9J A;  1FZE B;  2J3F D;  3GHG A;  1JY2 P; 
#chains in the Genus database with same CATH topology
 3CCM P;  2KI7 B;  1EDL A;  1U7M A;  2PGD A;  2FYZ A;  1L4A A;  3B5N B;  3MUD A;  3S9O A;  4ASW A;  3M9H A;  3MD0 A;  3Q5P A;  2BCC J;  2M5A B;  2E5Y A;  3C9I A;  2OTJ P;  2RN0 A;  3USS A;  3IR9 A;  2YNY A;  2FYU G;  2IFM A;  2YO2 A;  1OW7 A;  1E79 H;  5CJ4 A;  3EQ2 A;  3AEA C;  3M9Q A;  2N1T C;  3U1C A;  2R32 A;  1L4A D;  1EQ7 A;  3Q1M A;  1SLQ A;  2XZR A;  4EIJ A;  2WPR A;  1RQV A;  2YIU C;  3Q3D A;  1PP9 E;  5APX A;  1Y8A A;  2Z5H A;  2IBZ I;  1VF5 B;  4HB1 A;  3PLN A;  1RF0 B;  1N8R Q;  1NTZ K;  2B87 B;  4PJ0 H;  1HGZ A;  2J5Z A;  2HLO C;  1PPJ D;  2Y9Y A;  2CPB A;  3CXH H;  1BE3 J;  2OYI A;  4R9T A;  1SQX D;  3WUU A;  1N73 A;  2HFE D;  2QJK B;  3GW6 A;  1GTW A;  2IYP A;  1LT9 C;  2H89 C;  2ZT9 B;  3AEE C;  1Q81 Q;  4OGQ D;  1D7M A;  1L0L E;  2KS1 A;  5B5E H;  1FZE C;  2H88 C;  1ZME C;  2FYU K;  4AUW A;  1X8Y A;  4IFD K;  4CPG A;  1FC2 C;  1KIL D;  1K05 A;  2XNX C;  1SQQ J;  1LWU B;  4I7Z B;  4ZKU A;  4EDF A;  4AQR D;  1GU5 A;  5KJ7 A;  3IN6 A;  3H1J J;  2QM8 A;  4BRY A;  3L73 D;  3OA7 A;  2I8D A;  3AE7 C;  4IL6 H;  1NTK J;  3H1I G;  1SQX E;  2WSE J;  1QL2 A;  2YMY A;  1NU1 J;  3CX5 H;  4N78 D;  1KB9 I;  1GW4 A;  2O3J A;  5KJ7 D;  5AW3 B;  1FDO A;  3SSU A;  1PPJ G;  2KOG A;  1S2E A;  2CK3 H;  4LLH A;  4W7Y A;  1S5L E;  3HUS A;  4H44 B;  4A7P A;  3SWY A;  1KYO D;  2J3U A;  1KIL E;  3EFF K;  3CCR P;  2N1T A;  4YXD C;  2NPS A;  3L74 D;  4GT1 A;  5AVT B;  2C9L Y;  5CMZ A;  2B89 A;  3E1R A;  1JY3 P;  1JEK A;  2WSC J;  3TDK A;  3E1I C;  3L73 E;  1HWT C;  5AVV B;  1M1J B;  2WVR A;  3CCU P;  1S5L X;  2E75 B;  2O1J A;  3T97 B;  4GDO A;  4NPF X;  1L0L K;  3MP7 B;  3HE5 A;  2FXM A;  2C9N Y;  1SS1 A;  3S4R A;  1T3J A;  3H32 C;  3AE6 C;  3M0A A;  2HLO A;  3VMZ A;  2KIK A;  3CWB J;  1HGV A;  2NPS D;  4N78 E;  2Y9Z A;  1N7S C;  2AEF A;  2UWJ E;  4YPC A;  5KLV G;  1FOS F;  1M7L A;  5H2F H;  3S1K A;  2RH0 A;  5APU A;  1LT9 A;  1YIT P;  3BCC D;  4JYC A;  1KYO E;  3GHG B;  1FZC C;  1NTZ J;  2E74 D;  1VQK P;  1KTM A;  3A3Y B;  2E76 C;  1SQX K;  1NTM E;  1NWQ A;  3VMY A;  2XNX A;  1NO4 A;  1OW8 A;  1K9M Q;  1XTG B;  3RL0 B;  2Q9I A;  2WSE H;  4I6M C;  4MN4 C;  1ZRT D;  2JHL F;  5E79 E;  3H1L J;  3MIW A;  2M3B A;  1MZ9 A;  3UIA A;  1URQ D;  2GM4 A;  1VQ7 P;  1QVG O;  1KD1 