1RF1C

Crystal structure of fragment d of gammae132a fibrinogen with the peptide ligand gly-his-arg-pro-amide
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
298
structure length
298
Chain Sequence
YEASILTHDSSIRYLQEIYNSNNQKIVNLKEKVAQLAAQCQEPCKDTVQIHDITGKDCQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQSAIPYALRVELEDWNGRTSTADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEGNCAEQDGSGWWMNKCHAGHLNGVYYQGGTYSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIPFNRLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Calcium-Binding Site beta2, Adjacent to the "b" Polymerization Site, Modulates Lateral Aggregation of Protofibrils during Fibrin Polymerization.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
molecule keywords Fibrinogen alpha/alpha-E chain
total genus 91
structure length 298
sequence length 298
chains with identical sequence F
ec nomenclature
pdb deposition date 2003-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1rf1C01
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 1rf1C02
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 1rf1C03
1FIDA 1LTJB 1LWUB 1N73C 4M7HA 1FZCB 1RF1A 2JHIF 3BVHA 2HODB 1RF0A 2J3FD 1FZDA 1N86B 2JHHC 1RE4C 3E1IB 2H43B 1RF0B 1FZEA 2OYHB 2D39A 1LWUA 2XNXB 2JHMF 2J5ZA 1JY3O 2A45G 1M1JA 1FZBA 2J1GA 1M1JC 1T3UA 2XNXA 4JYOX 1FZFC 1FZEB 2OYHA 2HPCB 1LT9A 2J3UA 3H32A 2FFDC 4ZFGA 1N86C 3E1IC 2FFDA 1JY2P 1FZGB 1LT9C 3BVHB 2OYIC 1FZCA 1RF1B 2J0HA 1N73A 1FZBC 2OYIA 2Q9IB 1LWUC 4NYTA 3HUSC 2A45H 2H43A 1RE4A 4JZCA 3H32C 2J3FA 3FIBA 2A45I 1RE3B 1Z3UA 2OYIB 2HPCA 1RF1C 1FZAA 3GHGA 1LTJC 1N73B 1FZBB 2JHKF 1FZCC 4R9TA 2HLOB 2J0GA 3GHGB 1FZAB 2GY7A 2HODC 1FZFB 4R9JA 4EPUA 1N86A 3E1IA 2FIBA 1FIBA 2Z4EB 1RF0C 2OYHC 2J3GA 1RE3C 2J64A 1FZFA 2XNXC 2J61A 2J2PA 2J0YA 2Q9IA 1M1JB 1W2EA 2J60A 2HLOC 1LTJA 1FZEC 3GHGC 1FZAC 2HPCC 1JY2N 2J61B 1JY2O 1RE3A 2FFDB 4M7FA 1JY3P 1FZGA 1JC9A 3HUSB 1Z3SA 2Z4EC 2Z4EA 1JY3N 1FZGC 1LT9B 1RE4B 3H32B 3BVHC 2H43C 2J3OA 3HUSA 1FICA 2HODA 2HLOA 2WNPF 2JHLF 2Q9IC
chains in the Genus database with same CATH superfamily
3W67A 1LWUB 2KB7P 3AEFC 4WB4A 1J1EB 1GK4A 3L71J 2K9JA 2R3SA 2WMMA 1Y47A 3CWBE 2IPPA 1VQ4P 1SQQK 1NVOA 3RK2C 2I1KA 3WUUA 1U57A 5APYA 1PZQA 3Q5SA 2FBWC 1EDLA 2KK7A 3NTNA 4NYTA 4HKZH 2BEZF 2J3FA 3OA7A 1X8YA 1NTKK 2OYIB 3H1LE 5CCGC 3BCCG 2OTLP 1VQ5P 1S5LH 1SS1A 2H8PD 2O01N 3L75G 2P67A 2JWAA 1N86A 1GTWA 1PGOA 1SQVD 1Q86Q 1GU5A 4U3FE 2QRXA 1DEBA 1JOCA 1ZRTD 1PP9E 2OTKE 3HTKB 3SWFA 3L35A 3HUSB 1PFIA 4HB1A 2ZXXA 5AVUB 1XTGB 3HE4B 3KPEA 1KFMA 5KJ7C 4D6TG 1PPJE 1BE3G 5AW5B 1NKZB 1URQC 2M8RA 2N9BA 5AVRB 5KJ7A 2Z5IA 1OMIA 5KLVJ 1NTMK 1KMIZ 1IK7A 2OYHB 3CXHE 4Y28J 1LWUA 3TGUE 2XNXB 2Z5HA 4ZNCA 2Y9YA 1BGYD 2M0BA 3D6ZA 1E5WA 1YJWP 2HPCB 3F5HA 4ZFGA 1N86C 3HRNA 1E79H 3FWLA 3JC22 3BVHB 1EZVG 1JUNA 1LTAC 1U7MA 4H0LB 1SQQG 3RBZA 3AECC 1MKMA 1W2BO 3U1CA 1OVVA 4EIJA 3KDPB 1R5SA 2A45I 5APVA 1BE3E 1PPJG 2N1TD 1JCDA 3BCCJ 3GHGB 3B5NB 1FZFB 1VPCA 1OWAA 1YI2P 1QLED 3CMEP 2E43A 2NPSC 2ZYAA 1ZLLA 3M9BA 3CCLP 1RH5B 3AE6C 1TU3F 1FZEC 2QG4A 5AW2B 4D6TE 4C46A 1JY2N 1FDOA 1RE4B 3CLQA 3G9RA 4BWNA 1SFCB 1SQPD 3V4QA 1MFTA 1DIPA 5APSA 4U3FG 2NRGA 4PV1C 2JHHC 3L72E 3P8CE 1VQ8P 3S1KA 1M90Q 1KC8Q 2IZ0A 1L0LD 2KSEA 1QGKB 1OW7A 5KLVE 2ZXEB 1FDIA 1KB9H 3B5NC 4YPCA 1FZFC 1G2CA 5AVVB 2FFDC 3HD7C 2PFXA 4H44D 3T97B 2FYUE 1SQQJ 5M1BA 2LR2A 2KLUA 2AEJA 4NPFX 3SFEC 2QJPC 3EFGA 2Q1KA 3IR9A 3H1HG 3L71D 1NU1J 1X0TA 1BGYE 4B86A 3M0DC 2QJKC 1SQXK 1PL5A 3FIBA 1IJDB 1FZBB 2FYZA 4GT1A 4KJMA 3RK2D 1OW8A 4K3AA 4RESB 1WMKA 2OYHC 4EI2A 1P84I 4ZKPA 2XNDH 1KILB 2J60A 2C9NY 1NU1K 5CCGA 1Y9BA 1ZXGA 4M7FA 2MJZA 1USDA 5H2FH 2I8DA 4WY4D 4DCKA 1Q7YQ 2E42A 3BCCE 2WWWA 2RH0A 3IF4A 4GDOA 1NYHA 1GL2A 5KLIB 2FY8A 4PD4D 1FAVA 3CD6P 2E5TA 1OZHA 3AE7C 1PP9J 2KUBA 1KYOI 1NAFA 2P10A 1SQQD 2WQYC 3M0DA 3HD7D 3L73D 3PJSK 2Y0CA 4XFJA 4AUWA 3O8ZA 1S5LE 1PIXA 3CXHH 5E79H 2XV5A 1G1IA 1HWTC 2YKPA 1H0TB 1HGZA 1YJNP 1HGVA 1YQ3C 2DW3A 1GL2B 1P84D 3L71E 5AVWB 2XU6A 1FZBC 1OW6A 3L70J 3GLMA 1UIXA 3CCJP 1S9KE 3T97A 2O01J 3VMAA 2G3AA 2FYUG 3NFQA 2P58A 2GM4A 3V2NA 2KIKA 4R9TA 3M9HA 5KAFE 3EFFK 3A0HH 4IFFA 1H89A 1HUCA 5TISE 3B5NA 1FZFA 2B87B 2N1TB 4U3FD 1PV3A 3GHGC 3MP7B 1AFOA 1PP9D 2OYOA 1JY3P 1MV8A 1EC5A 2HYNA 2Z4EA 2Y0EA 1LT9B 3TGUD 2JEEA 3N7NA 2WNPF 2BCCG 4ASVA 3BVHA 4WY4A 1L0LG 2M5AA 2L91A 1DH3A 2N9YB 5BU8B 1K9MQ 1IFDA 1OX3A 1ZP0C 5AW3B 2JHMF 3H1KD 