3HUSB

Crystal structure of recombinant gamma n308k fibrinogen fragment d with the peptide ligand gly-pro-arg-pro-amide
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
303
structure length
303
Chain Sequence
TVNSNIPTNLRVLRSILENLRSKIQKLESDVSAQMEYCRTPCTVSCNIPVVSGKECEEIIRKGGETSEMYLIQPDSSVKPYRVYCDMNTENGGWTVIQNRQDGSVDFGRKWDPYKQGFGNVATNTDGKNYCGLPGEYWLGNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGGFTVQNEANKYQISVNKYRGTAGNALMDGASQLMGENRTMTIHNGMFFSTYDRDNDGWLTSDPRKQCSKEDGGGWWYNRCHAANPNGRYYWGGQYTWDMAKHGTDDGVVWMNWKGSWYSMRKMSMKIRPFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Blood clotting
molecule keywords Fibrinogen alpha chain
publication title Impaired protofibril formation in fibrinogen gammaN308K is due to altered D:D and "A:a" interactions.
pubmed doi rcsb
source organism Homo sapiens
total genus 75
structure length 303
sequence length 303
chains with identical sequence E
ec nomenclature
pdb deposition date 2009-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3husB01
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 3husB02
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 3husB03
1RF0A 1RE3C 2A45H 2A45G 1JY2O 1FZAB 1JY3P 1FZFC 1FZBA 1T3UA 1FZCB 1M1JB 1RE4B 2OYHB 1RF1C 3E1IB 1FZEC 1FZGB 2A45I 2FFDC 1FZCA 2HLOC 3HUSB 2J61A 2XNXA 1RE4A 2OYHA 3E1IA 2Q9IB 1FICA 2JHHC 1RE3B 2HPCC 2Q9IA 3GHGC 2H43C 1JY2P 4NYTA 3GHGB 2JHKF 1RF0C 1FZFB 2J5ZA 2J0YA 4R9JA 2HODC 1FZAA 1N73C 3H32C 2HODB 4M7HA 2J0GA 2OYIC 1FZFA 2J60A 1LT9C 3H32B 1M1JA 2J1GA 1FZBC 1RF1B 2J3FD 1FZEB 2J0HA 2FFDB 2HLOB 1Z3UA 1FZGA 2J3OA 3HUSA 1RF1A 1JY3N 2J3FA 2FFDA 3BVHC 1LTJC 1N86C 2JHMF 4ZFGA 2D39A 2HPCB 2XNXC 1LWUC 2Z4EC 1RE3A 2H43B 2J2PA 4JZCA 2HPCA 1RF0B 3GHGA 2H43A 1N73B 2OYIB 1FZDA 2GY7A 1LT9B 1FZBB 2HODA 1N73A 1JY2N 3H32A 1FZAC 3FIBA 1FZEA 2OYIA 1FIBA 1LT9A 2J3GA 2HLOA 1JY3O 4R9TA 1FZCC 1M1JC 3BVHB 1LTJB 1N86B 1Z3SA 2J3UA 4JYOX 4M7FA 1RE4C 2OYHC 4EPUA 2J61B 2XNXB 3E1IC 1LWUB 2J64A 2WNPF 1FZGC 2Z4EB 3HUSC 3BVHA 1LTJA 1N86A 1FIDA 1W2EA 2JHLF 2Q9IC 1LWUA 2Z4EA 2FIBA 2JHIF 1JC9A