Q;  3L74 G;  2K9J A;  2QVA A;  1QLE D;  3F89 A;  3HD7 A;  3Q2Y A;  2FYU J;  1JC9 A;  2J1G A;  1LTJ A;  1W5C E;  1OFC X;  1IFD A;  1M90 Q;  2QEX P;  2WSS H;  1ZV8 A;  1NKN A;  2WSC H;  4DCK A;  3AE3 C;  2QIW A;  5GTI H;  3L70 E;  1BGY E;  2MKV A;  1BE3 G;  3HD7 D;  2IDB A;  5CJ0 A;  3V6I A;  1U7J A;  1N86 B;  2LR2 A;  2W90 A;  3L72 E;  1H0T B;  1ZRT E;  3BCC G;  3RK3 B;  1NH4 A;  1J1E B;  3OAK A;  3E1I A;  2M0B A;  1JNM A;  2ZAE B;  1BSN A;  4WBA A;  1WRG A;  1OXZ A;  4WB4 A;  1SQQ G;  1R5L A;  4GOF A;  3OW2 O;  2J59 M;  1L4A C;  1NTM K;  3G71 P;  3MUD C;  3MHV A;  3CPW O;  1L0N D;  3L71 D;  3H1J G;  2J3F D;  2M8R A;  3VP8 A;  5AW8 B;  2V7Q J;  3KXD A;  2AXT H;  1EZV G;  1FOS E;  1FZG C;  1NTK G;  1KMI Z;  1LP1 A;  4L74 A;  1EDJ A;  3H1H D;  1VF5 D;  1P84 I;  1Q90 D;  2PAJ A;  2VRS A;  3D6Y A;  4BXL A;  3FXE A;  2Z4E B;  1SFC A;  2HYN A;  4IOI H;  2D2C B;  1FDM A;  3AED C;  3GF3 A;  3O6Q B;  2JWD A;  1J2J B;  2L91 A;  3RK2 D;  4OGQ C;  3AEB C;  3C8V A;  3TNU B;  1KQG B;  3VMA A;  1NAF A;  1VQL P;  3NXS A;  2OYH A;  4PD4 D;  1LTT C;  2K9Y A;  3I5C A;  1L0N E;  1SQX J;  1GMJ A;  3L71 E;  1KIL C;  2OYI C;  5APW A;  1UIX A;  1GL2 A;  2P10 A;  2JKV A;  1N73 C;  2QA4 P;  3PP5 A;  3M91 A;  1MKM A;  4DZO A;  1VQ9 P;  3H1K D;  1HJ0 A;  5KLI C;  4H0L D;  5KAF E;  1OIP A;  3V2Q A;  1PGP A;  4EI2 A;  1VQN P;  1NHL A;  5AW4 B;  1S3J A;  3H1H E;  1LT9 B;  1Q7Y Q;  3CWB G;  4D6T D;  3SFE C;  2HPC A;  4JQ0 D;  1FZE B;  2JR8 A;  2WSF J;  1AFO A;  3AEC C;  5AW6 B;  2YKP A;  1GL2 D;  1A02 J;  1PFI A;  3VN0 A;  3GLM A;  3CXH I;  1OWA A;  2P58 A;  2DW3 A;  2FYN C;  3L73 J;  5KJ7 C;  1PP9 D;  1NTZ G;  2V7Q H;  4PD4 E;  2OYO A;  1VL2 A;  3HTK B;  3P8C D;  2M3E A;  1IFN A;  1FS0 E;  2K9J B;  2A45 H;  2KB7 P;  2YMK A;  5KKZ B;  5TIS E;  3H1K E;  3H1L G;  3MGN A;  5CCG D;  3ABV C;  1T3U A;  1HH0 A;  1YIJ P;  5APT A;  2GA1 A;  2IPP A;  1FZG A;  1NAY A;  1RY3 A;  4D6T E;  4W7Z A;  3KQG A;  3KZI E;  3HUS C;  2O01 J;  4M7F A;  1FZA C;  2W83 C;  1FIC A;  2QJP C;  3SWF A;  1K73 Q;  3L37 A;  4GOD A;  1L0L D;  3L74 J;  2Q5U A;  3GG2 A;  1DX7 A;  1L0N K;  2NPS C;  3G3Z A;  4OVN F;  4XE5 B;  4ASV A;  3LID A;  4KHX A;  1RF1 A;  1OW6 A;  2J0G A;  1LGH B;  5AVZ B;  3CX5 I;  2LXB A;  1JO5 A;  3RGU A;  3RBZ A;  2W6A A;  4EYY Q;  3U1A A;  3P8C E;  5AVQ B;  3CCL P;  4JBZ A;  1YQ3 C;  1GD2 E;  