3L71G 3H1JG 5K5GB 2KS1B 4I6MC 2NPSA 1LT9A 4OH8B 2J3UA 3H32A 1L2PA 3SFDC 1N7LA 3AE9C 4KHXA 1SVFA 2OYIC 3H1HJ 3VP8A 1RF1B 1W5CE 4UB6H 3HUSC 1GMJA 3CXHD 3AEBC 4WWIA 2IBZE 1ZMEC 1SQBE 1ZOYC 1T2KD 2XKMA 3A2AA 2H89C 3H6PA 1KV4A 1M7LA 3KYQA 1RF0C 2KOGA 2LXBA 5GTIE 4H13C 2J61A 3U59A 1GL2C 1Q2NA 4NPEA 3L73G 3LIDA 2QM8A 1SQPK 2PRRA 2YKOA 2HPCC 2UWJE 1JMMA 5H2FE 1JNMA 2ZJSE 2V7QJ 2NZ2A 4M7HA 1KILD 4AYCA 1HJBA 1NTKE 1NKNA 3KXDA 3CC4P 3GF7A 1D7MA 3H1HE 2YMYA 3USSA 2KXPB 3F89A 1JB0J 3L72D 3P8CD 1S3JA 2LXCB 5APWA 1M56D 1KILC 2BEQD 3H1JJ 1IFMA 2Y0DA 1BE3D 3H1IJ 1EZVI 3P32A 1NAYA 4I2LC 1PGQA 1IFJA 5KJ7D 2KS1A 1SQXG 2FYUD 1NGMB 1SQXE 4MN4C 1PGJA 1VQ7P 2SPZA 4PD4I 3AE8C 5KTBA 1VDFA 2JR8A 1K05A 3TGUG 1NU1D 1SQPE 1KQSO 2QA4P 1DD3A 1G1JA 3FWNA 1PP9G 5CJ0A 2E76C 4TT3H 5CJ4A 5B5EH 2R32A 1FZAC 3MIWA 3CCUP 2D2CD 1JY2O 3WU2E 3GF3A 1OVUA 1ZR4A 1NTMD 3M0AA 3JSVC 3H1KG 4PV1B 4GOFA 3BVHC 3VYIA 5BVZA 1U7JA 2HODA 1N7SD 2JO1A 2WSEJ 1L0NJ 1N73C 2V7QH 4YXWH 3FXEA 5KAIE 2D2CC 3W68A 2FXOA 4PD4E 3CWBD 2K37A 2NPSD 3CCMP 1FJKA 2W27A 2GUVA 1OIPA 1AVOA 1M1JA 3M9QA 1J1DC 2IDBA 2QSIA 4CPGA 2O01H 1P84H 5B5EE 3SWKA 2W90A 1KYOH 2RKLA 3JCUH 2J0HA 1ZN5A 5AW0B 3BRTB 4JPZB 3SSUA 2LKMA 3AE2C 1CSBA 1BDDA 3OJAB 3Q1MA 3RL0C 3Q5RA 4DT0A 2W6AA 1EQ7A 3MHVA 1N73B 2RN0A 3H1JE 1YTZT 1Z56A 3EQ2A 3HE5B 2E75C 1CW5A 3Q5PA 3WUTA 1FIBA 2Z4EB 2OGUA 1RE3C 2WSFJ 4A7PA 4H0LC 3IAOA 1J1DB 2WT7A 3AEEC 4OGQC 1YBKA 2XDJA 3II6A 1FZGA 2ZAEB 3BATA 3HUSA 1ZRTE 5KAIH 1L0LK 3AEAC 3I56P 3GW6A 3A5TA 1KORA 2JHLF 1VL2A 5GTHH 3L70G 4OGQD 1RF0A 2J3FD 4LGDE 1LTTC 3BRVB 1IC2A 3LIEA 1IK9A 3I5CA 2WPVB 4TLFA 1SQXJ 1NOHA 1FOSE 1N7SB 2XNXA 2OYHA 1WRGA 2CPSA 3L4FA 1SQXD 2KYVA 3HD7A 1NTZK 2KNCB 1QL1A 1JY2P 4Y99C 1SQBD 4U3FJ 4K35A 2J59M 1EDJA 1DX7A 1OFCX 4DOJA 5KLVD 2ZFCA 1ZR2A 2K88A 2B9BA 5KKZC 2R5BA 1H8AA 3GHGA 1LTJC 2JHKF 2J0GA 5CBOA 1Q90D 3GMAA 1T3JA 1KQGB 4WY4B 1L0NE 4PJ0E 1LTSC 1IZNB 3ZDMA 2JP3A 4U7JA 2HLOC 1L0LJ 1GD2E 3I55P 2W6BA 4Z1MH 4BRYB 5L8RJ 2NPSB 3H1KE 3H1IE 3O6QB 3H32B 1NO4A 3AE1C 1JMBA 3LW5J 1RF1A 2HODB 2QIWA 2KP8A 3IN6A 1EDKA 1SQBK 3RL0B 1GZLA 1N86B 3G3ZA 2W6JH 1FZEA 5C39A 1EXJA 4LLHA 2QEXP 1QX8A 2BCCD 2HG5D 1VF5D 3E1IC 1AQ5A 1L0ND 1N7SA 3A0HE 3A0BE 2JDIH 5AW4B 5CCHC 2P1JA 1LWUC 4W80A 2QJYC 1T2KC 2YIUC 3BCCD 3HD7B 2K9YA 3L70E 2ZYDA 1Z3UA 1L4AC 2IBZD 2WSFH 3KZIE 3UIAA 3CMAP 2WSCH 2O3JA 3AE5C 5B66H 5CCHD 5AVYB 1NTME 1S5LX 1S9KD 2ZVNB 3V6IA 3D70A 2OQQA 2YXQB 4HH2A 3FXDA 4N3YB 3L72J 1NTKD 3KHUA 2JKVA 5E79E 2FKWB 3VMYA 5APTA 1JM0A 1SQVK 2KSJA 1HTLC 2FYUJ 5TJHA 1YHQP 1YYCA 2Q9IC 5B66E 2WSEH 3L36A 3GG2A 1EDIA 1GW4A 2Q7CA 1RY3A 5KKZB 1X79B 3VOPA 1FZDA 3E1IB 3CX5D 2I1JA 2L5GB 1JY3O 2KI7B 3H1ID 4DZOA 1A02J 3D6YA 1M1JC 1NTZE 2J58A 3VP9A 3H1LG 3RK3C 1SQBG 3R4YA 4R4MA 2YIUB 1A02F 1BCCJ 2VRSA 2A06G 1LT9C 3CWBJ 5KLVG 1NTZG 1AA0A 3SWYA 3VMZA 1N73A 1QVFO 2OARA 2M3BA 4C7NA 3L72G 2WTYA 3HE4A 3L74E 1MFZA 2MKVA 1FZAA 5APQA 1QL2A 3WMM0 4WBAA 1YJ9P 1GK6A 1IFIA 1KYOE 1M1JB 3RGUA 5KLIC 1GDTA 2B88A 3B71A 2E75B 1SQPG 5TISH 2WPSA 4WY4C 2XZRA 2BASA 3H1LJ 1NU1G 2J5UA 4JBZA 2FXPA 3AE4C 1S4XA 4IFMA 1BCCE 2V4HA 1L0NG 3A0BH 3C1LA 4H13D 1Y8AA 2W83C 1WT6A 2C0XA 3H1KJ 3Q3DA 1NTMG 1Q82Q 1FZBA 1URQB 2J1GA 3RL0g 3TNUA 1FZEB 2A06E 4GOEA 2IBZG 2IX7C 5AW1B 1MZ9A 2FYNC 3H1HD 2E76B 3CWBG 1FZCA 2AEFA 2Q9IB 4RKUJ 1RE4A 3P7KA 2H7HA 1NTKG 3MZWB 3E1RA 3E7KA 3S4RA 4D6TJ 3CPWO 5GTHE 3MD0A 2IZ1A 2D2CB 2O1JA 1LTBC 4EDFA 1AVYA 4R4LA 2C0WA 1N2DC 2ITAA 1JEKA 3K5BA 3L73E 5BU5A 1GL2D 3CXHI 2RMZA 2Q9IA 1FDMA 2YO3A 1SP4A 4KT0J 1JCCA 2J61B 3VMXA 3PH0A 4IFDK 1X22A 1JC9A 3H1IG 1J1EC 1J2JB 1BE3J 4RO0A 2H88C 4GKGA 1FIDA 1SQVJ 1IO4A 1LTIC 2R44A 2QVAA 2C9LY 1NTZD 1HJ0A 4QMAA 1H88A 1RE4C 2H43B 2CK3H 3WU2H 4PV1D 1ZW0A 1LJ2A 2ZT9D 2GA1A 2Q6QA 1FJPA 2J5ZA 2PGDA 2YNYA 3CCSP 5KLVK 3TF5A 1T3UA 4JYOX 2WITA 3FX0A 1KQLA 3CCRP 4DJGA 3L70D 5AVQB 2FFDA 1XTCC 2JWDA 4WVZA 2ZT9C 3L74D 2E74C 2WSCJ 4NPDA 3MTUE 3BASA 5CHXA 2OYIA 5EFWB 4I7ZC 1SQBJ 4I1LA 4UB8H 2IFMA 2WPRA 2H43A 4EYYQ 3H32C 1QEXA 4N6JA 4W7YA 3VN0A 3TNUB 1Q81Q 3RK3D 1FZCC 1T6AA 1URQD 2HLOB 2QJYB 1YQ4C 3H25A 2M5AB 3ABVC 3M91A 3V2PA 3Q2YA 2E76D 1VQ9P 2KZIA 1YITP 1LTJA 1LGHB 2HFED 1KFNA 1USEA 1NU1E 1R5LA 1SFCA 3P8MC 4IL6X 4YXDC 1Z3SA 2Z4EC 4Y99B 4AQRD 2ZT9B 5AVTB 2H43C 1SQPJ 3OAKA 2HLOA 4PJ0H 2WT7B 1GW3A 1KB9D 3AEGC 3TGUJ 1MUUA 1CZQA 3V2QA 2WSSH 1VQOP 2R3CA 3H1JD 2YXRB 2QE7H 5CCGD 3TK1A 2N1TA 5DJUB 2QJPB 1VQLP 1LT1A 3A3YB 2Q5UA 2P2UA 1KZUB 3NMDA 2OTJP 