1RF1C

Crystal structure of fragment d of gammae132a fibrinogen with the peptide ligand gly-his-arg-pro-amide
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
298
structure length
298
Chain Sequence
YEASILTHDSSIRYLQEIYNSNNQKIVNLKEKVAQLAAQCQEPCKDTVQIHDITGKDCQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQSAIPYALRVELEDWNGRTSTADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEGNCAEQDGSGWWMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIPFNRLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibrinogen alpha/alpha-E chain
publication title Calcium-Binding Site beta2, Adjacent to the "b" Polymerization Site, Modulates Lateral Aggregation of Protofibrils during Fibrin Polymerization.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
total genus 91
structure length 298
sequence length 298
chains with identical sequence F
ec nomenclature
pdb deposition date 2003-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1rf1C01
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 1rf1C02
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 1rf1C03
2Q9IA 2HODC 1FZBA 2A45G 2OYIA 1T3UA 2J0YA 2WNPF 1LT9C 2J61B 1LWUB 3BVHA 2J3GA 1M1JC 1JY2O 1RE3A 3FIBA 1FZEC 1RF0B 4JYOX 1N86C 1Z3SA 2OYHB 1N73A 2J61A 2JHKF 1FZBB 2OYIB 2FFDA 1LTJA 2J1GA 3HUSC 2FIBA 2Z4EA 2OYHA 1FZCC 4M7FA 2H43B 3BVHB 2XNXB 2HPCB 1RE3B 1FZFC 4NYTA 4R9TA 2HLOA 1N73B 2H43A 1FZAB 3GHGA 4R9JA 1W2EA 2A45H 2XNXA 2A45I 2HPCA 1LWUC 2FFDB 1RF1B 1LTJB 1JC9A 2J3FD 2JHHC 1RF0C 2Z4EB 1RE4B 1FZAA 2HODB 3E1IC 2J3OA 2Q9IC 1RF1A 1FZGA 3H32A 2OYIC 1FZBC 4M7HA 2HLOB 3GHGB 1RE4A 2H43C 1FIBA 1FIDA 3BVHC 2HODA 1RE3C 2J5ZA 1JY3P 2J60A 4ZFGA 1N73C 1LT9A 1M1JA 1FZGB 3H32B 1FZEA 2J0GA 2FFDC 1N86A 1LTJC 4JZCA 3HUSB 1JY3N 2D39A 1JY2P 2OYHC 2J3FA 2Z4EC 2J2PA 2J64A 1FICA 2JHLF 2JHIF 1Z3UA 4EPUA 3HUSA 2HLOC 1LT9B 1FZCA 3GHGC 1JY2N 1M1JB 2XNXC 1FZEB 2J0HA 2HPCC 1FZFA 1N86B 2J3UA 2GY7A 1FZAC 3E1IB 1LWUA 2Q9IB 1RF1C 1FZGC 3H32C 1FZDA 1RF0A 1FZCB 2JHMF 1JY3O 1RE4C 3E1IA 1FZFB
chains in the Genus database with same CATH superfamily
4EDFA 2A45G 4CPGA 1YYCA 4OGQC 3S1KA 2R32A 2WPRA 3CCRP 1FBMA 1KN7A 1KFNA 3PH0A 1JEKA 1FZEC 1MZ9A 1IK9A 1NTKG 4GODA 5TISH 1UIXA 1SQQJ 3FWNA 4XFJA 3HUSC 1KILD 1MUUA 4H0LC 4NPDA 2FXPA 2XNXB 1BCCD 2GA1A 5APWA 1SQVG 1FZAB 3GHGA 3VMYA 1NKNA 5AW4B 2Z4EB 1N7SC 4WY4C 1S5LX 2FYNC 2P7JA 2QJPC 3WU2H 1FIBA 3V4QA 1KILA 2I8DA 2FYUK 5B5EH 3KDPB 2ZT9D 3HD7D 4IL6E 4YXWH 2XNDH 3M0DC 3WUTA 4U3FE 4EOTA 1NTKK 3V5BA 4C7NB 2GUSA 4XE5B 3RK3C 3HE4A 1KB9I 2WPSA 2CK3H 2O1KA 1ZN5A 1PP9E 3HD7A 3QH9A 3H1KE 5CCGD 5GTHE 3EFGA 5KLIC 5AVUB 4U3FJ 2ZYGA 2QJYB 2H7HA 3A0BE 3V2RA 2WNPF 2W8ZA 2JJLA 2O01J 1OWAA 3FIBA 2YKQA 3H1JE 3CX5I 4PV1C 5KAIE 1IJDB 1PP9J 3H1KJ 1PGOA 5CCGA 3RL0C 4M7FA 5AVQB 1IFDA 3IFMA 1P84D 3JCUE 5CBNA 4NYTA 3B71A 5DJUB 2L5GB 1IZNB 3A0HH 2KIKA 3Q5PA 1SP4A 4C46A 2WITA 4NPEA 3H1JJ 1URQC 1MKMA 2Q3IA 1VL2A 1YQ4C 2K9YA 2E74C 1SQQD 1GDTA 2WSCH 5AW0B 1RE3C 3BCCE 3H25A 2IFMA 1IFPA 1L0LK 4H13C 1EDKA 2M3EA 1JY3N 1BSHA 5H2FE 1SQBE 2AXTH 1HTLC 3H1ID 1SVFA 1QL2A 3A7OA 1SLQA 2KSEA 2XNXC 2KUBA 2POHA 3USSA 2JR8A 3BCCJ 1FZAC 1T2KC 4IFDK 4GOEA 1FE6A 3AE2C 2WSEJ 2GUVA 1SQBJ 3JSVC 2LXCB 2IBZD 4R4LA 3BRVB 5APQA 1EXIA 4AYCA 2WMMA 4I7ZB 1ZV8A 1VQPP 4W80A 2O1JA 2FKWB 3PTZA 1KQLA 2K1AA 1J1EC 1ZR4A 2OYHA 3BVHB 1Q82Q 2HPCB 1M8OB 1FU1A 2H43A 3AECC 4BRYB 2AEFA 2J3FD 1NO4A 5APYA 1R5LA 1RH5B 3H32A 2RMZA 1NJIQ 1W2BO 3V2QA 4EYYQ 4M3LA 1VQKP 2H43C 3RL0g 1LTAC 5DJTB 1VDFA 1NTME 2LKMA 1JB0J 2C0WA 1YITP 1SQPE 2J5UA 2J0GA 1WMKA 3OAKA 1JY2P 3L74G 2J3FA 2P58A 4EIJA 1X0TA 2JHIF 4IL6H 4BXLA 2BEQD 3RK2D 5AW6B 5KLVE 3L35A 1FZFA 1NTMJ 3AEDC 2O01H 2N9BA 5K5GB 3Q3DA 1IK7A 1SQPJ 2R3SA 1UIIA 3CC2P 1FZCB 1IFJA 1BDDA 5GTHH 3IAOA 1LWUB 2KZIA 5KLVJ 3VYIA 1VQMP 2XU6A 1GL2D 1J2JB 2Y0DA 3FXDA 4GT1A 1J1DC 3MIWA 1AFOA 2PFXA 3G6EP 5KAIH 2HYNA 3LW5J 1VQOP 3MGNA 1YI2P 5AVYB 5AW2B 5B66H 1JTHB 2A06E 2J59M 1G2CB 3JCUH 3AE6C 1ZMEC 5CCHC 1Q2NA 1RE4B 1Q90D 4TLFA 3CXHE 1OW7A 5L8RJ 1KYOI 2M3BA 1AVYA 1SQVE 4NPFX 2YIUC 1JMMA 2I1KA 3D6ZA 4XA4A 3GF3A 1U7MA 2CPBA 2E5YA 1S72P 1NU1D 2E75B 2BCCD 5AVWB 2WSSH 2JHLF 3MP7B 1KORA 2P1JA 3PP5A 2R5DA 4OGQB 1ZXGA 1GK6A 1FZEB 1W5CE 2HPCC 1SQVJ 2KS1B 1KILE 1QVFO 1BCCE 4H0LB 3H1HD 3QWOC 3F5HA 1SQXD 2N1TD 3EFFK 4H44B 2B88A 1NU1G 3FGAD 2BCCG 5M1BA 4Y99C 1N86C 1N7SB 1N73A 3H1LD 2P67A 3KQGA 5E79H 1CZQA 1BCCJ 2JEEA 1L4AD 2IDBA 2QJPB 1YJWP 