chains in the Genus database with same CATH superfamily
2M5AB 1NU1J 3CD6P 3CCLP 1EDIA 1FAVA 1Q82Q 3AEDC 3H1KD 1SQXG 1QEXA 1SQQK 1RF1C 4QMAA 2R32A 3H1LE 1G1JA 3Q5RA 2Q9IB 1FICA 2P67A 3L71G 3QH9A 3QWOC 1VL2A 3L73G 1K04A 2Z5IA 1R5SA 3HE5A 5APXA 3S4RA 1RHZB 1OFCX 1FZFA 1L0NE 2B9BA 2JJLA 2QSIA 1NAFA 1VQ8P 5BU5A 3A0HH 2XNXC 1OVRA 4I6MC 2H43B 4JQ0D 3F5HA 4W80A 3LIDA 1ZRTD 1Q7YQ 5KLVJ 2KS1B 1GZLA 5B66H 5TJHA 2JR8A 4L76A 2OYIB 3B5NC 5KLVG 2ZYDA 1P84I 2E75B 2OTLP 1HF9A 1HGZA 2JHLF 1YYCA 3BCCJ 1KQLA 2AXTE 5APWA 5TISH 3BRVB 1VQ6P 3SWKA 1XTCC 3B4SA 3FWLA 1KC8Q 2LR2A 1SQQE 1M1JB 3MUDC 3H1KE 3D71A 2WVRA 1PP9E 3E1IB 1FZGB 2FKWB 2IBZD 1FZCA 3I56P 1ZV8A 2FXPA 2L5GB 2Q7CA 3IR9A 1OXZA 4PD4E 3SWYA 1PGQA 5B5EH 1EC5A 1PPJE 2J5UA 2FFDB 3PJSK 1EZVD 1JOCA 3NFQA 4U3FJ 3M0DA 3C8VA 1SQBJ 1KYOE 1LNQA 2HPCB 5AVYB 2N9YB 3FWNA 2Y0EA 4PJ0H 3VP9A 3GHGA 4GT1A 3CCMP 3U1CA 2OYOA 2N1TA 5CCGC 5CCGD 1GTWA 4IOIH 1ZRTE 3TSIA 4ZKPA 3W67A 3TF5A 2I8DA 3V2RA 2QVAA 3H1JE 3VMYA 3P8CD 3RBXA 3RBZA 4I7ZC 3VTPC 2K37A 1WT6A 2NZ2A 2J59M 2ZT9C 4Y99C 1E5WA 2V4HA 1OVUA 4GDOA 1K73Q 3CLQA 5KKZC 5CCHD 1SQPG 2FYUD 1PV3A 4OVNF 3BATA 3V2QA 1KILE 3PRJA 2KUBA 1JM0A 3MIWA 1FJPA 3CC7P 2OTJP 2BCCE 3FXEA 2WT7A 3W68A 2IBZE 1J1EC 2QJPB 4CPGA 3H1LJ 2V7QJ 1VQMP 5AW8B 1FC2C 3CCEP 5AVUB 4GOFA 1NTZD 1WMKA 2IZ0A 1NTZK 1QL2A 3CCJP 1RH5B 3OJAB 1L0NJ 1NAYA 2YO3A 4AYCA 1YBKA 5AW2B 3O8ZA 2J3FA 3L71D 4ZFGA 1FOSF 3CCRP 3FX0A 2Z4EC 3L73D 4JZCA 1KV4A 4GOEA 1MUUA 1CW5A 3L70E 4OGQC 4OGQD 4WWIA 4XA4A 2NPSA 3M91A 3H32A 3A7OA 1FIBA 2J3GA 1USDA 2KNCA 3M9BA 2FYZA 3TGUE 3KZIH 2XU6A 3HUSC 1N86A 5CHXA 2ZXXA 3IN6A 1DEEG 3HTKA 3AEGC 3RK2C 3L75D 3RK2D 2AXCA 1FZFC 2I1KA 3CXHH 1GL2B 2P10A 1M7LA 4R4LA 5AW0B 1SQQJ 2W8ZA 3PP5A 3O6QA 1RQUA 1KZUB 1JNMA 1PP9J 2XNXA 1KB9I 1BGYD 2BEZF 1SQQG 4Y28J 1EDLA 3GHGB 2N1TB 5GTHH 4YXDC 1NTZE 2D2CB 1LTTC 2QJYB 1IFJA 1BCCD 1OW7A 2J58A 1FZBC 3H1IG 1OX3A 2BASA 3IAOA 1PPJG 2WMMA 3AE4C 2IFNA 2WSEH 1JCCA 2FXOA 3SFDC 3VOPA 5KJ7D 