4ZKUA 2O1KA 4L76A 2P7JA 4N78D 2K1AA 1FC2C 3PLNA 1EZVE 2A45H 1YTZI 1DEEG 4JZCA 3RK3E 1LTGC 3RL0D 2FYNB 1KB9I 3QH9A 2K3RA 4L73A 4LC1A 1RHZB 4UB6E 1KTMA 2ZYGA 2GY7A 4R9JA 4EPUA 1RQVA 4C7RA 2PP6A 3NXSA 3AE3C 3TSIA 1KILA 4H0LD 4ZMDA 2E74B 3ITKA 4RJTA 2R5DA 3L37A 3PTZA 4JF7A 3CCQP 2AEMA 2POHA 3AEDC 1JY3N 1LNQA 1FZGC 2IBZI 3N4XA 1OXZA 3V2RA 1LTJB 4I7ZB 3CC7P 1JO5A 1VQPP 1BSNA 3L74G 1EZVD 3PP5A 1L0NK 3TDKA 1BGYJ 4YTPC 1RF0B 1L4AB 1FBMA 5APXA 3CX5E 2D39A 3D71A 1S1CX 3L75E 1VQMP 2A45G 1NHLA 1M1KQ 1SQQE 1K8AQ 1KN7A 2KZJA 1PPJD 3A7OA 5APUA 4OVNF 3CCVP 3M06A 4IL6H 1IFNA 1HF9A 3CI9A 2AXTH 2HR3A 1YIJP 1P84E 1KQFB 1FS0E 1LP1B 1JTHB 3H1LD 4H44B 1BCCG 1HH0A 2CPBA 2GUSA 1RE3B 1RF1C 1SLQA 1VQ6P 2A06D 4XE5B 5DJTB 2FYUK 1M57D 2E75D 3E1IA 4XA4A 2YO2A 1NH4A 2Q3IA 5AW7B 1NTMJ 2BCCE 4HYTB 3RK3B 3RK2B 1EXIA 3O6QA 2YKQA 4N78E 3L75J 3R2PA 4BRYA 1IFPA 3RBXA 2FXMA 2M3EA 2Y9ZA 2IYPA 1FZCB 1OVRA 2JHIF 3LW5H 4GODA 3QWOC 3VTPC 1S72P 4BXLA 3HE5A 4GIFA 4UB8E 2W8ZA 3CC2P 3CCEP 1VF5C 3C9IA 1FZGB 4JYCA 2B89A 3U1AA 4OWFA 1AQTA 2E5YA 1NJIQ 1VQKP 1RQUA 3EWKA 1R8EA 1NTKJ 1L0LE 3FGAD 5AW8B 1BDCA 3MUDA 1ZV8A 2QM7A 1L4AD 1DD4A 2ZVOB 2HPCA 1G2CB 3G4SP 3CX5H 2B87A 3KQGA 1K04A 2G8YA 4JQ0D 3B4SA 2IYOA 1LP1A 1JTHA 1CI6A 2JJLA 3HTKA 3L75D 4JYBA 4HJGH 1KD1Q 2XNXC 2J2PA 1URQA 1SQVG 3CX5I 4W7ZA 2KLVA 1W2EA 1RE3A 2K9JB 3L74J 4ASWA 5KAFH 2Q3EA 2AXCA 3C8VA 1T8ZA 2J3OA 1FICA 1NTZJ 2WVRA 4M3LA 2AXTE 5CMZA 1UIIA 4L75A 5CCHA 2WZ7A 3TYYA 3G71P 1N7SC 4L74A 5GTIH 1FE6A 1CI6B 2WPQA 4D6TD 1KB9E 1NWQA 3G6EP 3PRJA 2BCCJ 5CBNA 2E74D 1QVGO 3MGNA 5AVSB 5AW9B 2N1TC 1HVVA 4PD4H 1L4AA 1BCCD 4OGQB 1FOSF 1S2EA 3JCUE 1BGYG 2QJKB 3B8EB 1FU1A 3WUVA 4C7NB 1X9VA 1AJYA 3S9OA 4EOTA 3V4WA 1VQNP 3CL3D 1AV1A 3MUDC 3V5BA 1BSHA 1KILE 3L73J 4O9BA 1PGPA 1M8OB 1SFCC 4H13B 3OW2O 1FZAB 2HODC 1H0TA 5AVZB 2FIBA 1GU4A 1VF5B 1K73Q 2IFNA 2J3GA 2J64A 1SFCD 2J0YA 1HBWA 1SQVE 5AW6B 2YMKA 5AVXB 3KZIH 2KNCA 3B5ND 2FFDB 4IL6E 1N8RQ 2PAJA 4H44C 1KYOD 3IFMA 4IOIH 3PHLA
chains in the Genus database with same CATH topology
1LWUB 2KB7P 1GW3A 1RF1A 1MUUA 3BVHA 1CZQA 2HODB 4WB4A 4WY4A 3V2QA 2KP8A 1J1EB 1SQBK 2R3CA 3RL0B 1GZLA 1DH3A 1N86B 1GK4A 3G3ZA 5BU8B 1FZEA 1IFDA 5CCGD 5AW3B 2JHMF 3TK1A 2N1TA 2IPPA 1SQQK 4I6MC 4LLHA 2NPSA 3RK2C 1LT9A 3A3YB 4OH8B 2Q5UA 2J3UA 3H32A 2P2UA 2HG5D 1KZUB 3NMDA 3E1IC 1AQ5A 2I1KA 4ZKUA 1N7LA 5APYA 2O1KA 4KHXA 1SVFA 2P7JA 4N78D 2OYIC 3VP8A 1RF1B 1N7SA 5AW4B 5CCHC 2P1JA 1LWUC 4W80A 3NTNA 1T2KC 4NYTA 3HUSC 2A45H 1YTZI 4JZCA 3HD7B 2J3FA 1LTGC 3RL0D 3OA7A 1X8YA 1NTKK 4LC1A 1L4AC 2WSFH 3UIAA 1Z3UA 2OYIB 2WSCH 5CCGC 5CCHD 2H8PD 5AVYB 1T2KD 2GY7A 2P67A 2XKMA 3A2AA 4R9JA 1S9KD 4EPUA 1N86A 3H6PA 1M7LA 1GTWA 4C7RA 2PP6A 3KYQA 3NXSA 4HH2A 1RF0C 2KOGA 1GU5A 4N3YB 3TSIA 1KILA 2J61A 3U59A 1DEBA 1JOCA 1GL2C 2FKWB 3LIDA 3VMYA 3HTKB 2QM8A 1SQPK 2YKOA 3SWFA 2HPCC 2R5DA 3L35A 3L37A 4JF7A 1JMMA 5APTA 2POHA 3HUSB 1PFIA 1JY3N 1FZGC 1SQVK 1XTGB 5AVUB 3HE4B 2KSJA 1KFMA 3KPEA 1JNMA 1HTLC 3N4XA 5KJ7C 1OXZA 3V2RA 1YYCA 2Q9IC 5AW5B 1LTJB 1NKZB 4M7HA 1URQC 1JO5A 1KILD 2M8RA 2N9BA 2WSEH 3L36A 5AVRB 5KJ7A 1GW4A 4AYCA 2Q7CA 1HJBA 1RY3A 2Z5IA 1NKNA 3PP5A 1X79B 3VOPA 1FZDA 3E1IB 1L0NK 1NTMK 1RF0B 1L4AB 1FBMA 5APXA 2OYHB 2YMYA 2D39A 1LWUA 2I1JA 2XNXB 3P8CD 2L5GB 1JY3O 2A45G 1NHLA 2Z5HA 4DZOA 5APWA 1A02J 1M1JC 2J58A 1KILC 3VP9A 3RK3C 1E5WA 2HPCB 1A02F 1IFMA 2VRSA 3A7OA 4ZFGA 1N86C 3P32A 5APUA 4I2LC 3HRNA 1LT9C 1IFJA 3BVHB 5KJ7D 1JUNA 1LTAC 3M06A 3SWYA 3VMZA 1IFNA 1N73A 2OARA 3CI9A 2M3BA 4C7NA 2WTYA 3HE4A 3U1CA 4EIJA 1JTHB 1HH0A 2GUSA 2CPBA 1MFZA 3KDPB 2A45I 5APVA 1RE3B 1RF1C 2N1TD 1FZAA 1SLQA 5APQA 5KTBA 1VDFA 1JCDA 1QL2A 4XE5B 3WMM0 2FYUK 3GHGB 3B5NB 1FZFB 1VPCA 1OWAA 3E1IA 4WBAA 4XA4A 2YO2A 1NH4A 2E43A 2NPSC 1ZLLA 3M9BA 2Q3IA 1G1JA 5AW7B 1GK6A 1IFIA 5CJ0A 5CJ4A 1M1JB 4HYTB 3RK3B 2R32A 1FZEC 1FZAC 5AW2B 1GDTA 3MIWA 4C46A 3RK2B 1JY2N 1JY2O 1ZR4A 2YKQA 3M0AA 2WPSA 4WY4C 4N78E 1RE4B 3BVHC 3R2PA 3VYIA 5BVZA 2XZRA 2BASA 2HODA 3CLQA 1SFCB 2FXMA 1N7SD 3V4QA 1N73C 1FZCB 4IFMA 2JHIF 3LW5H 5APSA 3VTPC 2JHHC 3P8CE 3HE5A 2NPSD 1FJKA 2W27A 4GIFA 1WT6A 2C0XA 2GUVA 1M1JA 1FZBA 1URQB 2J1GA 3M9QA 2ZXEB 3B5NC 1FZFC 1J1DC 1G2CA 3TNUA 1FZEB 2O01H 5AVVB 2FFDC 2IX7C 3C9IA 3HD7C 5AW1B 1FZGB 1MZ9A 4JYCA 3U1AA 1FZCA 2J0HA 1ZN5A 5AW0B 3EFGA 2Q9IB 3IR9A 3BRTB 1RE4A 2LKMA 3P7KA 5AW8B 2H7HA 4B86A 1CSBA 3M0DC 3OJAB 1SQXK 3MUDA 1ZV8A 3RL0C 2QM7A 3FIBA 1L4AD 2W6AA 1IJDB 1EQ7A 2HPCA 1G2CB 1N73B 1FZBB 