4UB6E 1VF5D 5APTA 3B8EB 3AEAC 5APSA 2E5TA 2HLOA 2N1TA 3AE1C 4PJ0E 1BGYG 2P10A 3LIEA 1NKZB 1OVUA 3RK3B 1G1JA 3M9QA 1FZGA 1FZBC 5AW1B 1ZP0C 3A0HE 1NVOA 2OTKE 4DT0A 1L4AA 2JO1A 3T97B 3GMAA 4U7JA 1KQGB 3KPEA 3L70D 5KLIB 3I55P 1GU4A 1K9MQ 2G8YA 1OW8A 4RJTA 2NPSD 3EQ2A 1LTTC 3L37A 1QVGO 4L74A 2W6BA 2NZ2A 1DD3A 2RH0A 3L4FA 3L75D 4PV1B 1GTWA 3CCMP 1JCDA 2FYUD 1P84E 2RN0A 1H8AA 3RL0B 5AW9B 2B89A 2M5AA 1RE4C 2WSCJ 2Q5UA 1NTKD 2NPSA 3AE8C 2OYIA 2KI7B 5KJ7D 3L70G 1CI6A 3FXEA 1LT9C 2WSFH 4L75A 2IZ1A 1YJNP 2J3GA 3HE5B 5KKZB 4ZKPA 1URQB 3VP8A 1LTJA 3L75G 3HTKA 2E74B 2Q7CA 2AXCA 2YXRB 4ASVA 1RE3B 3N4XA 2QSIA 3KZIH 2FYUG 2ZVOB 5KJ7A 2A45H 3H1IE 4H13B 1Y47A 2WQYC 1LTIC 1SQPK 3K5BA 2KSJA 4IFFA 1JM0A 2PGDA 1RF1A 1M7LA 1MFZA 2G3AA 3G71P 2QM7A 3CXHH 3NTNA 3L73G 4H44C 2E43A 3H1IJ 3L72G 2YO3A 2IBZE 2ITAA 1EZVI 1E5WA 2YKOA 2WT7A 2KNCB 2YNYA 1IC2A 5BU8B 4N3YB 2ZAEB 3GHGC 2E42A 1DX7A 1J1EB 3L74E 1RF0A 1RHZB 3E1IA 1KILC 1FDOA 1HGVA 2J0YA 1S5LE 3CCJP 1JY2O 3H6PA 1OVVA 2OYHB 2IX7C 5APVA 2JHKF 5CMZA 1WT6A 2FFDA 3L74J 1N7LA 2W83C 3L71G 2H43B 2FIBA 2JWAA 3CCSP 5AVXB 1KC8Q 1KB9D 1EZVG 1USDA 4N6JA 2WWWA 2I1JA 2ZT9C 3CWBD 3HD7C 1L0LG 4UB6H 4YXDC 1USEA 4WBAA 4Z1MH 1Q86Q 4RO0A 1BSNA 3GW6A 4PJ0H 2ZYAA 2J3OA 5B66E 1FDIA 4ZNCA 3D6YA 2E76D 3Q5SA 1L0NG 1AQ5A 2MJZA 1H0TA 1EDLA 3W68A 1PIXA 1VQ6P 1JMBA 1PGPA 3V2NA 3TYYA 1M1JA 3CX5D 3RBXA 5KKZC 3CI9A 5CCGC 1RY3A 2Y0CA 3M0AA 3TGUG 1Z3UA 1NTZK 4EPUA 1PPJG 3TSIA 2IZ0A 3CWBG 1KB9H 3G4SP 5EFWB 3AE5C 2K37A 2Y9ZA 2DW3A 4N78D 2KLVA 1J1DB 1M56D 2YKPA 1ZLLA 2QIWA 3RK2B 1P84H 1L0NK 3A2AA 1X22A 3CX5H 4BWNA 2V7QH 3LIDA 2J61A 4ZMDA 1QLED 2ZXXA 3MTUE 3NXSA 2Z4EA 5AVTB 2KOGA 2NRGA 2QM8A 2OYOA 2YIUB 1KV4A 1NU1E 3Q2YA 1A02F 5BU5A 1K73Q 2BCCE 3AE3C 2PAJA 5E79E 1GW3A 3W67A 1NAYA 3SFEC 1OXZA 2HFED 3CMEP 3B4SA 3MD0A 1S9KD 2K9JB 4PD4I 2HODA 3L74D 4C7NA 1SFCD 1NU1J 2BCCJ 2AEJA 3H1HE 1SQXE 2KLUA 1FOSF 4JZCA 2OYHC 3RGUA 1FICA 2QVAA 4JYBA 4PD4D 3ITKA 4RESB 3H1LE 1LGHB 1YJ9P 1VPCA 1YTZI 3KYQA 4Y99B 1N86B 1YTZT 1M1KQ 2J3UA 2V4HA 1SFCA 2J58A 5AVRB 2W27A 3H1HJ 1YQ3C 3A3YB 1SQXJ 3H32C 4B86A 1SQQK 3FWLA 1OW6A 3PHLA 3P8CD 3TK1A 3H1LJ 3R4YA 1AQTA 4JYOX 3BATA 1KFMA 2B87B 1S5LH 1SS1A 1FZBB 1NYHA 2UWJE 4WVZA 4EI2A 5AVZB 1DEBA 2N1TB 3L70E 2QE7H 2PRRA 1FZFC 3PRJA 2OTJP 4I1LA 2FXMA 3I5CA 1EC5A 1AVOA 2JKVA 3KZIE 3L75E 3C8VA 1HVVA 4M7HA 2WSFJ 3R2PA 2FYUE 3FX0A 4K35A 2QJKC 4HB1A 3RK2C 3L70J 1JY3P 5GTIH 3CC4P 1ZRTD 1K05A 1XTCC 3U1AA 3H1JG 1NTKE 3GLMA 1K04A 4O9BA 1GL2A 3L75J 3S4RA 1EQ7A 1LT9B 1NOHA 2FYUJ 2FXOA 1FAVA 5CHXA 1LNQA 1IFIA 2M5AB 4HH2A 2NPSB 1NTKJ 3CL3D 1CI6B 3P32A 1KYOD 3O6QB 2Q9IA 1BE3G 1T3UA 5APXA 1GW4A 3BVHA 1KQSO 4TT3H 1E79H 2YXQB 4DJGA 3HTKB 1VQLP 3BASA 2W6JH 1YBKA 4BRYA 1BGYD 3UIAA 1HF9A 2C9LY 1IFMA 2J1GA 3B5ND 4W7YA 1AV1A 3IR9A 1DH3A 3VMZA 1VQ8P 4R9TA 4ASWA 5AW8B 1X79B 5APUA 1RF1B 1U57A 2XV5A 4UB8H 4OVNF 2QRXA 1ZW0A 4GOFA 4OWFA 1VQ4P 1AA0A 2H8PD 4GKGA 1M57D 1KYOH 3GHGB 3GF7A 1GK4A 3Q1MA 1PFIA 3B5NA 3AEGC 1N73C 3CLQA 3AE9C 3EWKA 3SWKA 2WZ7A 4QMAA 2J2PA 1KILB 4KJMA 2K3RA 2IYPA 3OA7A 1SQBK 2HLOC 1OX3A 1FZCA 2N1TC 1PGQA 4AQRD 1YHQP 1LTBC 2D2CD 2KB7P 1DD4A 3E1IB 2KK7A 1LWUA 4JQ0D 4JYCA 5KTBA 3CCUP 1FZGC 1FZDA 4LLHA 1KMIZ 1KB9E 3HE4B 1L4AC 3CWBE 5AVSB 3VTPC 1VF5C 2LXBA 2ZT9B 1NTMG 3HD7B 1S4XA 1SQPG 1CW5A 2E75D 1TU3F 1G2CA 4I6MC 1K8AQ 2RKLA 4OGQD 3CX5E 3CWBJ 2LR2A 5AW3B 3RBZA 4KHXA 2MKVA 4JBZA 1D7MA 3ZDMA 3AEEC 4HKZH 3L73D 1S1CX 4H0LD 1H0TB 2NPSC 2OYIC 3L72D 1GD2E 3MUDA 3TNUA 4N78E 3Q5RA 2KZJA 2V7QJ 1QEXA 1OMIA 3MHVA 1NTMK 1FZEA 1N7SD 4WY4D 2Q6QA 1LTJC 1QX8A 1KZUB 1Y8AA 3HUSA 3M9BA 5KJ7C 3V4WA 5KLVK 2A06G 2K88A 3L36A 1RF1C 3OW2O 1N7SA 1OZHA 3RK3D 2OARA 4WY4A 3U1CA 2ZVNB 4IL6X 2QG4A 1NTZD 3L71D 2J61B 1KTMA 4YTPC 1S9KE 4LGDE 2HR3A 3VOPA 3F89A 1EZVD 3M0DA 4JF7A 3AE7C 1L0LD 1GU5A 3AEFC 2WPVB 2WVRA 1KD1Q 1GMJA 4GIFA 1L0ND 3T97A 4PV1D 1PZQA 4HYTB 4PD4E 1RF0C 4ZKUA 3SWYA 1BCCG 2HODB 3E1IC 3RL0D 4IFMA 1NTZG 2L91A 3P7KA 3N7NA 2FY8A 1MV8A 3SFDC 3TGUD 1SQVK 1IFNA 2YO2A 1PL5A 1PPJD 1HBWA 5CJ0A 1KQFB 3H32B 3P8CE 2FFDC 4A7PA 1HUCA 1URQD 4D6TD 2IPPA 3VP9A 2M0BA 5GTIE 2E74D 1P84I 1SFCB 1JY2N 3D70A 1EDIA 2J0HA 2GY7A 4H13D 2Q3EA 3NMDA 3HE5A 1JY3O 1URQA 2Y9YA 3CPWO 1FZFB 2Z5HA 1VQNP 1FS0E 5KAFH 2JWDA 1LP1A 1M1JC 2IFNA 1RE3A 1DIPA 1EDJA 4D6TG 1T6AA 1T2KD 4I2LC 1N8RQ 1BDCA 2JP3A 3G3ZA 2W6AA 2QEXP 1LTGC 1BE3E 2QJKB 2WTYA 3WUVA 1ZRTE 1EXJA 3AEBC 2E76C 3WUUA 1ZOYC 1FC2C 2XNXA 1FZAA 2C9NY 4MN4C 1JNMA 