1T2K D;  2E74 C;  3HE4 B;  1Z3U A;  1KIL A;  1QL1 A;  3H32 B;  3L75 D;  1PP9 G;  1FZB C;  3KYQ A;  2WSF H;  1J1D C;  1CI6 B;  2POH A;  3CCQ P;  1VPC A;  1RH5 B;  2BAS A;  1N7S B;  1KN7 A;  3BCC J;  3WU2 H;  1JY2 O;  2KNC A;  1GK6 A;  3H6P A;  3A2A A;  3CL3 D;  3TK1 A;  1ZN5 A;  1MUU A;  5DJU B;  4C7N B;  5CCH A;  5CBN A;  1RE4 A;  3A7O A;  1FZC B;  4N3Y B;  1S9K E;  4JYB A;  3AEG C;  2V4H A;  3BVH A;  2IZ0 A;  1DEE G;  2Q9I C;  1HTL C;  4L73 A;  2JHH C;  4HJG H;  2WT7 A;  1JMM A;  4K35 A;  4WVZ A;  2IZ1 A;  2R5D A;  5CBO A;  4PV1 D;  1L0L G;  2A45 G;  3H1I E;  3CME P;  2KSE A;  3L36 A;  1AQ5 A;  1X9V A;  3CI9 A;  2KP8 A;  3AE5 C;  1OX3 A;  5CCH D;  4WY4 A;  1KYO H;  3L75 E;  3HD7 C;  2O01 H;  2H43 A;  4I1L A;  1LTJ C;  1G2C A;  1EZV I;  1CW5 A;  1WT6 A;  1LTS C;  2OGU A;  3VMX A;  2CPS A;  4JYO X;  2HG5 D;  3CLQ A;  4H13 D;  5KAI H;  2HOD A;  3RK3 D;  3L4F A;  4AYC A;  5L8R J;  4UB8 E;  3R2P A;  5E79 H;  3CCS P;  1FZF A;  1FZA A;  3W67 A;  2O01 N;  1SQX G;  4JZC A;  1BCC D;  1PGQ A;  4WY4 D;  4RO0 A;  1QEX A;  3MZW B;  5APV A;  3SWK A;  2GY7 A;  1RE3 A;  3IFM A;  2G3A A;  1NTM D;  3VTP C;  3CXH E;  1W2B O;  3PHL A;  1JCD A;  3BRT B;  2Q6Q A;  1Q86 Q;  2J61 A;  3GF7 A;  2E42 A;  1AVO A;  1SQV D;  3NTN A;  1VQO P;  4Y99 C;  2KXP B;  2IBZ D;  3WMM 0;  4IFF A;  5KLV E;  1VF5 C;  2ZYD A;  5CHX A;  1RF0 C;  1IJD B;  1L0N J;  3L71 J;  5KTB A;  2XU6 A;  3AE1 C;  1FZB A;  1ZLL A;  3R4Y A;  3CD6 P;  3L73 G;  3LW5 J;  1QVF O;  3RK3 E;  5APS A;  1L4A B;  3NMD A;  2AEM A;  3RK2 C;  2QJK C;  1URQ A;  2D2C D;  2BEZ F;  1BCC E;  4NPD A;  3EWK A;  3H1H J;  2FFD A;  2BCC E;  4ZMD A;  3L70 D;  1BGY D;  1VQ8 P;  2RMZ A;  1YI2 P;  2NRG A;  1EDK A;  4NYT A;  1LTI C;  2Q7C A;  1KZU B;  1SFC C;  4O9B A;  3FWN A;  3N7N A;  1IO4 A;  3L72 D;  3WUT A;  2GUS A;  1LT1 A;  4UB6 H;  1GU4 A;  3CX5 E;  1SQV E;  1S72 P;  1JTH A;  4I7Z C;  2IBZ E;  4H0L C;  3LIE A;  2XDJ A;  2PRR A;  1SQP D;  1UII A;  4OGQ B;  2OYH C;  4TT3 H;  3JC2 2;  4Y28 J;  1NTM G;  3FXD A;  2AEJ A;  5B66 E;  2I1K A;  4U3F D;  2R44 A;  1GL2 C;  1H89 A;  3RBX A;  3H1K J;  4L76 A;  2OYI B;  1WMK A;  5BU5 A;  3B5N A;  1N73 B;  1U57 A;  3AEF C;  1KB9 D;  4D6T J;  2M5A A;  1M56 D;  3P8M C;  1BDC A;  2Q3E A;  5KLI B;  2HPC C;  4U7J A;  1RQU A;  2KS1 B;  1ZR4 A;  2N9Y B;  4RJT A;  1NKZ B;  2JO1 A;  1VQ4 P;  2QJY B;  2JHI