2FYZA 4GT1A 3MD0A 3RK2D 2O1JA 1YTZT 1Z56A 1LTBC 3KQGA 2C0WA 3EQ2A 3HE5B 1N2DC 1CW5A 1FIBA 4RESB 2Z4EB 1JTHA 1CI6A 2JJLA 3HTKA 2OYHC 4JYBA 4ZKPA 1RE3C 2XNXC 2J2PA 5BU5A 1GL2D 1URQA 2Q9IA 1FDMA 2YO3A 1SP4A 4W7ZA 2KLVA 1KILB 1W2EA 1J1DB 2J60A 2C9NY 1NU1K 5CCGA 2WT7A 1JCCA 2J61B 1RE3A 2XDJA 4M7FA 2MJZA 3II6A 3VMXA 4IFDK 1FZGA 1JC9A 3BATA 1J1EC 1J2JB 4WY4D 1T8ZA 2J3OA 3HUSA 1L0LK 1FICA 4M3LA 5CMZA 2E42A 2WWWA 5CCHA 2WZ7A 3A5TA 3TYYA 2JHLF 4GKGA 1GL2A 1FIDA 1N7SC 1FAVA 1IO4A 1LTIC 2C9LY 1CI6B 1NAFA 1RF0A 2WPQA 1NWQA 3M0DA 3HD7D 2J3FD 4LGDE 1H88A 1RE4C 1LTTC 3BRVB 1IC2A 3O8ZA 3LIEA 4AUWA 2H43B 1IK9A 3I5CA 1FJPA 2J5ZA 1NOHA 2YNYA 1FOSE 1N7SB 5KLVK 3MGNA 5AVSB 5AW9B 2N1TC 1HVVA 1T3UA 2XNXA 4JYOX 1L4AA 2WITA 2OYHA 1WRGA 1KQLA 2CPSA 1FOSF 3L4FA 2XV5A 2KYVA 1G1IA 3HD7A 1NTZK 2YKPA 5AVQB 1HWTC 2FFDA 1QL1A 1JY2P 1HGZA 1XTCC 4Y99C 1HGVA 3B8EB 1GL2B 1FU1A 3MTUE 2J59M 3BASA 4C7NB 1X9VA 5AVWB 2XU6A 1FZBC 5CHXA 2OYIA 4EOTA 1DX7A 3V4WA 4DOJA 1S9KE 2ZFCA 3CL3D 4I1LA 3V5BA 1ZR2A 2IFMA 3T97A 2WPRA 2H43A 3NFQA 2GM4A 3H32C 4O9BA 4N6JA 4W7YA 3V2NA 1SFCC 3TNUB 3VN0A 2R5BA 1H8AA 3GHGA 1LTJC 2JHKF 3RK3D 1FZCC 4R9TA 3M9HA 1URQD 2HLOB 2J0GA 1FZAB 2HODC 5AVZB 2FIBA 4IFFA 1GU4A 1H89A 1T3JA 4WY4B 2IFNA 1HUCA 2J3GA 2J64A 1SFCD 3B5NA 1FZFA 3M91A 3V2PA 2J0YA 1LTSC 1HBWA 2N1TB 2HLOC 1LTJA 5AW6B 1LGHB 3GHGC 2HFED 1KFNA 5AVXB 1AFOA 1GD2E 1SFCA 3B5ND 2FFDB 1JY3P 2W6BA 3P8MC 1MV8A 1Z3SA 2HYNA 2Z4EA 2Z4EC 4Y99B 2NPSB 1LT9B 4AQRD 3H32B 5AVTB 2H43C 2PAJA 2JEEA 1NO4A 3IFMA 3OAKA 2HLOA 3N7NA 2WT7B 2WNPF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FID A;  1LTJ B;  1LWU B;  1N73 C;  4M7H A;  1FZC B;  1RF1 A;  2JHI F;  3BVH A;  2HOD B;  1RF0 A;  2J3F D;  1FZD A;  1N86 B;  2JHH C;  1RE4 C;  3E1I B;  2H43 B;  1RF0 B;  1FZE A;  2OYH B;  2D39 A;  1LWU A;  2XNX B;  2JHM F;  2J5Z A;  1JY3 O;  2A45 G;  1M1J A;  1FZB A;  2J1G A;  1M1J C;  1T3U A;  2XNX A;  4JYO X;  1FZF C;  1FZE B;  2OYH A;  2HPC B;  1LT9 A;  2J3U A;  3H32 A;  2FFD C;  4ZFG A;  1N86 C;  3E1I C;  2FFD A;  1JY2 P;  1FZG B;  1LT9 C;  3BVH B;  2OYI C;  1FZC A;  1RF1 B;  2J0H A;  1N73 A;  1FZB C;  2OYI A;  2Q9I B;  1LWU C;  4NYT A;  3HUS C;  2A45 H;  2H43 A;  1RE4 A;  4JZC A;  3H32 C;  2J3F A;  3FIB A;  2A45 I;  1RE3 B;  1Z3U A;  2OYI B;  2HPC A;  1RF1 C;  1FZA A;  3GHG A;  1LTJ C;  1N73 B;  1FZB B;  2JHK F;  1FZC C;  4R9T A;  2HLO B;  2J0G A;  3GHG B;  1FZA B;  2GY7 A;  2HOD C;  1FZF B;  4R9J A;  4EPU A;  1N86 A;  3E1I A;  2FIB A;  1FIB A;  2Z4E B;  1RF0 C;  2OYH C;  2J3G A;  1RE3 C;  2J64 A;  1FZF A;  2XNX C;  2J61 A;  2J2P A;  2J0Y A;  2Q9I A;  1M1J B;  1W2E A;  2J60 A;  2HLO C;  1LTJ A;  1FZE C;  3GHG C;  1FZA C;  2HPC C;  1JY2 N;  2J61 B;  1JY2 O;  1RE3 A;  2FFD B;  4M7F A;  1JY3 P;  1FZG A;  1JC9 A;  3HUS B;  1Z3S A;  2Z4E C;  2Z4E A;  1JY3 N;  1FZG C;  1LT9 B;  1RE4 B;  3H32 B;  3BVH C;  2H43 C;  2J3O A;  3HUS A;  1FIC A;  2HOD A;  2HLO A;  2WNP F;  2JHL F;  2Q9I C; 
#chains in the Genus database with same CATH topology
 3W67 A;  1LWU B;  2KB7 P;  3AEF C;  4WB4 A;  1J1E B;  1GK4 A;  3L71 J;  2K9J A;  2R3S A;  2WMM A;  1Y47 A;  3CWB E;  2IPP A;  1VQ4 P;  1SQQ K;  1NVO A;  3RK2 C;  2I1K A;  3WUU A;  1U57 A;  5APY A;  1PZQ A;  3Q5S A;  2FBW C;  1EDL A;  2KK7 A;  3NTN A;  4NYT A;  4HKZ H;  2BEZ F;  2J3F A;  3OA7 A;  1X8Y A;  1NTK K;  2OYI B;  3H1L E;  5CCG C;  3BCC G;  2OTL P;  1VQ5 P;  1S5L H;  1SS1 A;  2H8P D;  2O01 N;  3L75 G;  2P67 A;  2JWA A;  1N86 A;  1GTW A;  1PGO A;  1SQV D;  1Q86 Q;  1GU5 A;  4U3F E;  2QRX A;  1DEB A;  1JOC A;  1ZRT D;  1PP9 E;  2OTK E;  3HTK B;  3SWF A;  3L35 A;  3HUS B;  1PFI A;  4HB1 A;  2ZXX A;  5AVU B;  1XTG B;  3HE4 B;  3KPE A;  1KFM A;  5KJ7 C;  4D6T G;  1PPJ E;  1BE3 G;  5AW5 B;  1NKZ B;  1URQ C;  2M8R A;  2N9B A;  5AVR B;  5KJ7 A;  2Z5I A;  1OMI A;  5KLV J;  1NTM K;  1KMI Z;  1IK7 A;  2OYH B;  3CXH E;  4Y28 J;  1LWU A;  3TGU E;  2XNX B;  2Z5H A;  4ZNC A;  2Y9Y A;  1BGY D;  2M0B A;  3D6Z A;  1E5W A;  1YJW P;  2HPC B;  3F5H A;  4ZFG A;  1N86 C;  3HRN A;  1E79 H;  3FWL A;  3JC2 2;  3BVH B;  1EZV G;  1JUN A;  1LTA C;  1U7M A;  4H0L B;  1SQQ G;  3RBZ A;  3AEC C;  1MKM A;  1W2B O;  3U1C A;  1OVV A;  4EIJ A;  3KDP B;  1R5S A;  2A45 I;  5APV A;  1BE3 E;  1PPJ G;  2N1T D;  1JCD A;  3BCC J;  3GHG B;  3B5N B;  1FZF B;  1VPC A;  1OWA A;  1YI2 P;  1QLE D;  3CME P;  2E43 A;  2NPS C;  2ZYA A;  1ZLL A;  3M9B