4Y28J 1BE3J 4JPZB 2IBZI 1FIDA 4UB8E 2J5ZA 2KNCA 4C7RA 1GL2B 1KYOE 2D39A 1SQQG 2Z4EC 3WMM0 2J64A 1HH0A 3SSUA 3IN6A 3VN0A 1BGYE 2AEMA 2HG5D 2R44A 3H1IG 2Q9IB 3AE4C 1HWTC 2OGUA 3M9HA 2HODC 2W90A 1DEEG 4U3FD 3E7KA 1BGYJ 1JOCA 1RQVA 1Z3SA 1N2DC 3CCEP 2H89C 2IBZG 2KYVA 2P2UA 3CCQP 1Q81Q 1NAFA 1PP9D 2YMKA 3H1KD 2QJYC 1N73B 1LTSC 1SFCC 4R9JA 1W2EA 4KT0J 1HGZA 2CPSA 2C0XA 4HJGH 2ZYDA 3B5NB 4U3FG 3IF4A 2HLOB 3CC7P 3H1JD 5AW7B 2BASA 4PD4H 2FYZA 3U59A 5CBOA 5C39A 3GG2A 1JO5A 2GM4A 4WB4A 4DCKA 3TF5A 1FZGB 1OFCX 5CCHD 3M06A 1LT1A 1PP9G 3H1KG 1L4AB 3CD6P 1M90Q 1VF5B 3BRTB 1JUNA 3CCLP 2N9YB 1YIJP 3VMXA 1S2EA 1BE3D 1HJBA 3A0BH 2KP8A 3BCCD 1Z56A 3ABVC 1QL1A 5CCHA 3CMAP 1IO4A 1JCCA 3SWFA 5TISE 1SQBD 2D2CB 3V2PA 3L73E 1ZR2A 2XKMA 4GDOA 3TDKA 3II6A 3L72E 2WPQA 3C1LA 4L76A 1R5SA 5AW5B 1GL2C 2M8RA 4DOJA 2OYIB 1GZLA 3PLNA 3KHUA 3CCVP 3M91A 5TJHA 5BVZA 4DZOA 3E1RA 3C9IA 2K9JA 1R8EA 3BCCG 4I7ZC 1CSBA 2HPCA 3L73J 1LTJB 1Y9BA 2JHHC 3WU2E 3L72J 3TNUB 1A02J 4L73A 2IYOA 5B5EE 2Q9IC 1FOSE 1FDMA 2H88C 1SQBG 2WSEH 3BVHC 5H2FH 3O8ZA 5AVVB 3RK3E 1H89A 3I56P 2XZRA 4LC1A 1L2PA 1N86A 2XDJA 3HUSB 2ZXEB 1NTZE 3L71E 4IOIH 2OTLP 3G9RA 1H88A 1MFTA 1HJ0A 1EZVE 1QGKB 3P8MC 1OVRA 2ZJSE 1T8ZA 1L0LE 4WY4B 1PGJA 1Q7YQ 2FYNB 2WT7B 1NTMD 2JDIH 2KXPB 2B9BA 2FBWC 1VQ5P 1PV3A 1NTZJ 3L71J 2B87A 2VRSA 3B5NC 1L0NE 1SQPD 1FZBA 4W7ZA 2O01N 1VQ9P 2PP6A 1RF0B 3H1HG 5CJ4A 1L0LJ 1NH4A 1SQXG 1VQ7P 5KLVD 5KAFE 3VMAA 1FJKA 3TGUE 3V6IA 3MZWB 2Q1KA 1FZCC 2Z5IA 1PPJE 4YPCA 1L0NJ 3H1LG 3NFQA 4D6TE 1NU1K 2A45I 1X8YA 2FFDB 1LWUC 3A5TA 1WRGA 3OJAB 1JC9A 2YMYA 2R5BA 1JTHA 1X9VA 3JC22 1FJPA 1T3JA 3TGUJ 1RE4A 2QA4P 2BEZF 2J60A 4OH8B 4ZFGA 3CXHI 3HRNA 5KLVG 2AXTE 1LT9A 4RKUJ 4D6TJ 4R4MA 3PJSK 1LJ2A 2D2CC 1G1IA 1S3JA 2R3CA 1SQXK 1XTGB 4WWIA 2A06D 1AJYA 2OQQA 1M1JB 4K3AA 1NWQA 1RQUA 3CXHD 3O6QA 4H44D 2O3JA 3LW5H 4AUWA 2ZFCA 1OIPA 1U7JA 1SQQE 1SQVD 2SPZA 3D71A 1NGMB 2KS1A 2E75C 3MUDC 3S9OA 2JHMF 2E76B 1NHLA 3KXDA 1LP1B 2Y0EA
chains in the Genus database with same CATH topology
2Z5HA 3P8CD 2A45G 2N1TD 1YYCA 3TK1A 2R32A 2WPRA 1FBMA 1KFNA 1M1JC 2IFNA 1RE3A 1FZEC 4Y99C 1MZ9A 4JYOX 1N86C 1N7SB 1T2KD 3BATA 1KFMA 4I2LC 1IK9A 1N73A 2P67A 3KQGA 3G3ZA 2W6AA 1FZBB 5AVZB 1CZQA 1DEBA 1LTGC 2JEEA 1L4AD 2N1TB 3HUSC 1KILD 1MUUA 2WTYA 2XNXB 5APTA 3B8EB 5APSA 1FZFC 2HLOA 5APWA 2N1TA 4I1LA 1FZAB 3GHGA 2XNXA 2FXMA 3I5CA 3VMYA 3LIEA 1NKNA 5AW4B 2Z4EB 1NKZB 1N7SC 4WY4C 1FZAA 3RK3B 1G1JA 2C9NY 3M9QA 1HVVA 1FZGA 1FZBC 2P7JA 4M7HA 5AW1B 1JNMA 3R2PA 1FIBA 1FIDA 1L4AA 3V4QA 3RK2C 1KILA 2FYUK 2J5ZA 1JY3P 3KDPB 3KPEA 3HD7D 4C7RA 1GL2B 1XTCC 3U1AA 3M0DC 4O9BA 1GU4A 2D39A 4EOTA 2Z4EC 1NTKK 2NPSD 3EQ2A 3V5BA 3WMM0 2J64A 1LTTC 4C7NB 1GL2A 1HH0A 3L37A 2GUSA 4XE5B 3RK3C 1EQ7A 3VN0A 1LT9B 2W6BA 1NOHA 3L4FA 3HE4A 1FAVA 2WPSA 5CHXA 1GTWA 1JCDA 2HG5D 1IFIA 2O1KA 1ZN5A 4HH2A 2Q9IB 3HD7A 2NPSB 5CCGD 3EFGA 3CL3D 1H8AA 3RL0B 1HWTC 5AVUB 5AW9B 1CI6B 1RE4C 3P32A 2Q5UA 3M9HA 2Q9IA 2HODC 2NPSA 2OYIA 2H7HA 1T3UA 5KJ7D 3V2RA 1CI6A 5APXA 2WNPF 2JJLA 1LT9C 1GW4A 2WSFH 3BVHA 2J3GA 1OWAA 3HE5B 3FIBA 1JOCA 2YKQA 1Z3SA 3HTKB 4ZKPA 1URQB 3VP8A 1N2DC 3BASA 1IJDB 2KYVA 3UIAA 2C9LY 1LTJA 1IFMA 3HTKA 2J1GA 3B5ND 5CCGA 3RL0C 4M7FA 2P2UA 4W7YA 5AVQB 2Q7CA 3IR9A 1IFDA 1DH3A 3IFMA 1NAFA 1RE3B 3VMZA 3N4XA 4NYTA 4R9TA 1N73B 5AW8B 1LTSC 2L5GB 1X79B 1SFCC 4R9JA 5APUA 5KJ7A 1W2EA 2A45H 1HGZA 2CPSA 1RF1B 2XV5A 2C0XA 1SP4A 4C46A 2WITA 1LTIC 1SQPK 1URQC 2KSJA 4IFFA 3B5NB 2Q3IA 1RF1A 2H8PD 4GKGA 2HLOB 5AW7B 2BASA 3GHGB 1GK4A 1M7LA 2FYZA 3U59A 1MFZA 1GDTA 1PFIA 3B5NA 2WSCH 5AW0B 1RE3C 2QM7A 1JO5A 3NTNA 2GM4A 2IFMA 1N73C 3CLQA 4WB4A 2E43A 1FZGB 1L0LK 5CCHD 2YO3A 2WZ7A 3M06A 1JY3N 1E5WA 1L4AB 2J2PA 1HTLC 1KILB 2YKOA 1SVFA 2WT7A 3OA7A 1QL2A 1SQBK 2YNYA 1SLQA 1IC2A 3A7OA 3BRTB 5BU8B 2HLOC 4N3YB 2N1TC 1FZCA 1JUNA 3GHGC 2E42A 2XNXC 2POHA 3VMXA 4AQRD 1LTBC 1DX7A 1HJBA 1FZAC 1J1EB 2KB7P 3E1IB 1T2KC 4IFDK 1LWUA 4JYCA 5KTBA 2KP8A 1FZGC 1FZDA 1RF0A 1Z56A 1QL1A 4LLHA 5CCHA 3HE4B 1L4AC 2GUVA 3E1IA 1IO4A 1KILC 1HGVA 5AVSB 1JCCA 3BRVB 5APQA 3VTPC 3SWFA 2J0YA 4AYCA 1ZV8A 3HD7B 3V2PA 1ZR2A 1JY2O 3H6PA 2XKMA 4W80A 2O1JA 3II6A 2OYHB 2FKWB 2WPQA 1KQLA 2IX7C 5AW5B 5APVA 1CW5A 1GL2C 2M8RA 5CMZA 1J1EC 4DOJA 2OYIB 2JHKF 1WT6A 2FFDA 1N7LA 1GZLA 1G2CA 2H43B 2FIBA 1ZR4A 2OYHA 3BVHB 4I6MC 3M91A 2HPCB 5AVXB 1FU1A 5AW3B 5BVZA 4DZOA 4KHXA 3C9IA 2H43A 4N6JA 1CSBA 2WWWA 2HPCA 2I1JA 3HD7C 1LTJB 2J3FD 2JHHC 1NO4A 3TNUB 1A02J 4WBAA 