F;  2I1J A;  2J3F A;  1PP9 J;  3AE4 C;  1IZN B;  1FE6 A;  2ZXX A;  3B5N D;  2XV5 A;  3LW5 H;  3L70 G;  3ITK A;  1SQB D;  5H2F E;  1SQP E;  3FGA D;  3V4W A;  1GDT A;  2FYN B;  2ZYA A;  3A0B E;  2K3R A;  4BRY B;  3MTU E;  4U3F E;  2QM7 A;  1FBM A;  1M1J C;  2K37 A;  1FJK A;  1OVV A;  1M57 D;  1RF0 A;  3L72 G;  3H1J E;  1AJY A;  1MFZ A;  2B87 A;  1USE A;  1Q2N A;  2ITA A;  3TGU D;  3K5B A;  1KB9 E;  1YYC A;  1SQV K;  3L35 A;  1IK7 A;  3H25 A;  2JDI H;  4M3L A;  1NU1 E;  1L0L J;  3SFD C;  3C1L A;  1T2K C;  3A0H E;  3M0D A;  3HUS B;  4PD4 H;  2RKL A;  2QSI A;  4HH2 A;  1X79 B;  2QJP B;  2A06 E;  2WZ7 A;  2N1T B;  2A45 I;  4R4M A;  2NPS B;  4QMA A;  1RF1 C;  1FU1 A;  3IAO A;  1SQB E;  1YJW P;  5TIS H;  1LWU A;  4KT0 J;  2KYV A;  2YIU B;  3D70 A;  3PJS K;  2ZT9 D;  1PGO A;  5GTI E;  3KZI H;  5AW7 B;  3TGU E;  3TSI A;  3L75 J;  2KLV A;  3HE5 B;  4M7H A;  3WUV A;  1IC2 A;  2E74 B;  2JJL A;  3VYI A;  1JUN A;  1LTB C;  2HLO B;  1GW3 A;  3W68 A;  3KPE A;  1YJN P;  2QRX A;  1KOR A;  4EPU A;  1GK4 A;  4ZNC A;  4PV1 C;  3CCE P;  3KHU A;  1FZD A;  2ZVN B;  3PTZ A;  1SQP K;  2ZVO B;  3CCV P;  1K8A Q;  1Z3S A;  2JHK F;  2N9B A;  1L0N G;  3L71 G;  5CCH C;  1RE4 C;  1YJ9 P;  1ZXG A;  1HUC A;  1S4X A;  5GTH E;  3F5H A;  3BVH C;  5AW0 B;  2JHM F;  1JY3 O;  5CCG A;  3V5B A;  2XNX B;  1H88 A;  3II6 A;  4OH8 B;  5AW9 B;  4H13 C;  2Y0C A;  2XND H;  5M1B A;  2Q9I B;  3E7K A;  3H1H G;  2O1K A;  1CSB A;  1NU1 K;  1H8A A;  1JB0 J;  1KV4 A;  1M1J A;  2R3C A;  2Q1K A;  2YO3 A;  3T97 A;  2H7H A;  4WY4 C;  2OAR A;  1ZP0 C;  5AW2 B;  4H44 D;  3CC7 P;  1AQT A;  2E5T A;  2H43 C;  1AV1 A;  3VP9 A;  4N6J A;  3HD7 B;  2J64 A;  1VQP P;  1HBW A;  1IFJ A;  1EDI A;  1LTJ B;  5C39 A;  1SQB K;  1OMI A;  2J58 A;  2FYU E;  2NZ2 A;  2HOD C;  1PIX A;  2W27 A;  3Q5S A;  2QE7 H;  1FIB A;  2WPS A;  3V2R A;  2WTY A;  1FZF C;  1BCC J;  4R4L A;  2E75 D;  2FBW C;  3GHG A;  2E43 A;  2FY8 A;  2WIT A;  3H1K G;  1RE3 C;  1NTM J;  5APY A;  1KYO I;  1P84 D;  1S9K D;  1CZQ A;  4K3A A;  1KFM A;  2KK7 A;  1VQ5 P;  2IYO A;  4D6T G;  1A02 F;  2Z4E C;  1SQV J;  1OVR A;  2C0X A;  3E1I B;  2YXR B;  1NGM B;  2D2C C;  1OVU A;  4L75 A;  3H1I D;  1AA0 A;  5AW1 B;  4UB8 H;  4RES B;  1S5L H;  4Y99 B;  2K1A A;  2W6B A;  1JMB A;  3Q5R A;  2J0Y A;  3FX0 A;  2J2P A;  2FIB A;  5TJH A;  1SP4 A;  5AVU B;  2ZFC A;  3RL0 D;  1IFP A;  