A;  3CCL P;  1RH5 B;  3AE6 C;  1TU3 F;  1FZE C;  2QG4 A;  5AW2 B;  4D6T E;  4C46 A;  1JY2 N;  1FDO A;  1RE4 B;  3CLQ A;  3G9R A;  4BWN A;  1SFC B;  1SQP D;  3V4Q A;  1MFT A;  1DIP A;  5APS A;  4U3F G;  2NRG A;  4PV1 C;  2JHH C;  3L72 E;  3P8C E;  1VQ8 P;  3S1K A;  1M90 Q;  1KC8 Q;  2IZ0 A;  1L0L D;  2KSE A;  1QGK B;  1OW7 A;  5KLV E;  2ZXE B;  1FDI A;  1KB9 H;  3B5N C;  4YPC A;  1FZF C;  1G2C A;  5AVV B;  2FFD C;  3HD7 C;  2PFX A;  4H44 D;  3T97 B;  2FYU E;  1SQQ J;  5M1B A;  2LR2 A;  2KLU A;  2AEJ A;  4NPF X;  3SFE C;  2QJP C;  3EFG A;  2Q1K A;  3IR9 A;  3H1H G;  3L71 D;  1NU1 J;  1X0T A;  1BGY E;  4B86 A;  3M0D C;  2QJK C;  1SQX K;  1PL5 A;  3FIB A;  1IJD B;  1FZB B;  2FYZ A;  4GT1 A;  4KJM A;  3RK2 D;  1OW8 A;  4K3A A;  4RES B;  1WMK A;  2OYH C;  4EI2 A;  1P84 I;  4ZKP A;  2XND H;  1KIL B;  2J60 A;  2C9N Y;  1NU1 K;  5CCG A;  1Y9B A;  1ZXG A;  4M7F A;  2MJZ A;  1USD A;  5H2F H;  2I8D A;  4WY4 D;  4DCK A;  1Q7Y Q;  2E42 A;  3BCC E;  2WWW A;  2RH0 A;  3IF4 A;  4GDO A;  1NYH A;  1GL2 A;  5KLI B;  2FY8 A;  4PD4 D;  1FAV A;  3CD6 P;  2E5T A;  1OZH A;  3AE7 C;  1PP9 J;  2KUB A;  1KYO I;  1NAF A;  2P10 A;  1SQQ D;  2WQY C;  3M0D A;  3HD7 D;  3L73 D;  3PJS K;  2Y0C A;  4XFJ A;  4AUW A;  3O8Z A;  1S5L E;  1PIX A;  3CXH H;  5E79 H;  2XV5 A;  1G1I A;  1HWT C;  2YKP A;  1H0T B;  1HGZ A;  1YJN P;  1HGV A;  1YQ3 C;  2DW3 A;  1GL2 B;  1P84 D;  3L71 E;  5AVW B;  2XU6 A;  1FZB C;  1OW6 A;  3L70 J;  3GLM A;  1UIX A;  3CCJ P;  1S9K E;  3T97 A;  2O01 J;  3VMA A;  2G3A A;  2FYU G;  3NFQ A;  2P58 A;  2GM4 A;  3V2N A;  2KIK A;  4R9T A;  3M9H A;  5KAF E;  3EFF K;  3A0H H;  4IFF A;  1H89 A;  1HUC A;  5TIS E;  3B5N A;  1FZF A;  2B87 B;  2N1T B;  4U3F D;  1PV3 A;  3GHG C;  3MP7 B;  1AFO A;  1PP9 D;  2OYO A;  1JY3 P;  1MV8 A;  1EC5 A;  2HYN A;  2Z4E A;  2Y0E A;  1LT9 B;  3TGU D;  2JEE A;  3N7N A;  2WNP F;  2BCC G;  4ASV A;  3BVH A;  4WY4 A;  1L0L G;  2M5A A;  2L91 A;  1DH3 A;  2N9Y B;  5BU8 B;  1K9M Q;  1IFD A;  1OX3 A;  1ZP0 C;  5AW3 B;  2JHM F;  3H1K D;  3L71 G;  3H1J G;  5K5G B;  2KS1 B;  4I6M C;  2NPS A;  1LT9 A;  4OH8 B;  2J3U A;  3H32 A;  1L2P A;  3SFD C;  1N7L A;  3AE9 C;  4KHX A;  1SVF A;  2OYI C;  3H1H J;  3VP8 A;  1RF1 B;  1W5C E;  4UB6 H;  3HUS C;  1GMJ A;  3CXH D;  3AEB C;  4WWI A;  2IBZ E;  1ZME C;  1SQB E;  1ZOY C;  1T2K D;  2XKM A;  3A2A A;  2H89 C;  3H6P A;  1KV4 A;  1M7L A;  3KYQ A;  1RF0 C;  2KOG A;  2LXB A;  5GTI E;  4H13 C;  2J61 A;  3U59 A;  1GL2 C;  1Q2N A;  4NPE A;  3L73 G;  3LID A;  2QM8 A;  1SQP K;  2PRR A;  2YKO A;  2HPC C;  2UWJ E;  1JMM A;  5H2F E;  1JNM A;  2ZJS E;  2V7Q J;  2NZ2 A;  4M7H A;  1KIL D;  4AYC A;  1HJB A;  1NTK E;  1NKN A;  3KXD A;  3CC4 P;  3GF7 A;  1D7M A;  3H1H E;  2YMY A;  3USS A;  2KXP B;  3F89 A;  1JB0 J;  3L72 D;  3P8C D;  1S3J A;  2LXC B;  5APW A;  1M56 D;  1KIL C;  2BEQ D;  3H1J J;  1IFM A;  2Y0D A;  1BE3 D;  3H1I J;  1EZV I;  3P32 A;  1NAY A;  4I2L C;  1PGQ A;  1IFJ A;  5KJ7 D;  2KS1 A;  1SQX G;  2FYU D;  1NGM B;  1SQX E;  4MN4 C;  1PGJ A;  1VQ7 P;  2SPZ A;  4PD4 I;  3AE8 C;  5KTB A;  1VDF A;  2JR8 A;  1K05 A;  3TGU G;  1NU1 D;  1SQP E;  1KQS O;  2QA4 P;  1DD3 A;  1G1J A;  3FWN A;  1PP9 G;  5CJ0 A;  2E76 C;  4TT3 H;  5CJ4 A;  5B5E H;  2R32 A;  1FZA C;  3MIW A;  3CCU P;  2D2C D;  1JY2 O;  3WU2 E;  3GF3 A;  1OVU A;  1ZR4 A;  1NTM D;  3M0A A;  3JSV C;  3H1K G;  4PV1 B;  4GOF A;  3BVH C;  3VYI A;  5BVZ A;  1U7J A;  2HOD A;  1N7S D;  2JO1 A;  2WSE J;  1L0N J;  1N73 C;  2V7Q H;  4YXW H;  3FXE A;  5KAI E;  2D2C C;  3W68 A;  2FXO A;  4PD4 E;  3CWB D;  2K37 A;  2NPS D;  3CCM P;  1FJK A;  2W27 A;  2GUV A;  1OIP A;  1AVO A;  1M1J A;  3M9Q A;  1J1D C;  2IDB A;  2QSI A;  4CPG A;  2O01 H;  1P84 H;  5B5E E;  3SWK A;  2W90 A;  1KYO H;  2RKL A;  3JCU H;  2J0H A;  1ZN5 A;  5AW0 B;  3BRT B;  4JPZ B;  3SSU A;  2LKM A;  3AE2 C;  1CSB A;  1BDD A;  3OJA B;  3Q1M A;  3RL0 C;  3Q5R A;  4DT0 A;  2W6A A;  1EQ7 A;  3MHV A;  1N73 B;  2RN0 A;  3H1J E;  1YTZ T;  1Z56 A;  3EQ2 A;  3HE5 B;  2E75 C;  1CW5 A;  3Q5P A;  3WUT A;  1FIB A;  2Z4E B;  2OGU A;  1RE3 C;  2WSF J;  4A7P A;  4H0L C;  3IAO A;  1J1D B;  2WT7 A;  3AEE C;  4OGQ C;  1YBK A;  2XDJ A;  3II6 A;  1FZG A;  2ZAE B;  3BAT A;  3HUS A;  1ZRT E;  5KAI H;  1L0L K;  3AEA C;  3I56 P;  3GW6 A;  3A5T A;  1KOR A;  2JHL F;  1VL2 A;  5GTH H;  3L70 G;  4OGQ D;  1RF0 A;  2J3F D;  4LGD E;  1LTT C;  3BRV B;  