5APYA 2J3OA 2Q9IC 3H32A 2NPSC 2OYIC 1FOSE 1FDMA 1GD2E 3MUDA 3TNUA 3V2QA 4M3LA 4N78E 2H43C 2WSEH 1LTAC 3BVHC 1AQ5A 2MJZA 1VDFA 3O8ZA 2LKMA 5AVVB 2C0WA 1H89A 1NTMK 2XZRA 3V2NA 4LC1A 3TYYA 1M1JA 1FZEA 1N7SD 2J0GA 4WY4D 1N86A 1LTJC 2XDJA 3CI9A 3HUSB 3OAKA 5CCGC 1JY2P 2ZXEB 2J3FA 1RY3A 4EIJA 2JHIF 1KZUB 3M0AA 1Z3UA 1NTZK 4EPUA 3TSIA 3HUSA 3RK2D 1H88A 3M9BA 5AW6B 5KJ7C 3L35A 3V4WA 1FZFA 3P8MC 1T8ZA 5KLVK 4WY4B 4N78D 2KLVA 2O01H 3L36A 2N9BA 1J1DB 2WT7B 2YKPA 1RF1C 1ZLLA 1FZCB 1IFJA 1N7SA 3RK3D 2OARA 4WY4A 3U1CA 3RK2B 2VRSA 3B5NC 1FZBA 4W7ZA 1L0NK 2J61B 1LWUB 3A2AA 2PP6A 1RF0B 3VYIA 2XU6A 1S9KE 4LGDE 1GL2D 1J2JB 5CJ4A 3LIDA 1NH4A 2J61A 3VOPA 4GT1A 3M0DA 1J1DC 4JF7A 3MTUE 1FJKA 3NXSA 1GU5A 2Z4EA 3MIWA 1FZCC 1AFOA 2Z5IA 5AVTB 2KOGA 2QM8A 2HYNA 3MGNA 1A02F 5BU5A 3NFQA 5AVYB 5AW2B 4GIFA 2PAJA 1JTHB 1NU1K 1GW3A 2A45I 1X8YA 2FFDB 1LWUC 3A5TA 3T97A 2J59M 1WRGA 3OJAB 4HYTB 1JC9A 1G2CB 2YMYA 1RF0C 4ZKUA 5CCHC 1RE4B 1OXZA 1JTHA 1X9VA 2R5BA 2HFED 3SWYA 2HODB 3E1IC 3RL0D 1FJPA 4IFMA 3P7KA 3N7NA 1T3JA 2M3BA 3MD0A 1S9KD 1RE4A 2HODA 1MV8A 4C7NA 1SFCD 2J60A 4ZFGA 4OH8B 1JMMA 3HRNA 1SQVK 1IFNA 2YO2A 1LT9A 2I1KA 1HBWA 4XA4A 5CJ0A 3H32B 2CPBA 3P8CE 1G1IA 2FFDC 1FOSF 1HUCA 1URQD 2R3CA 4JZCA 5AVWB 1SQXK 2OYHC 1XTGB 1FICA 2JHLF 2IPPA 4JYBA 3VP9A 2P1JA 3PP5A 2R5DA 4RESB 1SFCB 1LGHB 1GK6A 1VPCA 1JY2N 1M1JB 1YTZI 3KYQA 1FZEB 1NWQA 2J0HA 4Y99B 2HPCC 1N86B 1YTZT 4AUWA 3LW5H 2J3UA 2ZFCA 2GY7A 1SFCA 2J58A 5AVRB 2W27A 3NMDA 3A3YB 3HE5A 3H32C 4B86A 1SQQK 2JHMF 1JY3O 1URQA 1NHLA 1FZFB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q9I A;  2HOD C;  1FZB A;  2A45 G;  2OYI A;  1T3U A;  2J0Y A;  2WNP F;  1LT9 C;  2J61 B;  1LWU B;  3BVH A;  2J3G A;  1M1J C;  1JY2 O;  1RE3 A;  3FIB A;  1FZE C;  1RF0 B;  4JYO X;  1N86 C;  1Z3S A;  2OYH B;  1N73 A;  2J61 A;  2JHK F;  1FZB B;  2OYI B;  2FFD A;  1LTJ A;  2J1G A;  3HUS C;  2FIB A;  2Z4E A;  2OYH A;  1FZC C;  4M7F A;  2H43 B;  3BVH B;  2XNX B;  2HPC B;  1RE3 B;  1FZF C;  4NYT A;  4R9T A;  2HLO A;  1N73 B;  2H43 A;  1FZA B;  3GHG A;  4R9J A;  1W2E A;  2A45 H;  2XNX A;  2A45 I;  2HPC A;  1LWU C;  2FFD B;  1RF1 B;  1LTJ B;  1JC9 A;  2J3F D;  2JHH C;  1RF0 C;  2Z4E B;  1RE4 B;  1FZA A;  2HOD B;  3E1I C;  2J3O A;  2Q9I C;  1RF1 A;  1FZG A;  3H32 A;  2OYI C;  1FZB C;  4M7H A;  2HLO B;  3GHG B;  1RE4 A;  2H43 C;  1FIB A;  1FID A;  3BVH C;  2HOD A;  1RE3 C;  2J5Z A;  1JY3 P;  2J60 A;  4ZFG A;  1N73 C;  1LT9 A;  1M1J A;  1FZG B;  3H32 B;  1FZE A;  2J0G A;  2FFD C;  1N86 A;  1LTJ C;  4JZC A;  3HUS B;  1JY3 N;  2D39 A;  1JY2 P;  2OYH C;  2J3F A;  2Z4E C;  2J2P A;  2J64 A;  1FIC A;  2JHL F;  2JHI F;  1Z3U A;  4EPU A;  3HUS A;  2HLO C;  1LT9 B;  1FZC A;  3GHG C;  1JY2 N;  1M1J B;  2XNX C;  1FZE B;  2J0H A;  2HPC C;  1FZF A;  1N86 B;  2J3U A;  2GY7 A;  1FZA C;  3E1I B;  1LWU A;  2Q9I B;  1RF1 C;  1FZG C;  3H32 C;  1FZD A;  1RF0 A;  1FZC B;  2JHM F;  1JY3 O;  1RE4 C;  3E1I A;  1FZF B; 
#chains in the Genus database with same CATH topology
 4EDF A;  2A45 G;  4CPG A;  1YYC A;  4OGQ C;  3S1K A;  2R32 A;  2WPR A;  3CCR P;  1FBM A;  1KN7 A;  1KFN A;  3PH0 A;  1JEK A;  1FZE C;  1MZ9 A;  1IK9 A;  1NTK G;  4GOD A;  5TIS H;  1UIX A;  1SQQ J;  3FWN A;  4XFJ A;  3HUS C;  1KIL D;  1MUU A;  4H0L C;  4NPD A;  2FXP A;  2XNX B;  1BCC D;  2GA1 A;  5APW A;  1SQV G;  1FZA B;  3GHG A;  3VMY A;  1NKN A;  5AW4 B;  2Z4E B;  1N7S C;  4WY4 C;  1S5L X;  2FYN C;  2P7J A;  2QJP C;  3WU2 H;  1FIB A;  3V4Q A;  1KIL A;  2I8D A;  2FYU K;  5B5E H;  3KDP B;  2ZT9 D;  3HD7 D;  4IL6 E;  4YXW H;  2XND H;  3M0D C;  3WUT A;  4U3F E;  4EOT A;  1NTK K;  3V5B A;  4C7N B;  2GUS A;  4XE5 B;  3RK3 C;  3HE4 A;  1KB9 I;  2WPS A;  2CK3 H;  2O1K A;  1ZN5 A;  1PP9 E;  3HD7 A;  3QH9 A;  3H1K E;  5CCG D;  5GTH E;  3EFG A;  5KLI C;  5AVU B;  4U3F J;  2ZYG A;  2QJY B;  2H7H A;  3A0B E;  3V2R A;  2WNP F;  2W8Z A;  2JJL A;  2O01 J;  1OWA A;  3FIB A;  2YKQ A;  3H1J E;  3CX5 I;  4PV1 C;  5KAI E;  1IJD B;  1PP9 J;  3H1K J;  1PGO A;  5CCG A;  3RL0 C;  4M7F A;  5AVQ B;  1IFD A;  3IFM A;  1P84 D;  3JCU E;  5CBN A;  4NYT A;  3B71 A;  5DJU B;  2L5G B;  1IZN B;  3A0H H;  2KIK A;  3Q5P A;  1SP4 A;  4C46 A;  2WIT A;  4NPE A;  3H1J J;  1URQ C;  1MKM A;  2Q3I A;  1VL2 A;  1YQ4 C;  2K9Y A;  2E74 C;  1SQQ D;  1GDT A;  2WSC H;  5AW0 B;  1RE3 C;  3BCC E;  3H25 A;  2IFM A;  1IFP A;  1L0L K;  4H13 C;  1EDK A;  2M3E A;  1JY3 