1JY2 N;  1MFT A;  1URQ C;  3JCU E;  2OTL P;  1G1J A;  3BAS A;  3L70 J;  3RK2 B;  1BGY J;  2P2U A;  2FFD C;  3QWO C;  1DD3 A;  1P84 E;  5BU8 B;  1LP1 B;  1BDD A;  4XFJ A;  1JOC A;  2KSJ A;  3VOP A;  3L72 J;  4HKZ H;  4ZFG A;  3A5T A;  2E76 B;  1N86 A;  2AXC A;  4DOJ A;  1SFC B;  4YXW H;  1H0T A;  1IK9 A;  2ZXE B;  3CXH D;  3NFQ A;  4DJG A;  4GOE A;  1SQP J;  2LKM A;  1R8E A;  2WMM A;  4GKG A;  3QH9 A;  4H0L B;  2FKW B;  4U3F J;  1N2D C;  2J5U A;  3FWL A;  4WWI A;  4W80 A;  5DJT B;  2OYH B;  3PH0 A;  5KLV D;  2WPV B;  1PPJ E;  3G4S P;  2MJZ A;  1GL2 B;  3D6Z A;  5KKZ C;  3B5N C;  2FXP A;  1PGJ A;  2PFX A;  3B4S A;  3L75 G;  3G9R A;  3O8Z A;  2WWW A;  2BCC D;  2HPC B;  2GUV A;  4PJ0 E;  4C7R A;  3V2P A;  1HJB A;  2BEQ D;  5B66 H;  2OQQ A;  4DT0 A;  5EFW B;  3ZDM A;  2KUB A;  3P7K A;  1SQB J;  3IF4 A;  2Z4E A;  4HYT B;  2JP3 A;  3CX5 D;  3WU2 E;  1LTA C;  5AVY B;  3O6Q A;  2PP6 A;  3CMA P;  5AVX B;  2YKQ A;  1M8O B;  5APQ A;  4YTP C;  3TNU A;  5B5E E;  3TGU J;  1Z56 A;  1ZW0 A;  2K88 A;  1T8Z A;  3FIB A;  3B8E B;  2N1T D;  1BE3 D;  3TYY A;  3CC4 P;  2ZT9 C;  3KDP B;  1FZG B;  1X0T A;  3M0D C;  4BWN A;  1KFN A;  1OZH A;  3A0B H;  5AVS B;  4OWF A;  1JCC A;  3P32 A;  4IL6 E;  1Y9B A;  2YKO A;  1FZE A;  3B71 A;  2IX7 C;  1YHQ P;  3L74 E;  1YBK A;  3AE9 C;  1LWU C;  4RKU J;  1BCC G;  1RF1 B;  1KB9 H;  2BCC G;  1NJI Q;  2JWA A;  5KAI E;  2P67 A;  1VQ6 P;  1SQQ D;  3JSV C;  1R5S A;  3G6E P;  5BVZ A;  4IL6 X;  2HR3 A;  3HTK A;  3A0H H;  3V2N A;  4TLF A;  3U59 A;  4PD4 I;  3H1J D;  1EXI A;  2Z5I A;  1KIL B;  1SQV G;  1NOH A;  1N7L A;  3D71 A;  1EZV D;  2B88 A;  2IBZ G;  1G1I A;  2W8Z A;  2LXC B;  1JM0 A;  1L2P A;  1BE3 E;  1NTK D;  1S1C X;  1FJP A;  2QG4 A;  2KNC B;  1IFM A;  2G8Y A;  4PV1 B;  1FDI A;  4JPZ B;  3BAT A;  2R3S A;  1NU1 D;  3BCC E;  4JF7 A;  4NPE A;  5KLV K;  4H44 C;  1JY2 P;  1RHZ B;  3OJA B;  1NVO A;  1RE4 B;  2L5G B;  5CCG C;  2XKM A;  2A06 D;  3BVH B;  1LTG C;  3I55 P;  4B86 A;  1BGY G;  2WT7 B;  2KZI A;  1SQQ E;  2J0H A;  2R5B A;  4H13 B;  2Y0D A;  1DIP A;  1LNQ A;  1PL5 A;  1X22 A;  1QGK B;  5KAF H;  2E75 C;  1E5W A;  1XTC C;  1GZL A;  1FAV A;  2P7J A;  1P84 H;  4WY4 B;  2YXQ B;  1EZV E;  3HE4 A;  1DEB A;  1KQS O;  2H43 B;  1NTK E;  3H32 A;  5GTH H;  1G2C B;  1SQP G;  3HRN A;  1BSH A;  4I2L C;  4EOT A;  1CI6 A;  3RL0 g;  1VQM P;  1Q82 Q;  1N7S