1IC2 A;  3LIE A;  1IK9 A;  3I5C A;  2WPV B;  4TLF A;  1SQX J;  1NOH A;  1FOS E;  1N7S B;  2XNX A;  2OYH A;  1WRG A;  2CPS A;  3L4F A;  1SQX D;  2KYV A;  3HD7 A;  1NTZ K;  2KNC B;  1QL1 A;  1JY2 P;  4Y99 C;  1SQB D;  4U3F J;  4K35 A;  2J59 M;  1EDJ A;  1DX7 A;  1OFC X;  4DOJ A;  5KLV D;  2ZFC A;  1ZR2 A;  2K88 A;  2B9B A;  5KKZ C;  2R5B A;  1H8A A;  3GHG A;  1LTJ C;  2JHK F;  2J0G A;  5CBO A;  1Q90 D;  3GMA A;  1T3J A;  1KQG B;  4WY4 B;  1L0N E;  4PJ0 E;  1LTS C;  1IZN B;  3ZDM A;  2JP3 A;  4U7J A;  2HLO C;  1L0L J;  1GD2 E;  3I55 P;  2W6B A;  4Z1M H;  4BRY B;  5L8R J;  2NPS B;  3H1K E;  3H1I E;  3O6Q B;  3H32 B;  1NO4 A;  3AE1 C;  1JMB A;  3LW5 J;  1RF1 A;  2HOD B;  2QIW A;  2KP8 A;  3IN6 A;  1EDK A;  1SQB K;  3RL0 B;  1GZL A;  1N86 B;  3G3Z A;  2W6J H;  1FZE A;  5C39 A;  1EXJ A;  4LLH A;  2QEX P;  1QX8 A;  2BCC D;  2HG5 D;  1VF5 D;  3E1I C;  1AQ5 A;  1L0N D;  1N7S A;  3A0H E;  3A0B E;  2JDI H;  5AW4 B;  5CCH C;  2P1J A;  1LWU C;  4W80 A;  2QJY C;  1T2K C;  2YIU C;  3BCC D;  3HD7 B;  2K9Y A;  3L70 E;  2ZYD A;  1Z3U A;  1L4A C;  2IBZ D;  2WSF H;  3KZI E;  3UIA A;  3CMA P;  2WSC H;  2O3J A;  3AE5 C;  5B66 H;  5CCH D;  5AVY B;  1NTM E;  1S5L X;  1S9K D;  2ZVN B;  3V6I A;  3D70 A;  2OQQ A;  2YXQ B;  4HH2 A;  3FXD A;  4N3Y B;  3L72 J;  1NTK D;  3KHU A;  2JKV A;  5E79 E;  2FKW B;  3VMY A;  5APT A;  1JM0 A;  1SQV K;  2KSJ A;  1HTL C;  2FYU J;  5TJH A;  1YHQ P;  1YYC A;  2Q9I C;  5B66 E;  2WSE H;  3L36 A;  3GG2 A;  1EDI A;  1GW4 A;  2Q7C A;  1RY3 A;  5KKZ B;  1X79 B;  3VOP A;  1FZD A;  3E1I B;  3CX5 D;  2I1J A;  2L5G B;  1JY3 O;  2KI7 B;  3H1I D;  4DZO A;  1A02 J;  3D6Y A;  1M1J C;  1NTZ E;  2J58 A;  3VP9 A;  3H1L G;  3RK3 C;  1SQB G;  3R4Y A;  4R4M A;  2YIU B;  1A02 F;  1BCC J;  2VRS A;  2A06 G;  1LT9 C;  3CWB J;  5KLV G;  1NTZ G;  1AA0 A;  3SWY A;  3VMZ A;  1N73 A;  1QVF O;  2OAR A;  2M3B A;  4C7N A;  3L72 G;  2WTY A;  3HE4 A;  3L74 E;  1MFZ A;  2MKV A;  1FZA A;  5APQ A;  1QL2 A;  3WMM 0;  4WBA A;  1YJ9 P;  1GK6 A;  1IFI A;  1KYO E;  1M1J B;  3RGU A;  5KLI C;  1GDT A;  2B88 A;  3B71 A;  2E75 B;  1SQP G;  5TIS H;  2WPS A;  4WY4 C;  2XZR A;  2BAS A;  3H1L J;  1NU1 G;  2J5U A;  4JBZ A;  2FXP A;  3AE4 C;  1S4X A;  4IFM A;  1BCC E;  2V4H A;  1L0N G;  3A0B H;  3C1L A;  4H13 D;  1Y8A A;  2W83 C;  1WT6 A;  2C0X A;  3H1K J;  3Q3D A;  1NTM G;  1Q82 Q;  1FZB A;  1URQ B;  2J1G A;  3RL0 g;  3TNU A;  1FZE B;  2A06 E;  4GOE A;  2IBZ G;  2IX7 C;  5AW1 B;  1MZ9 A;  2FYN C;  3H1H D;  2E76 B;  3CWB G;  1FZC A;  2AEF A;  2Q9I B;  4RKU J;  1RE4 A;  3P7K A;  2H7H A;  1NTK G;  3MZW B;  3E1R A;  3E7K A;  3S4R A;  4D6T J;  3CPW O;  5GTH E;  3MD0 A;  2IZ1 A;  2D2C B;  2O1J A;  1LTB C;  4EDF A;  1AVY A;  4R4L A;  2C0W A;  1N2D C;  2ITA A;  1JEK A;  3K5B A;  3L73 E;  5BU5 A;  1GL2 D;  3CXH I;  2RMZ A;  2Q9I A;  1FDM A;  2YO3 A;  1SP4 A;  4KT0 J;  1JCC A;  2J61 B;  3VMX A;  3PH0 A;  4IFD K;  1X22 A;  1JC9 A;  3H1I G;  1J1E C;  1J2J B;  1BE3 J;  4RO0 A;  2H88 C;  4GKG A;  1FID A;  1SQV J;  1IO4 A;  1LTI C;  2R44 A;  2QVA A;  2C9L Y;  1NTZ D;  1HJ0 A;  4QMA A;  1H88 A;  1RE4 C;  2H43 B;  2CK3 H;  3WU2 H;  4PV1 D;  1ZW0 A;  1LJ2 A;  2ZT9 D;  2GA1 A;  2Q6Q A;  1FJP A;  2J5Z A;  2PGD A;  2YNY A;  3CCS P;  5KLV K;  3TF5 A;  1T3U A;  4JYO X;  2WIT A;  3FX0 A;  1KQL A;  3CCR P;  4DJG A;  3L70 D;  5AVQ B;  2FFD A;  1XTC C;  2JWD A;  4WVZ A;  2ZT9 C;  3L74 D;  2E74 C;  2WSC J;  4NPD A;  3MTU E;  3BAS A;  5CHX A;  2OYI A;  5EFW B;  4I7Z C;  1SQB J;  4I1L A;  4UB8 H;  2IFM A;  2WPR A;  2H43 A;  4EYY Q;  3H32 C;  1QEX A;  4N6J A;  4W7Y A;  3VN0 A;  3TNU B;  1Q81 Q;  3RK3 D;  1FZC C;  1T6A A;  1URQ D;  2HLO B;  2QJY B;  1YQ4 C;  3H25 A;  2M5A B;  3ABV C;  3M91 A;  3V2P A;  3Q2Y A;  2E76 D;  1VQ9 P;  2KZI A;  1YIT P;  1LTJ A;  1LGH B;  2HFE D;  1KFN A;  1USE A;  1NU1 E;  1R5L A;  1SFC A;  3P8M C;  4IL6 X;  4YXD C;  1Z3S A;  2Z4E C;  4Y99 B;  4AQR D;  2ZT9 B;  5AVT B;  2H43 C;  1SQP J;  3OAK A;  2HLO A;  4PJ0 H;  2WT7 B;  1GW3 A;  1KB9 D;  3AEG C;  3TGU J;  1MUU A;  1CZQ A;  3V2Q A;  2WSS H;  1VQO P;  2R3C A;  3H1J D;  2YXR B;  2QE7 H;  5CCG D;  3TK1 A;  2N1T A;  5DJU B;  2QJP B;  1VQL P;  1LT1 A;  3A3Y B;  2Q5U A;  2P2U A;  1KZU B;  3NMD A;  2OTJ P;  4ZKU A;  2O1K A;  4L76 A;  2P7J A;  4N78 D;  2K1A A;  1FC2 C;  3PLN A;  1EZV E;  2A45 H;  1YTZ I;  1DEE G;  4JZC A;  3RK3 E;  1LTG C;  3RL0 D;  2FYN