N;  1BSH A;  5H2F E;  1SQB E;  2AXT H;  1HTL C;  3H1I D;  1SVF A;  1QL2 A;  3A7O A;  1SLQ A;  2KSE A;  2XNX C;  2KUB A;  2POH A;  3USS A;  2JR8 A;  3BCC J;  1FZA C;  1T2K C;  4IFD K;  4GOE A;  1FE6 A;  3AE2 C;  2WSE J;  2GUV A;  1SQB J;  3JSV C;  2LXC B;  2IBZ D;  4R4L A;  3BRV B;  5APQ A;  1EXI A;  4AYC A;  2WMM A;  4I7Z B;  1ZV8 A;  1VQP P;  4W80 A;  2O1J A;  2FKW B;  3PTZ A;  1KQL A;  2K1A A;  1J1E C;  1ZR4 A;  2OYH A;  3BVH B;  1Q82 Q;  2HPC B;  1M8O B;  1FU1 A;  2H43 A;  3AEC C;  4BRY B;  2AEF A;  2J3F D;  1NO4 A;  5APY A;  1R5L A;  1RH5 B;  3H32 A;  2RMZ A;  1NJI Q;  1W2B O;  3V2Q A;  4EYY Q;  4M3L A;  1VQK P;  2H43 C;  3RL0 g;  1LTA C;  5DJT B;  1VDF A;  1NTM E;  2LKM A;  1JB0 J;  2C0W A;  1YIT P;  1SQP E;  2J5U A;  2J0G A;  1WMK A;  3OAK A;  1JY2 P;  3L74 G;  2J3F A;  2P58 A;  4EIJ A;  1X0T A;  2JHI F;  4IL6 H;  4BXL A;  2BEQ D;  3RK2 D;  5AW6 B;  5KLV E;  3L35 A;  1FZF A;  1NTM J;  3AED C;  2O01 H;  2N9B A;  5K5G B;  3Q3D A;  1IK7 A;  1SQP J;  2R3S A;  1UII A;  3CC2 P;  1FZC B;  1IFJ A;  1BDD A;  5GTH H;  3IAO A;  1LWU B;  2KZI A;  5KLV J;  3VYI A;  1VQM P;  2XU6 A;  1GL2 D;  1J2J B;  2Y0D A;  3FXD A;  4GT1 A;  1J1D C;  3MIW A;  1AFO A;  2PFX A;  3G6E P;  5KAI H;  2HYN A;  3LW5 J;  1VQO P;  3MGN A;  1YI2 P;  5AVY B;  5AW2 B;  5B66 H;  1JTH B;  2A06 E;  2J59 M;  1G2C B;  3JCU H;  3AE6 C;  1ZME C;  5CCH C;  1Q2N A;  1RE4 B;  1Q90 D;  4TLF A;  3CXH E;  1OW7 A;  5L8R J;  1KYO I;  2M3B A;  1AVY A;  1SQV E;  4NPF X;  2YIU C;  1JMM A;  2I1K A;  3D6Z A;  4XA4 A;  3GF3 A;  1U7M A;  2CPB A;  2E5Y A;  1S72 P;  1NU1 D;  2E75 B;  2BCC D;  5AVW B;  2WSS H;  2JHL F;  3MP7 B;  1KOR A;  2P1J A;  3PP5 A;  2R5D A;  4OGQ B;  1ZXG A;  1GK6 A;  1FZE B;  1W5C E;  2HPC C;  1SQV J;  2KS1 B;  1KIL E;  1QVF O;  1BCC E;  4H0L B;  3H1H D;  3QWO C;  3F5H A;  1SQX D;  2N1T D;  3EFF K;  4H44 B;  2B88 A;  1NU1 G;  3FGA D;  2BCC G;  5M1B A;  4Y99 C;  1N86 C;  1N7S B;  1N73 A;  3H1L D;  2P67 A;  3KQG A;  5E79 H;  1CZQ A;  1BCC J;  2JEE A;  1L4A D;  2IDB A;  2QJP B;  1YJW P;  4UB6 E;  1VF5 D;  5APT A;  3B8E B;  3AEA C;  5APS A;  2E5T A;  2HLO A;  2N1T A;  3AE1 C;  4PJ0 E;  1BGY G;  2P10 A;  3LIE A;  1NKZ B;  1OVU A;  3RK3 B;  1G1J A;  3M9Q A;  1FZG A;  1FZB C;  5AW1 B;  1ZP0 C;  3A0H E;  1NVO A;  2OTK E;  4DT0 A;  1L4A A;  2JO1 A;  3T97 B;  3GMA A;  4U7J A;  1KQG B;  3KPE A;  3L70 D;  5KLI B;  3I55 P;  1GU4 A;  1K9M Q;  2G8Y A;  1OW8 A;  4RJT A;  2NPS D;  3EQ2 A;  1LTT C;  3L37 A;  1QVG O;  4L74 A;  2W6B A;  2NZ2 A;  1DD3 A;  2RH0 A;  3L4F A;  3L75 D;  4PV1 B;  1GTW A;  3CCM P;  1JCD A;  2FYU D;  1P84 E;  2RN0 A;  1H8A A;  3RL0 B;  5AW9 B;  2B89 A;  2M5A A;  1RE4 C;  2WSC J;  2Q5U A;  1NTK D;  2NPS A;  3AE8 C;  2OYI A;  2KI7 B;  5KJ7 D;  3L70 G;  1CI6 A;  3FXE A;  1LT9 C;  2WSF H;  4L75 A;  2IZ1 A;  1YJN P;  2J3G A;  3HE5 B;  5KKZ B;  4ZKP A;  1URQ B;  3VP8 A;  1LTJ A;  3L75 G;  3HTK A;  2E74 B;  2Q7C A;  2AXC A;  2YXR B;  4ASV A;  1RE3 B;  3N4X A;  2QSI A;  3KZI H;  2FYU G;  2ZVO B;  5KJ7 A;  2A45 H;  3H1I E;  4H13 B;  1Y47 A;  2WQY C;  1LTI C;  1SQP K;  3K5B A;  2KSJ A;  4IFF A;  1JM0 A;  2PGD A;  1RF1 A;  1M7L A;  1MFZ A;  2G3A A;  3G71 P;  2QM7 A;  3CXH H;  3NTN A;  3L73 G;  4H44 C;  2E43 A;  3H1I J;  3L72 G;  2YO3 A;  2IBZ E;  2ITA A;  1EZV I;  1E5W A;  2YKO A;  2WT7 A;  2KNC B;  2YNY A;  1IC2 A;  5BU8 B;  4N3Y B;  2ZAE B;  3GHG C;  2E42 A;  1DX7 A;  1J1E B;  3L74 E;  1RF0 A;  1RHZ B;  3E1I A;  1KIL C;  1FDO A;  1HGV A;  2J0Y A;  1S5L E;  3CCJ P;  1JY2 O;  3H6P A;  1OVV A;  2OYH B;  2IX7 C;  5APV A;  2JHK F;  5CMZ A;  1WT6 A;  2FFD A;  3L74 J;  1N7L A;  2W83 C;  3L71 G;  2H43 B;  2FIB A;  2JWA A;  3CCS P;  5AVX B;  1KC8 Q;  1KB9 D;  1EZV G;  1USD A;  4N6J A;  2WWW A;  2I1J A;  2ZT9 C;  3CWB D;  3HD7 C;  1L0L G;  4UB6 H;  4YXD C;  1USE A;  4WBA A;  4Z1M H;  1Q86 Q;  4RO0 A;  1BSN A;  3GW6 A;  4PJ0 H;  2ZYA A;  2J3O A;  5B66 E;  1FDI A;  4ZNC A;  3D6Y A;  2E76 D;  3Q5S A;  1L0N G;  1AQ5 A;  2MJZ A;  1H0T A;  1EDL A;  3W68 A;  1PIX A;  1VQ6 P;  1JMB A;  1PGP A;  3V2N A;  3TYY A;  1M1J A;  3CX5 D;  3RBX A;  5KKZ C;  3CI9 A;  5CCG C;  1RY3 A;  2Y0C A;  3M0A A;  3TGU G;  1Z3U A;  1NTZ K;  4EPU A;  1PPJ G;  3TSI A;  2IZ0 A;  3CWB G;  1KB9 H;  3G4S P;  5EFW B;  3AE5 C;  2K37 A;  2Y9Z A;  2DW3 A;  4N78 D;  2KLV A;  1J1D B;  1M56 D;  2YKP A;  1ZLL A;  2QIW A;  3RK2 B;  1P84 H;  