A;  3CWB D;  4UB6 E;  2H8P D;  4U3F G;  2HOD B;  1EXJ A;  3M06 A;  2D39 A;  3PRJ A;  3V4Q A;  1FZF B;  1W2E A;  1DH3 A;  1FZA B;  3GHG C;  1PZQ A;  1FID A;  3N4X A;  4C7N A;  5AVW B;  1ZOY C;  1YTZ T;  3I56 P;  3CCJ P;  1FZC A;  1RE3 B;  1USD A;  1T6A A;  1KQF B;  1NTZ D;  1NU1 G;  3RL0 C;  3H1I J;  1N7S D;  4Z1M H;  2J61 B;  1TU3 F;  2SPZ A;  2ZJS E;  1VDF A;  1HF9 A;  4GIF A;  2KZJ A;  2J3G A;  1M1K Q;  1AVY A;  2A06 G;  2B9B A;  2W6J H;  4KJM A;  2FXO A;  3H1L D;  3GMA A;  4XA4 A;  3BRV B;  1SQB G;  1Y47 A;  2J3O A;  4LGD E;  3EFG A;  1FZB B;  1J1D B;  2WQY C;  3CWB E;  4ZKP A;  1NYH A;  2E76 D;  5AW5 B;  2FYU D;  1SQQ K;  1KC8 Q;  1SFC D;  4IFM A;  3TGU G;  1QX8 A;  1URQ B;  2JEE A;  1YTZ I;  2P1J A;  5K5G B;  1YQ4 C;  3CC2 P;  2FFD B;  5AVR B;  1KQL A;  1NTZ E;  1MV8 A;  1N86 C;  1DD4 A;  1NTK K;  1JY3 N;  3TF5 A;  3RK3 C;  2QJY C;  2Y0E A;  2ZYG A;  1J1E C;  2AXT E;  1K04 A;  2WPQ A;  1IFI A;  1PV3 A;  1JTH B;  4LC1 A;  2J60 A;  2OTK E;  1HVV A;  2Q3I A;  3AE2 C;  3H1L E;  3JCU H;  2IFN A;  5KLV J;  2WNP F;  3AE8 C;  4C46 A;  1LJ2 A;  1ZR2 A;  1SVF A;  4R9J A;  2KLU A;  3M9B A;  2C0W A;  1EC5 A; 
#chains in the Genus database with same CATH homology
 4NYT A;  1LTI C;  2Q7C A;  4GKG A;  1KZU B;  1SFC C;  1FOS E;  2FKW B;  4O9B A;  1FZG C;  1N2D C;  3N7N A;  1IO4 A;  2FYZ A;  1L4A A;  2GUS A;  4W80 A;  3B5N B;  3MUD A;  1GU4 A;  2OYH B;  1JTH A;  3M9H A;  3MD0 A;  3LIE A;  2XDJ A;  2PAJ A;  2VRS A;  3C9I A;  2MJZ A;  1GL2 B;  2Z4E B;  1SFC A;  2HYN A;  3B5N C;  2OYH C;  3IR9 A;  2YNY A;  1FDM A;  2I1K A;  2IFM A;  2YO2 A;  5CJ4 A;  3EQ2 A;  1J2J B;  1GL2 C;  3RK2 D;  1H89 A;  3O8Z A;  2WWW A;  3M9Q A;  2N1T C;  3TNU B;  2OYI B;  3U1C A;  2R32 A;  5BU5 A;  1L4A D;  1EQ7 A;  1NAF A;  1SLQ A;  3B5N A;  2XZR A;  3NXS A;  4EIJ A;  2OYH A;  2GUV A;  2HPC B;  1N73 B;  4C7R A;  1LTT C;  3V2P A;  3I5C A;  1HJB A;  2WPR A;  5APX A;  1KIL C;  3P8M C;  2OYI C;  5APW A;  2Z5H A;  3P7K A;  1GL2 A;  2Z4E A;  1N73 C;  2HPC C;  4HYT B;  3PP5 A;  3M91 A;  1RF0 B;  4DZO A;  1ZR4 A;  1LTA C;  1NTZ K;  5AVY B;  2PP6 A;  1NKZ B;  1HGZ A;  5AVX B;  2J5Z A;  2HLO C;  2YKQ A;  5APQ A;  2JHI F;  2CPB A;  3V2Q A;  2I1J A;  1NHL A;  5AW4 B;  3TNU A;  2J3F A;  2OYI A;  1LT9 B;  4R9T A;  1Z56 A;  3B5N D;  2XV5 A;  1N73 A;  2HPC A;  3LW5 H;  2HFE D;  1GTW A;  1FZE B;  3V4W A;  