B;  1KB9 I;  3QH9 A;  2K3R A;  4L73 A;  4LC1 A;  1RHZ B;  4UB6 E;  1KTM A;  2ZYG A;  2GY7 A;  4R9J A;  4EPU A;  1RQV A;  4C7R A;  2PP6 A;  3NXS A;  3AE3 C;  3TSI A;  1KIL A;  4H0L D;  4ZMD A;  2E74 B;  3ITK A;  4RJT A;  2R5D A;  3L37 A;  3PTZ A;  4JF7 A;  3CCQ P;  2AEM A;  2POH A;  3AED C;  1JY3 N;  1LNQ A;  1FZG C;  2IBZ I;  3N4X A;  1OXZ A;  3V2R A;  1LTJ B;  4I7Z B;  3CC7 P;  1JO5 A;  1VQP P;  1BSN A;  3L74 G;  1EZV D;  3PP5 A;  1L0N K;  3TDK A;  1BGY J;  4YTP C;  1RF0 B;  1L4A B;  1FBM A;  5APX A;  3CX5 E;  2D39 A;  3D71 A;  1S1C X;  3L75 E;  1VQM P;  2A45 G;  1NHL A;  1M1K Q;  1SQQ E;  1K8A Q;  1KN7 A;  2KZJ A;  1PPJ D;  3A7O A;  5APU A;  4OVN F;  3CCV P;  3M06 A;  4IL6 H;  1IFN A;  1HF9 A;  3CI9 A;  2AXT H;  2HR3 A;  1YIJ P;  1P84 E;  1KQF B;  1FS0 E;  1LP1 B;  1JTH B;  3H1L D;  4H44 B;  1BCC G;  1HH0 A;  2CPB A;  2GUS A;  1RE3 B;  1RF1 C;  1SLQ A;  1VQ6 P;  2A06 D;  4XE5 B;  5DJT B;  2FYU K;  1M57 D;  2E75 D;  3E1I A;  4XA4 A;  2YO2 A;  1NH4 A;  2Q3I A;  5AW7 B;  1NTM J;  2BCC E;  4HYT B;  3RK3 B;  3RK2 B;  1EXI A;  3O6Q A;  2YKQ A;  4N78 E;  3L75 J;  3R2P A;  4BRY A;  1IFP A;  3RBX A;  2FXM A;  2M3E A;  2Y9Z A;  2IYP A;  1FZC B;  1OVR A;  2JHI F;  3LW5 H;  4GOD A;  3QWO C;  3VTP C;  1S72 P;  4BXL A;  3HE5 A;  4GIF A;  4UB8 E;  2W8Z A;  3CC2 P;  3CCE P;  1VF5 C;  3C9I A;  1FZG B;  4JYC A;  2B89 A;  3U1A A;  4OWF A;  1AQT A;  2E5Y A;  1NJI Q;  1VQK P;  1RQU A;  3EWK A;  1R8E A;  1NTK J;  1L0L E;  3FGA D;  5AW8 B;  1BDC A;  3MUD A;  1ZV8 A;  2QM7 A;  1L4A D;  1DD4 A;  2ZVO B;  2HPC A;  1G2C B;  3G4S P;  3CX5 H;  2B87 A;  3KQG A;  1K04 A;  2G8Y A;  4JQ0 D;  3B4S A;  2IYO A;  1LP1 A;  1JTH A;  1CI6 A;  2JJL A;  3HTK A;  3L75 D;  4JYB A;  4HJG H;  1KD1 Q;  2XNX C;  2J2P A;  1URQ A;  1SQV G;  3CX5 I;  4W7Z A;  2KLV A;  1W2E A;  1RE3 A;  2K9J B;  3L74 J;  4ASW A;  5KAF H;  2Q3E A;  2AXC A;  3C8V A;  1T8Z A;  2J3O A;  1FIC A;  1NTZ J;  2WVR A;  4M3L A;  2AXT E;  5CMZ A;  1UII A;  4L75 A;  5CCH A;  2WZ7 A;  3TYY A;  3G71 P;  1N7S C;  4L74 A;  5GTI H;  1FE6 A;  1CI6 B;  2WPQ A;  4D6T D;  1KB9 E;  1NWQ A;  3G6E P;  3PRJ A;  2BCC J;  5CBN A;  2E74 D;  1QVG O;  3MGN A;  5AVS B;  5AW9 B;  2N1T C;  1HVV A;  4PD4 H;  1L4A A;  1BCC D;  4OGQ B;  1FOS F;  1S2E A;  3JCU E;  1BGY G;  2QJK B;  3B8E B;  1FU1 A;  3WUV A;  4C7N B;  1X9V A;  1AJY A;  3S9O A;  4EOT A;  3V4W A;  1VQN P;  3CL3 D;  1AV1 A;  3MUD C;  3V5B A;  1BSH A;  1KIL E;  3L73 J;  4O9B A;  1PGP A;  1M8O B;  1SFC C;  4H13 B;  3OW2 O;  1FZA B;  2HOD C;  1H0T A;  5AVZ B;  2FIB A;  1GU4 A;  1VF5 B;  1K73 Q;  2IFN A;  2J3G A;  2J64 A;  1SFC D;  2J0Y A;  1HBW A;  1SQV E;  5AW6 B;  2YMK A;  5AVX B;  3KZI H;  2KNC A;  3B5N D;  2FFD B;  4IL6 E;  1N8R Q;  2PAJ A;  4H44 C;  1KYO D;  3IFM A;  4IOI H;  3PHL A; 
#chains in the Genus database with same CATH homology
 1LWU B;  2KB7 P;  1GW3 A;  1RF1 A;  1MUU A;  3BVH A;  1CZQ A;  2HOD B;  4WB4 A;  4WY4 A;  3V2Q A;  2KP8 A;  1J1E B;  1SQB K;  2R3C A;  3RL0 B;  1GZL A;  1DH3 A;  1N86 B;  1GK4 A;  3G3Z A;  5BU8 B;  1FZE A;  1IFD A;  5CCG D;  5AW3 B;  2JHM F;  3TK1 A;  2N1T A;  2IPP A;  1SQQ K;  4I6M C;  4LLH A;  2NPS A;  3RK2 C;  1LT9 A;  3A3Y B;  4OH8 B;  2Q5U A;  2J3U A;  3H32 A;  2P2U A;  2HG5 D;  1KZU B;  3NMD A;  3E1I C;  1AQ5 A;  2I1K A;  4ZKU A;  1N7L A;  5APY A;  2O1K A;  4KHX A;  1SVF A;  2P7J A;  4N78 D;  2OYI C;  3VP8 A;  1RF1 B;  1N7S A;  5AW4 B;  5CCH C;  2P1J A;  1LWU C;  4W80 A;  3NTN A;  1T2K C;  4NYT A;  3HUS C;  2A45 H;  1YTZ I;  4JZC A;  3HD7 B;  2J3F A;  1LTG C;  3RL0 D;  3OA7 A;  1X8Y A;  1NTK K;  4LC1 A;  1L4A C;  2WSF H;  3UIA A;  1Z3U A;  2OYI B;  2WSC H;  5CCG C;  5CCH D;  2H8P D;  5AVY B;  1T2K D;  2GY7 A;  2P67 A;  2XKM A;  3A2A A;  4R9J A;  1S9K D;  4EPU A;  1N86 A;  3H6P A;  1M7L A;  1GTW A;  4C7R A;  2PP6 A;  3KYQ A;  3NXS A;  4HH2 A;  1RF0 C;  2KOG A;  1GU5 A;  4N3Y B;  3TSI A;  1KIL A;  2J61 A;  3U59 A;  1DEB A;  1JOC A;  1GL2 C;  2FKW B;  3LID A;  3VMY A;  3HTK B;  2QM8 A;  1SQP K;  2YKO A;  3SWF A;  2HPC C;  2R5D A;  3L35 A;  3L37 A;  4JF7 A;  1JMM A;  5APT A;  2POH A;  3HUS B;  1PFI A;  1JY3 N;  1FZG C;  1SQV K;  1XTG B;  5AVU B;  3HE4 B;  2KSJ A;  1KFM A;  3KPE A;  1JNM A;  1HTL C;  3N4X A;  5KJ7 C;  1OXZ A;  3V2R A;  1YYC A;  2Q9I C;  5AW5 B;  1LTJ B;  1NKZ B;  4M7H A;  1URQ C;  1JO5 A;  1KIL D;  2M8R A;  2N9B A;  2WSE H;  3L36 