1L0N K;  3A2A A;  1X22 A;  3CX5 H;  4BWN A;  2V7Q H;  3LID A;  2J61 A;  4ZMD A;  1QLE D;  2ZXX A;  3MTU E;  3NXS A;  2Z4E A;  5AVT B;  2KOG A;  2NRG A;  2QM8 A;  2OYO A;  2YIU B;  1KV4 A;  1NU1 E;  3Q2Y A;  1A02 F;  5BU5 A;  1K73 Q;  2BCC E;  3AE3 C;  2PAJ A;  5E79 E;  1GW3 A;  3W67 A;  1NAY A;  3SFE C;  1OXZ A;  2HFE D;  3CME P;  3B4S A;  3MD0 A;  1S9K D;  2K9J B;  4PD4 I;  2HOD A;  3L74 D;  4C7N A;  1SFC D;  1NU1 J;  2BCC J;  2AEJ A;  3H1H E;  1SQX E;  2KLU A;  1FOS F;  4JZC A;  2OYH C;  3RGU A;  1FIC A;  2QVA A;  4JYB A;  4PD4 D;  3ITK A;  4RES B;  3H1L E;  1LGH B;  1YJ9 P;  1VPC A;  1YTZ I;  3KYQ A;  4Y99 B;  1N86 B;  1YTZ T;  1M1K Q;  2J3U A;  2V4H A;  1SFC A;  2J58 A;  5AVR B;  2W27 A;  3H1H J;  1YQ3 C;  3A3Y B;  1SQX J;  3H32 C;  4B86 A;  1SQQ K;  3FWL A;  1OW6 A;  3PHL A;  3P8C D;  3TK1 A;  3H1L J;  3R4Y A;  1AQT A;  4JYO X;  3BAT A;  1KFM A;  2B87 B;  1S5L H;  1SS1 A;  1FZB B;  1NYH A;  2UWJ E;  4WVZ A;  4EI2 A;  5AVZ B;  1DEB A;  2N1T B;  3L70 E;  2QE7 H;  2PRR A;  1FZF C;  3PRJ A;  2OTJ P;  4I1L A;  2FXM A;  3I5C A;  1EC5 A;  1AVO A;  2JKV A;  3KZI E;  3L75 E;  3C8V A;  1HVV A;  4M7H A;  2WSF J;  3R2P A;  2FYU E;  3FX0 A;  4K35 A;  2QJK C;  4HB1 A;  3RK2 C;  3L70 J;  1JY3 P;  5GTI H;  3CC4 P;  1ZRT D;  1K05 A;  1XTC C;  3U1A A;  3H1J G;  1NTK E;  3GLM A;  1K04 A;  4O9B A;  1GL2 A;  3L75 J;  3S4R A;  1EQ7 A;  1LT9 B;  1NOH A;  2FYU J;  2FXO A;  1FAV A;  5CHX A;  1LNQ A;  1IFI A;  2M5A B;  4HH2 A;  2NPS B;  1NTK J;  3CL3 D;  1CI6 B;  3P32 A;  1KYO D;  3O6Q B;  2Q9I A;  1BE3 G;  1T3U A;  5APX A;  1GW4 A;  3BVH A;  1KQS O;  4TT3 H;  1E79 H;  2YXQ B;  4DJG A;  3HTK B;  1VQL P;  3BAS A;  2W6J H;  1YBK A;  4BRY A;  1BGY D;  3UIA A;  1HF9 A;  2C9L Y;  1IFM A;  2J1G A;  3B5N D;  4W7Y A;  1AV1 A;  3IR9 A;  1DH3 A;  3VMZ A;  1VQ8 P;  4R9T A;  4ASW A;  5AW8 B;  1X79 B;  5APU A;  1RF1 B;  1U57 A;  2XV5 A;  4UB8 H;  4OVN F;  2QRX A;  1ZW0 A;  4GOF A;  4OWF A;  1VQ4 P;  1AA0 A;  2H8P D;  4GKG A;  1M57 D;  1KYO H;  3GHG B;  3GF7 A;  1GK4 A;  3Q1M A;  1PFI A;  3B5N A;  3AEG C;  1N73 C;  3CLQ A;  3AE9 C;  3EWK A;  3SWK A;  2WZ7 A;  4QMA A;  2J2P A;  1KIL B;  4KJM A;  2K3R A;  2IYP A;  3OA7 A;  1SQB K;  2HLO C;  1OX3 A;  1FZC A;  2N1T C;  1PGQ A;  4AQR D;  1YHQ P;  1LTB C;  2D2C D;  2KB7 P;  1DD4 A;  3E1I B;  2KK7 A;  1LWU A;  4JQ0 D;  4JYC A;  5KTB A;  3CCU P;  1FZG C;  1FZD A;  4LLH A;  1KMI Z;  1KB9 E;  3HE4 B;  1L4A C;  3CWB E;  5AVS B;  3VTP C;  1VF5 C;  2LXB A;  2ZT9 B;  1NTM G;  3HD7 B;  1S4X A;  1SQP G;  1CW5 A;  2E75 D;  1TU3 F;  1G2C A;  4I6M C;  1K8A Q;  2RKL A;  4OGQ D;  3CX5 E;  3CWB J;  2LR2 A;  5AW3 B;  3RBZ A;  4KHX A;  2MKV A;  4JBZ A;  1D7M A;  3ZDM A;  3AEE C;  4HKZ H;  3L73 D;  1S1C X;  4H0L D;  1H0T B;  2NPS C;  2OYI C;  3L72 D;  1GD2 E;  3MUD A;  3TNU A;  4N78 E;  3Q5R A;  2KZJ A;  2V7Q J;  1QEX A;  1OMI A;  3MHV A;  1NTM K;  1FZE A;  1N7S D;  4WY4 D;  2Q6Q A;  1LTJ C;  1QX8 A;  1KZU B;  1Y8A A;  3HUS A;  3M9B A;  5KJ7 C;  3V4W A;  5KLV K;  2A06 G;  2K88 A;  3L36 A;  1RF1 C;  3OW2 O;  1N7S A;  1OZH A;  3RK3 D;  2OAR A;  4WY4 A;  3U1C A;  2ZVN B;  4IL6 X;  2QG4 A;  1NTZ D;  3L71 D;  2J61 B;  1KTM A;  4YTP C;  1S9K E;  4LGD E;  2HR3 A;  3VOP A;  3F89 A;  1EZV D;  3M0D A;  4JF7 A;  3AE7 C;  1L0L D;  1GU5 A;  3AEF C;  2WPV B;  2WVR A;  1KD1 Q;  1GMJ A;  4GIF A;  1L0N D;  3T97 A;  4PV1 D;  1PZQ A;  4HYT B;  4PD4 E;  1RF0 C;  4ZKU A;  3SWY A;  1BCC G;  2HOD B;  3E1I C;  3RL0 D;  4IFM A;  1NTZ G;  2L91 A;  3P7K A;  3N7N A;  2FY8 A;  1MV8 A;  3SFD C;  3TGU D;  1SQV K;  1IFN A;  2YO2 A;  1PL5 A;  1PPJ D;  1HBW A;  5CJ0 A;  1KQF B;  3H32 B;  3P8C E;  2FFD C;  4A7P A;  1HUC A;  1URQ D;  4D6T D;  2IPP A;  3VP9 A;  2M0B A;  5GTI E;  2E74 D;  1P84 I;  1SFC B;  1JY2 N;  3D70 A;  1EDI A;  2J0H A;  2GY7 A;  4H13 D;  2Q3E A;  3NMD A;  3HE5 A;  1JY3 O;  1URQ A;  2Y9Y A;  3CPW O;  1FZF B;  2Z5H A;  1VQN P;  1FS0 E;  5KAF H;  2JWD A;  1LP1 A;  1M1J C;  2IFN A;  1RE3 A;  1DIP A;  1EDJ A;  4D6T G;  1T6A A;  1T2K D;  4I2L C;  1N8R Q;  1BDC A;  2JP3 A;  3G3Z A;  2W6A A;  2QEX P;  1LTG C;  1BE3 E;  2QJK B;  2WTY A;  3WUV A;  1ZRT E;  1EXJ A;  3AEB C;  2E76 C;  3WUU A;  1ZOY C;  1FC2 C;  2XNX A;  1FZA A;  2C9N Y;  4MN4 C;  1JNM A;  4Y28 J;  1BE3 J;  4JPZ B;  2IBZ I;  1FID A;  4UB8 E;  2J5Z A;  2KNC A;  4C7R A;  1GL2 B;  1KYO E;  2D39 A;  1SQQ G;  2Z4E C;  