1GDT A;  1AFO A;  1T8Z A;  1LT9 C;  3FIB A;  5AW6 B;  2YKP A;  1GL2 D;  1A02 J;  3MTU E;  1PFI A;  2QM7 A;  1FBM A;  1M1J C;  1FJK A;  3VN0 A;  3B8E B;  2N1T D;  1RF0 A;  1OWA A;  1FZE C;  1MFZ A;  5KJ7 C;  3TYY A;  3KDP B;  1FZG B;  2FYU K;  4AUW A;  1X8Y A;  3M0D C;  4IFD K;  1KFN A;  1KIL D;  1YYC A;  2XNX C;  5AVS B;  3HTK B;  1LWU B;  3P8C D;  1JCC A;  3P32 A;  1SQV K;  4ZKU A;  3L35 A;  4AQR D;  1IFN A;  2YKO A;  1GU5 A;  1FZE A;  4M3L A;  2A45 H;  2IX7 C;  2KB7 P;  5KJ7 A;  2QM8 A;  1T2K C;  1LWU C;  3M0D A;  1RF1 B;  5CCG D;  3MGN A;  3OA7 A;  3HUS B;  1T3U A;  1HH0 A;  4HH2 A;  1X79 B;  2P67 A;  5APT A;  2WZ7 A;  2IPP A;  1FZG A;  1RY3 A;  2N1T B;  4W7Z A;  2A45 I;  3KQG A;  2NPS B;  1QL2 A;  1RF1 C;  2YMY A;  3HUS C;  5BVZ A;  1FU1 A;  4M7F A;  1FZA C;  1FIC A;  3HTK A;  1LWU A;  3SWF A;  3L37 A;  3V2N A;  2KYV A;  3U59 A;  4N78 D;  2Q5U A;  1DX7 A;  2Z5I A;  1KIL B;  1GW4 A;  1L0N K;  2NPS C;  1NOH A;  3G3Z A;  1N7L A;  5KJ7 D;  5AW3 B;  4XE5 B;  1G1I A;  3LID A;  2KOG A;  4KHX A;  1RF1 A;  4LLH A;  4W7Y A;  3HUS A;  5AW7 B;  1FJP A;  2J0G A;  1LGH B;  3TSI A;  2KLV A;  3HE5 B;  5AVZ B;  4M7H A;  3SWY A;  1JO5 A;  1IFM A;  1IC2 A;  2JJL A;  3VYI A;  1JUN A;  1LTB C;  2J3U A;  2HLO B;  3BAT A;  1GW3 A;  3KPE A;  2W6A A;  3U1A A;  2N1T A;  3P8C E;  4JF7 A;  5AVQ B;  2NPS A;  5KLV K;  4GT1 A;  5AVT B;  1JY2 P;  3OJA B;  2C9L Y;  4EPU A;  5CMZ A;  1GK4 A;  1GD2 E;  1T2K D;  1JY3 P;  1RE4 B;  3HE4 B;  2L5G B;  1FZD A;  1Z3U A;  1SQP K;  5CCG C;  3E1I C;  1KIL A;  2XKM A;  1QL1 A;  1Z3S A;  3H32 B;  2JHK F;  3BVH B;  2N9B A;  1HWT C;  5AVV B;  1M1J B;  1LTG C;  1FZB C;  3KYQ A;  2WSF H;  1J1D C;  1CI6 B;  2O1J A;  4B86 A;  2POH A;  5CCH C;  1VPC A;  1RE4 C;  2BAS A;  1N7S B;  1HUC A;  2WT7 B;  1L0L K;  2J0H A;  2R5B A;  3HE5 A;  2FXM A;  2C9N Y;  1JY2 O;  1GK6 A;  1T3J A;  3H32 C;  3H6P A;  3M0A A;  3BVH C;  2HLO A;  3A2A A;  3CL3 D;  3VMZ A;  5AW0 B;  3TK1 A;  2JHM F;  1JY3 O;  1ZN5 A;  5CCG A;  1E5W A;  1HGV A;  3V5B A;  1XTC C;  2NPS D;  4N78 E;  1GZL A;  2XNX B;  1H88 A;  1MUU A;  1N7S C;  1FAV A;  3II6 A;  4OH8 B;  5AW9 B;  2P7J A;  4C7N B;  2Q9I B;  5CCH A;  4WY4 B;  1RE4 A;  2O1K A;  3HE4 A;  3A7O A;  1FOS F;  1M7L A;  1CSB A;  1DEB A;  1FZC B;  4N3Y B;  1S9K E;  4JYB A;  1NU1 K;  5APU A;  1H8A A;  1LT9 A;  2H43 B;  3H32 A;  3BVH A;  1G2C