A;  5AVR B;  5KJ7 A;  1GW4 A;  4AYC A;  2Q7C A;  1HJB A;  1RY3 A;  2Z5I A;  1NKN A;  3PP5 A;  1X79 B;  3VOP A;  1FZD A;  3E1I B;  1L0N K;  1NTM K;  1RF0 B;  1L4A B;  1FBM A;  5APX A;  2OYH B;  2YMY A;  2D39 A;  1LWU A;  2I1J A;  2XNX B;  3P8C D;  2L5G B;  1JY3 O;  2A45 G;  1NHL A;  2Z5H A;  4DZO A;  5APW A;  1A02 J;  1M1J C;  2J58 A;  1KIL C;  3VP9 A;  3RK3 C;  1E5W A;  2HPC B;  1A02 F;  1IFM A;  2VRS A;  3A7O A;  4ZFG A;  1N86 C;  3P32 A;  5APU A;  4I2L C;  3HRN A;  1LT9 C;  1IFJ A;  3BVH B;  5KJ7 D;  1JUN A;  1LTA C;  3M06 A;  3SWY A;  3VMZ A;  1IFN A;  1N73 A;  2OAR A;  3CI9 A;  2M3B A;  4C7N A;  2WTY A;  3HE4 A;  3U1C A;  4EIJ A;  1JTH B;  1HH0 A;  2GUS A;  2CPB A;  1MFZ A;  3KDP B;  2A45 I;  5APV A;  1RE3 B;  1RF1 C;  2N1T D;  1FZA A;  1SLQ A;  5APQ A;  5KTB A;  1VDF A;  1JCD A;  1QL2 A;  4XE5 B;  3WMM 0;  2FYU K;  3GHG B;  3B5N B;  1FZF B;  1VPC A;  1OWA A;  3E1I A;  4WBA A;  4XA4 A;  2YO2 A;  1NH4 A;  2E43 A;  2NPS C;  1ZLL A;  3M9B A;  2Q3I A;  1G1J A;  5AW7 B;  1GK6 A;  1IFI A;  5CJ0 A;  5CJ4 A;  1M1J B;  4HYT B;  3RK3 B;  2R32 A;  1FZE C;  1FZA C;  5AW2 B;  1GDT A;  3MIW A;  4C46 A;  3RK2 B;  1JY2 N;  1JY2 O;  1ZR4 A;  2YKQ A;  3M0A A;  2WPS A;  4WY4 C;  4N78 E;  1RE4 B;  3BVH C;  3R2P A;  3VYI A;  5BVZ A;  2XZR A;  2BAS A;  2HOD A;  3CLQ A;  1SFC B;  2FXM A;  1N7S D;  3V4Q A;  1N73 C;  1FZC B;  4IFM A;  2JHI F;  3LW5 H;  5APS A;  3VTP C;  2JHH C;  3P8C E;  3HE5 A;  2NPS D;  1FJK A;  2W27 A;  4GIF A;  1WT6 A;  2C0X A;  2GUV A;  1M1J A;  1FZB A;  1URQ B;  2J1G A;  3M9Q A;  2ZXE B;  3B5N C;  1FZF C;  1J1D C;  1G2C A;  3TNU A;  1FZE B;  2O01 H;  5AVV B;  2FFD C;  2IX7 C;  3C9I A;  3HD7 C;  5AW1 B;  1FZG B;  1MZ9 A;  4JYC A;  3U1A A;  1FZC A;  2J0H A;  1ZN5 A;  5AW0 B;  3EFG A;  2Q9I B;  3IR9 A;  3BRT B;  1RE4 A;  2LKM A;  3P7K A;  5AW8 B;  2H7H A;  4B86 A;  1CSB A;  3M0D C;  3OJA B;  1SQX K;  3MUD A;  1ZV8 A;  3RL0 C;  2QM7 A;  3FIB A;  1L4A D;  2W6A A;  1IJD B;  1EQ7 A;  2HPC A;  1G2C B;  1N73 B;  1FZB B;  2FYZ A;  4GT1 A;  3MD0 A;  3RK2 D;  2O1J A;  1YTZ T;  1Z56 A;  1LTB C;  3KQG A;  2C0W A;  3EQ2 A;  3HE5 B;  1N2D C;  1CW5 A;  1FIB A;  4RES B;  2Z4E B;  1JTH A;  1CI6 A;  2JJL A;  3HTK A;  2OYH C;  4JYB A;  4ZKP A;  1RE3 C;  2XNX C;  2J2P A;  5BU5 A;  1GL2 D;  1URQ A;  2Q9I A;  1FDM A;  2YO3 A;  1SP4 A;  4W7Z A;  2KLV A;  1KIL B;  1W2E A;  1J1D B;  2J60 A;  2C9N Y;  1NU1 K;  5CCG A;  2WT7 A;  1JCC A;  2J61 B;  1RE3 A;  2XDJ A;  4M7F A;  2MJZ A;  3II6 A;  3VMX A;  4IFD K;  1FZG A;  1JC9 A;  3BAT A;  1J1E C;  1J2J B;  4WY4 D;  1T8Z A;  2J3O A;  3HUS A;  1L0L K;  1FIC A;  4M3L A;  5CMZ A;  2E42 A;  2WWW A;  5CCH A;  2WZ7 A;  3A5T A;  3TYY A;  2JHL F;  4GKG A;  1GL2 A;  1FID A;  1N7S C;  1FAV A;  1IO4 A;  1LTI C;  2C9L Y;  1CI6 B;  1NAF A;  1RF0 A;  2WPQ A;  1NWQ A;  3M0D A;  3HD7 D;  2J3F D;  4LGD E;  1H88 A;  1RE4 C;  1LTT C;  3BRV B;  1IC2 A;  3O8Z A;  3LIE A;  4AUW A;  2H43 B;  1IK9 A;  3I5C A;  1FJP A;  2J5Z A;  1NOH A;  2YNY A;  1FOS E;  1N7S B;  5KLV K;  3MGN A;  5AVS B;  5AW9 B;  2N1T C;  1HVV A;  1T3U A;  2XNX A;  4JYO X;  1L4A A;  2WIT A;  2OYH A;  1WRG A;  1KQL A;  2CPS A;  1FOS F;  3L4F A;  2XV5 A;  2KYV A;  1G1I A;  3HD7 A;  1NTZ K;  2YKP A;  5AVQ B;  1HWT C;  2FFD A;  1QL1 A;  1JY2 P;  1HGZ A;  1XTC C;  4Y99 C;  1HGV A;  3B8E B;  1GL2 B;  1FU1 A;  3MTU E;  2J59 M;  3BAS A;  4C7N B;  1X9V A;  5AVW B;  2XU6 A;  1FZB C;  5CHX A;  2OYI A;  4EOT A;  1DX7 A;  3V4W A;  4DOJ A;  1S9K E;  2ZFC A;  3CL3 D;  4I1L A;  3V5B A;  1ZR2 A;  2IFM A;  3T97 A;  2WPR A;  2H43 A;  3NFQ A;  2GM4 A;  3H32 C;  4O9B A;  4N6J A;  4W7Y A;  3V2N A;  1SFC C;  3TNU B;  3VN0 A;  2R5B A;  1H8A A;  3GHG A;  1LTJ C;  2JHK F;  3RK3 D;  1FZC C;  4R9T A;  3M9H A;  1URQ D;  2HLO B;  2J0G A;  1FZA B;  2HOD C;  5AVZ B;  2FIB A;  4IFF A;  1GU4 A;  1H89 A;  1T3J A;  4WY4 B;  2IFN A;  1HUC A;  2J3G A;  2J64 A;  1SFC D;  3B5N A;  1FZF A;  3M91 A;  3V2P A;  2J0Y A;  1LTS C;  1HBW A;  2N1T B;  2HLO C;  1LTJ A;  5AW6 B;  1LGH B;  3GHG C;  2HFE D;  1KFN A;  5AVX B;  1AFO A;  1GD2 E;  1SFC A;  3B5N D;  2FFD B;  1JY3 P;  2W6B A;  3P8M C;  1MV8 A;  1Z3S A;  2HYN A;  2Z4E A;  2Z4E C;  4Y99 B;  2NPS B;  1LT9 B;  4AQR D;  3H32 B;  5AVT B;  2H43 C;  2PAJ A;  2JEE A;  1NO4 A;  3IFM A;  3OAK A;  2HLO A;  3N7N A;  2WT7 B;  2WNP F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...