3WMM 0;  2J64 A;  1HH0 A;  3SSU A;  3IN6 A;  3VN0 A;  1BGY E;  2AEM A;  2HG5 D;  2R44 A;  3H1I G;  2Q9I B;  3AE4 C;  1HWT C;  2OGU A;  3M9H A;  2HOD C;  2W90 A;  1DEE G;  4U3F D;  3E7K A;  1BGY J;  1JOC A;  1RQV A;  1Z3S A;  1N2D C;  3CCE P;  2H89 C;  2IBZ G;  2KYV A;  2P2U A;  3CCQ P;  1Q81 Q;  1NAF A;  1PP9 D;  2YMK A;  3H1K D;  2QJY C;  1N73 B;  1LTS C;  1SFC C;  4R9J A;  1W2E A;  4KT0 J;  1HGZ A;  2CPS A;  2C0X A;  4HJG H;  2ZYD A;  3B5N B;  4U3F G;  3IF4 A;  2HLO B;  3CC7 P;  3H1J D;  5AW7 B;  2BAS A;  4PD4 H;  2FYZ A;  3U59 A;  5CBO A;  5C39 A;  3GG2 A;  1JO5 A;  2GM4 A;  4WB4 A;  4DCK A;  3TF5 A;  1FZG B;  1OFC X;  5CCH D;  3M06 A;  1LT1 A;  1PP9 G;  3H1K G;  1L4A B;  3CD6 P;  1M90 Q;  1VF5 B;  3BRT B;  1JUN A;  3CCL P;  2N9Y B;  1YIJ P;  3VMX A;  1S2E A;  1BE3 D;  1HJB A;  3A0B H;  2KP8 A;  3BCC D;  1Z56 A;  3ABV C;  1QL1 A;  5CCH A;  3CMA P;  1IO4 A;  1JCC A;  3SWF A;  5TIS E;  1SQB D;  2D2C B;  3V2P A;  3L73 E;  1ZR2 A;  2XKM A;  4GDO A;  3TDK A;  3II6 A;  3L72 E;  2WPQ A;  3C1L A;  4L76 A;  1R5S A;  5AW5 B;  1GL2 C;  2M8R A;  4DOJ A;  2OYI B;  1GZL A;  3PLN A;  3KHU A;  3CCV P;  3M91 A;  5TJH A;  5BVZ A;  4DZO A;  3E1R A;  3C9I A;  2K9J A;  1R8E A;  3BCC G;  4I7Z C;  1CSB A;  2HPC A;  3L73 J;  1LTJ B;  1Y9B A;  2JHH C;  3WU2 E;  3L72 J;  3TNU B;  1A02 J;  4L73 A;  2IYO A;  5B5E E;  2Q9I C;  1FOS E;  1FDM A;  2H88 C;  1SQB G;  2WSE H;  3BVH C;  5H2F H;  3O8Z A;  5AVV B;  3RK3 E;  1H89 A;  3I56 P;  2XZR A;  4LC1 A;  1L2P A;  1N86 A;  2XDJ A;  3HUS B;  2ZXE B;  1NTZ E;  3L71 E;  4IOI H;  2OTL P;  3G9R A;  1H88 A;  1MFT A;  1HJ0 A;  1EZV E;  1QGK B;  3P8M C;  1OVR A;  2ZJS E;  1T8Z A;  1L0L E;  4WY4 B;  1PGJ A;  1Q7Y Q;  2FYN B;  2WT7 B;  1NTM D;  2JDI H;  2KXP B;  2B9B A;  2FBW C;  1VQ5 P;  1PV3 A;  1NTZ J;  3L71 J;  2B87 A;  2VRS A;  3B5N C;  1L0N E;  1SQP D;  1FZB A;  4W7Z A;  2O01 N;  1VQ9 P;  2PP6 A;  1RF0 B;  3H1H G;  5CJ4 A;  1L0L J;  1NH4 A;  1SQX G;  1VQ7 P;  5KLV D;  5KAF E;  3VMA A;  1FJK A;  3TGU E;  3V6I A;  3MZW B;  2Q1K A;  1FZC C;  2Z5I A;  1PPJ E;  4YPC A;  1L0N J;  3H1L G;  3NFQ A;  4D6T E;  1NU1 K;  2A45 I;  1X8Y A;  2FFD B;  1LWU C;  3A5T A;  1WRG A;  3OJA B;  1JC9 A;  2YMY A;  2R5B A;  1JTH A;  1X9V A;  3JC2 2;  1FJP A;  1T3J A;  3TGU J;  1RE4 A;  2QA4 P;  2BEZ F;  2J60 A;  4OH8 B;  4ZFG A;  3CXH I;  3HRN A;  5KLV G;  2AXT E;  1LT9 A;  4RKU J;  4D6T J;  4R4M A;  3PJS K;  1LJ2 A;  2D2C C;  1G1I A;  1S3J A;  2R3C A;  1SQX K;  1XTG B;  4WWI A;  2A06 D;  1AJY A;  2OQQ A;  1M1J B;  4K3A A;  1NWQ A;  1RQU A;  3CXH D;  3O6Q A;  4H44 D;  2O3J A;  3LW5 H;  4AUW A;  2ZFC A;  1OIP A;  1U7J A;  1SQQ E;  1SQV D;  2SPZ A;  3D71 A;  1NGM B;  2KS1 A;  2E75 C;  3MUD C;  3S9O A;  2JHM F;  2E76 B;  1NHL A;  3KXD A;  1LP1 B;  2Y0E A; 
#chains in the Genus database with same CATH homology
 2Z5H A;  3P8C D;  2A45 G;  2N1T D;  1YYC A;  3TK1 A;  2R32 A;  2WPR A;  1FBM A;  1KFN A;  1M1J C;  2IFN A;  1RE3 A;  1FZE C;  4Y99 C;  1MZ9 A;  4JYO X;  1N86 C;  1N7S B;  1T2K D;  3BAT A;  1KFM A;  4I2L C;  1IK9 A;  1N73 A;  2P67 A;  3KQG A;  3G3Z A;  2W6A A;  1FZB B;  5AVZ B;  1CZQ A;  1DEB A;  1LTG C;  2JEE A;  1L4A D;  2N1T B;  3HUS C;  1KIL D;  1MUU A;  2WTY A;  2XNX B;  5APT A;  3B8E B;  5APS A;  1FZF C;  2HLO A;  5APW A;  2N1T A;  4I1L A;  1FZA B;  3GHG A;  2XNX A;  2FXM A;  3I5C A;  3VMY A;  3LIE A;  1NKN A;  5AW4 B;  2Z4E B;  1NKZ B;  1N7S C;  4WY4 C;  1FZA A;  3RK3 B;  1G1J A;  2C9N Y;  3M9Q A;  1HVV A;  1FZG A;  1FZB C;  2P7J A;  4M7H A;  5AW1 B;  1JNM A;  3R2P A;  1FIB A;  1FID A;  1L4A A;  3V4Q A;  3RK2 C;  1KIL A;  2FYU K;  2J5Z A;  1JY3 P;  3KDP B;  3KPE A;  3HD7 D;  4C7R A;  1GL2 B;  1XTC C;  3U1A A;  3M0D C;  4O9B A;  1GU4 A;  2D39 A;  4EOT A;  2Z4E C;  1NTK K;  2NPS D;  3EQ2 A;  3V5B A;  3WMM 0;  2J64 A;  1LTT C;  4C7N B;  1GL2 A;  1HH0 A;  3L37 A;  2GUS A;  4XE5 B;  3RK3 C;  1EQ7 A;  3VN0 A;  1LT9 B;  2W6B A;  1NOH A;  3L4F A;  3HE4 A;  1FAV A;  2WPS A;  5CHX A;  1GTW A;  1JCD A;  2HG5 D;  1IFI A;  2O1K A;  1ZN5 A;  4HH2 A;  2Q9I B;  3HD7 A;  2NPS B;  5CCG D;  3EFG A;  3CL3 D;  1H8A A;  3RL0 B;  1HWT C;  5AVU B;  5AW9 B;  1CI6 B;  1RE4 C;  3P32 A;  2Q5U A;  3M9H A;  2Q9I A;  2HOD C;  2NPS A;  2OYI A;  2H7H A;  1T3U A;  5KJ7 D;  3V2R A;  1CI6 A;  5APX A;  2WNP F;  2JJL A;  1LT9 C;  1GW4 A;  2WSF H;  3BVH A;  2J3G A;  1OWA A;  3HE5 B;  