B;  3HRN A;  1M1J A;  4I2L C;  4EOT A;  2R3C A;  1CI6 A;  2Q9I C;  2YO3 A;  1HTL C;  4JYC A;  3T97 A;  2H7H A;  4WY4 C;  2JHH C;  2OAR A;  3GHG B;  5AW2 B;  1N7S A;  2WT7 A;  2H8P D;  1FZC C;  1JMM A;  2HOD B;  2R5D A;  2H43 C;  3VP9 A;  4N6J A;  3HD7 B;  3M06 A;  2D39 A;  2J64 A;  2A45 G;  3A3Y B;  3V4Q A;  1SQX K;  1HBW A;  3L36 A;  1FZF B;  1W2E A;  1IFJ A;  1DH3 A;  1AQ5 A;  1FZA B;  1NWQ A;  3VMY A;  2XNX A;  3GHG C;  1LTJ B;  1SQB K;  1NO4 A;  1X9V A;  2J58 A;  3CI9 A;  1FID A;  3N4X A;  4C7N A;  1XTG B;  2KP8 A;  3RL0 B;  2Q9I A;  2HOD C;  2W27 A;  2WSE H;  5AVW B;  5CCH D;  4WY4 A;  3HD7 C;  1FIB A;  4I6M C;  2O01 H;  2JHL F;  1YTZ T;  1FZC A;  2WPS A;  3V2R A;  2WTY A;  1RE3 B;  1FZF C;  2H43 A;  3MIW A;  4I1L A;  1LTJ C;  2M3B A;  1G2C A;  1MZ9 A;  1CW5 A;  3UIA A;  3RL0 C;  1URQ D;  1WT6 A;  2GM4 A;  1LTS C;  3GHG A;  1N7S D;  3VMX A;  2CPS A;  2E43 A;  4JYO X;  2HG5 D;  2WIT A;  3CLQ A;  1RE3 C;  2HOD A;  3RK3 D;  5APY A;  2J61 B;  3L4F A;  3HD7 A;  4AYC A;  1VDF A;  1S9K D;  1CZQ A;  4GIF A;  1KFM A;  3R2P A;  1FZF A;  1JC9 A;  2J3G A;  2J1G A;  1FZA A;  1LTJ A;  1A02 F;  2Z4E C;  4JZC A;  2C0X A;  4WY4 D;  4XA4 A;  3BRV B;  3E1I B;  1IFD A;  5APV A;  2GY7 A;  2J3O A;  4LGD E;  3EFG A;  1ZV8 A;  1RE3 A;  1NKN A;  1FZB B;  2WSC H;  1J1D B;  3IFM A;  5AW1 B;  4ZKP A;  5AW5 B;  4RES B;  3VTP C;  4Y99 B;  1JCD A;  3BRT B;  2W6B A;  1SQQ K;  1SFC D;  4IFM A;  2J61 A;  2J0Y A;  3HD7 D;  2J2P A;  5CJ0 A;  1URQ B;  2FIB A;  2JEE A;  1YTZ I;  2P1J A;  2E42 A;  3NTN A;  1N86 B;  4Y99 C;  2FFD B;  3RK3 B;  1SP4 A;  3WMM 0;  4IFF A;  1NH4 A;  5AVU B;  5AVR B;  1KQL A;  2ZFC A;  3RL0 D;  1J1E B;  3OAK A;  5CHX A;  3E1I A;  1RF0 C;  1JY2 N;  1URQ C;  1IJD B;  1G1J A;  3BAS A;  1MV8 A;  1JNM A;  5KTB A;  2XU6 A;  1N86 C;  3RK2 B;  1FZB A;  1NTK K;  1ZLL A;  1JY3 N;  2P2U A;  2FFD C;  3RK3 C;  4WBA A;  1WRG A;  5APS A;  1OXZ A;  1L4A B;  1J1E C;  5BU8 B;  4WB4 A;  2WPQ A;  1IFI A;  3NMD A;  1JOC A;  1JTH B;  2KSJ A;  4LC1 A;  3VOP A;  3RK2 C;  2J60 A;  4ZFG A;  3A5T A;  1URQ A;  1HVV A;  2Q3I A;  2IFN A;  1N86 A;  2WNP F;  2J59 M;  1L4A C;  1NTM K;  4DOJ A;  4C46 A;  1SFC B;  2FFD A;  1IK9 A;  2ZXE B;  1ZR2 A;  1SVF A;  4R9J A;  3NFQ A;  3M9B A;  2J3F D;  2C0W A;  2M8R A;  3VP8 A;  2LKM A;  5AW8 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...