3FIB A;  1JOC A;  2YKQ A;  1Z3S A;  3HTK B;  4ZKP A;  1URQ B;  3VP8 A;  1N2D C;  3BAS A;  1IJD B;  2KYV A;  3UIA A;  2C9L Y;  1LTJ A;  1IFM A;  3HTK A;  2J1G A;  3B5N D;  5CCG A;  3RL0 C;  4M7F A;  2P2U A;  4W7Y A;  5AVQ B;  2Q7C A;  3IR9 A;  1IFD A;  1DH3 A;  3IFM A;  1NAF A;  1RE3 B;  3VMZ A;  3N4X A;  4NYT A;  4R9T A;  1N73 B;  5AW8 B;  1LTS C;  2L5G B;  1X79 B;  1SFC C;  4R9J A;  5APU A;  5KJ7 A;  1W2E A;  2A45 H;  1HGZ A;  2CPS A;  1RF1 B;  2XV5 A;  2C0X A;  1SP4 A;  4C46 A;  2WIT A;  1LTI C;  1SQP K;  1URQ C;  2KSJ A;  4IFF A;  3B5N B;  2Q3I A;  1RF1 A;  2H8P D;  4GKG A;  2HLO B;  5AW7 B;  2BAS A;  3GHG B;  1GK4 A;  1M7L A;  2FYZ A;  3U59 A;  1MFZ A;  1GDT A;  1PFI A;  3B5N A;  2WSC H;  5AW0 B;  1RE3 C;  2QM7 A;  1JO5 A;  3NTN A;  2GM4 A;  2IFM A;  1N73 C;  3CLQ A;  4WB4 A;  2E43 A;  1FZG B;  1L0L K;  5CCH D;  2YO3 A;  2WZ7 A;  3M06 A;  1JY3 N;  1E5W A;  1L4A B;  2J2P A;  1HTL C;  1KIL B;  2YKO A;  1SVF A;  2WT7 A;  3OA7 A;  1QL2 A;  1SQB K;  2YNY A;  1SLQ A;  1IC2 A;  3A7O A;  3BRT B;  5BU8 B;  2HLO C;  4N3Y B;  2N1T C;  1FZC A;  1JUN A;  3GHG C;  2E42 A;  2XNX C;  2POH A;  3VMX A;  4AQR D;  1LTB C;  1DX7 A;  1HJB A;  1FZA C;  1J1E B;  2KB7 P;  3E1I B;  1T2K C;  4IFD K;  1LWU A;  4JYC A;  5KTB A;  2KP8 A;  1FZG C;  1FZD A;  1RF0 A;  1Z56 A;  1QL1 A;  4LLH A;  5CCH A;  3HE4 B;  1L4A C;  2GUV A;  3E1I A;  1IO4 A;  1KIL C;  1HGV A;  5AVS B;  1JCC A;  3BRV B;  5APQ A;  3VTP C;  3SWF A;  2J0Y A;  4AYC A;  1ZV8 A;  3HD7 B;  3V2P A;  1ZR2 A;  1JY2 O;  3H6P A;  2XKM A;  4W80 A;  2O1J A;  3II6 A;  2OYH B;  2FKW B;  2WPQ A;  1KQL A;  2IX7 C;  5AW5 B;  5APV A;  1CW5 A;  1GL2 C;  2M8R A;  5CMZ A;  1J1E C;  4DOJ A;  2OYI B;  2JHK F;  1WT6 A;  2FFD A;  1N7L A;  1GZL A;  1G2C A;  2H43 B;  2FIB A;  1ZR4 A;  2OYH A;  3BVH B;  4I6M C;  3M91 A;  2HPC B;  5AVX B;  1FU1 A;  5AW3 B;  5BVZ A;  4DZO A;  4KHX A;  3C9I A;  2H43 A;  4N6J A;  1CSB A;  2WWW A;  2HPC A;  2I1J A;  3HD7 C;  1LTJ B;  2J3F D;  2JHH C;  1NO4 A;  3TNU B;  1A02 J;  4WBA A;  5APY A;  2J3O A;  2Q9I C;  3H32 A;  2NPS C;  2OYI C;  1FOS E;  1FDM A;  1GD2 E;  3MUD A;  3TNU A;  3V2Q A;  4M3L A;  4N78 E;  2H43 C;  2WSE H;  1LTA C;  3BVH C;  1AQ5 A;  2MJZ A;  1VDF A;  3O8Z A;  2LKM A;  5AVV B;  2C0W A;  1H89 A;  1NTM K;  2XZR A;  3V2N A;  4LC1 A;  3TYY A;  1M1J A;  1FZE A;  1N7S D;  2J0G A;  4WY4 D;  1N86 A;  1LTJ C;  2XDJ A;  3CI9 A;  3HUS B;  3OAK A;  5CCG C;  1JY2 P;  2ZXE B;  2J3F A;  1RY3 A;  4EIJ A;  2JHI F;  1KZU B;  3M0A A;  1Z3U A;  1NTZ K;  4EPU A;  3TSI A;  3HUS A;  3RK2 D;  1H88 A;  3M9B A;  5AW6 B;  5KJ7 C;  3L35 A;  3V4W A;  1FZF A;  3P8M C;  1T8Z A;  5KLV K;  4WY4 B;  4N78 D;  2KLV A;  2O01 H;  3L36 A;  2N9B A;  1J1D B;  2WT7 B;  2YKP A;  1RF1 C;  1ZLL A;  1FZC B;  1IFJ A;  1N7S A;  3RK3 D;  2OAR A;  4WY4 A;  3U1C A;  3RK2 B;  2VRS A;  3B5N C;  1FZB A;  4W7Z A;  1L0N K;  2J61 B;  1LWU B;  3A2A A;  2PP6 A;  1RF0 B;  3VYI A;  2XU6 A;  1S9K E;  4LGD E;  1GL2 D;  1J2J B;  5CJ4 A;  3LID A;  1NH4 A;  2J61 A;  3VOP A;  4GT1 A;  3M0D A;  1J1D C;  4JF7 A;  3MTU E;  1FJK A;  3NXS A;  1GU5 A;  2Z4E A;  3MIW A;  1FZC C;  1AFO A;  2Z5I A;  5AVT B;  2KOG A;  2QM8 A;  2HYN A;  3MGN A;  1A02 F;  5BU5 A;  3NFQ A;  5AVY B;  5AW2 B;  4GIF A;  2PAJ A;  1JTH B;  1NU1 K;  1GW3 A;  2A45 I;  1X8Y A;  2FFD B;  1LWU C;  3A5T A;  3T97 A;  2J59 M;  1WRG A;  3OJA B;  4HYT B;  1JC9 A;  1G2C B;  2YMY A;  1RF0 C;  4ZKU A;  5CCH C;  1RE4 B;  1OXZ A;  1JTH A;  1X9V A;  2R5B A;  2HFE D;  3SWY A;  2HOD B;  3E1I C;  3RL0 D;  1FJP A;  4IFM A;  3P7K A;  3N7N A;  1T3J A;  2M3B A;  3MD0 A;  1S9K D;  1RE4 A;  2HOD A;  1MV8 A;  4C7N A;  1SFC D;  2J60 A;  4ZFG A;  4OH8 B;  1JMM A;  3HRN A;  1SQV K;  1IFN A;  2YO2 A;  1LT9 A;  2I1K A;  1HBW A;  4XA4 A;  5CJ0 A;  3H32 B;  2CPB A;  3P8C E;  1G1I A;  2FFD C;  1FOS F;  1HUC A;  1URQ D;  2R3C A;  4JZC A;  5AVW B;  1SQX K;  2OYH C;  1XTG B;  1FIC A;  2JHL F;  2IPP A;  4JYB A;  3VP9 A;  2P1J A;  3PP5 A;  2R5D A;  4RES B;  1SFC B;  1LGH B;  1GK6 A;  1VPC A;  1JY2 N;  1M1J B;  1YTZ I;  3KYQ A;  1FZE B;  1NWQ A;  2J0H A;  4Y99 B;  2HPC C;  1N86 B;  1YTZ T;  4AUW A;  3LW5 H;  2J3U A;  2ZFC A;  2GY7 A;  1SFC A;  2J58 A;  5AVR B;  2W27 A;  3NMD A;  3A3Y B;  3HE5 A;  3H32 C;  4B86 A;  1SQQ K;  2JHM F;  1JY3 O;  1URQ A;  1NHL A;  1FZF B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...