1SS1A 3MUDA 3MD0A 4TT3H 4L74A 3H1JJ 3PHLA 1FZCC 3GW6A 5CMZA 1JTHB 2WT7B 2SPZA 2WNPF 3H1HJ 3L72E 4OWFA 2GA1A 3A5TA 4EI2A 1RE3C 3H1HG 3L75E 2RMZA 3USSA 4C7NB 5APVA 3WMM0 2Y0CA 3M0DC 3OA7A 2A45I 3EWKA 3PH0A 3VMAA 2BCCJ 2OYHA 5AVTB 1SQPD 1URQA 1NWQA 1ZP0C 1QL1A 3GHGC 2N1TC 4GODA 2N1TD 1RF0C 2D2CD 5AW3B 2J0YA 2IYPA 2NPSB 2J60A 3H32B 1RF1B 1LGHB 2KNCB 1IFMA 2KLVA 3NMDA 2OQQA 1DD4A 1U57A 1YJNP 3CWBD 5H2FE 2OARA 2E42A 4JYCA 1OWAA 3KXDA 3HTKB 2WSFJ 1L0LD 1SFCC 2C0WA 1QX8A 1GMJA 1OVVA 4KHXA 4IL6E 5KAFE 3EFGA 3L70J 1LTGC 1N73A 3V4QA 4L73A 1KFMA 3E7KA 1ZR4A 2WZ7A 1PL5A 3O6QB 1Y8AA 5DJTB 1HBWA 3L74D 2J3UA 3M0AA 3TGUJ 1OIPA 2XNXB 2W83C 5AVWB 3BRTB 3OW2O 1IFIA 3GMAA 2JHIF 3TGUG 5GTIE 3CC2P 4BRYA 1KQFB 3GLMA 2CPSA 1S1CX 2OTKE 2KLUA 3B5NB 1KYOI 1X9VA 1T3JA 1BE3E 1HH0A 1FZEC 1YHQP 3P8MC 3TNUA 3TDKA 1GDTA 1H0TA 2FYNC 3GF3A 2K88A 2ZVNB 1NU1G 5CJ4A 2A06E 1NTZJ 1MV8A 2NPSC 3H32C 2NPSD 3MHVA 2KP8A 3L36A 4H44B 2PGDA 5AVXB 2J3OA 2E76C 2E76D 3HUSA 4KT0J 1N86C 1SQVD 2W90A 1EXJA 1RY3A 5APUA 5KAIE 4N78D 1VQ9P 1LTSC 2JDIH 2W6JH 4EYYQ 1P84H 3CX5H 3KDPB 1L0LE 3VMZA 1FDIA 2IBZI 5APYA 4ZNCA 3ITKA 1NTMJ 4BXLA 3S9OA 1ZOYC 1VQ5P 4DCKA 3L74E 1X8YA 3CC4P 1HJ0A 3K5BA 1AVYA 1NVOA 1W2EA 2LXCB 2BEQD 3L72J 1NTMG 2O3JA 1LWUA 4D6TD 4HH2A 4WY4C 2VRSA 3B5ND 1EZVI 1FZBA 2O01N 4I7ZB 1YQ4C 3G3ZA 2ZT9B 1FOSE 4Y99B 2IZ1A 4H0LC 5KKZB 2GM4A 1RE4A 3GF7A 1S5LE 2WTYA 1Q90D 2K9JA 4RKUJ 3D6YA 4ZKUA 4HYTB 2E5TA 2YXQB 3BCCG 1HGVA 3HD7A 2J5ZA 1X79B 4H44C 1BDCA 4H44D 4UB6E 1ZN5A 4OH8B 3EFFK 2WPSA 3B8EB 1J1EB 5E79H 3CCUP 4I1LA 3N4XA 1AV1A 1RE3A 3LIEA 1HUCA 1LT1A 2KI7B 4BRYB 2WSSH 2HFED 3IFMA 3WU2H 4ZMDA 3FGAD 1FU1A 1JY3O 4DJGA 4GIFA 4UB8H 2OYHC 4U3FG 2Z4EB 2G8YA 1URQC 1SQBG 1FIDA 1TU3F 1H0TB 4RO0A 1RF0A 2B89A 1P84D 2R3CA 3CX5D 4C7RA 4OGQB 3JCUH 2JWDA 5L8RJ 1VQOP 2XZRA 2ZT9D 1BE3J 3HUSB 1W5CE 1BDDA 2W27A 5APSA 1VQ4P 2JHHC 1NTKD 1SFCA 2FYUK 3RK2B 2ZYGA 3SWFA 1M56D 3HE5B 1RQVA 3A0BE 2JHKF 1FZFB 1S2EA 2WSCJ 1N73C 3R4YA 2KK7A 2M0BA 2KXPB 3CPWO 2RKLA 4M3LA 1AQ5A 3TK1A 3RL0g 3ZDMA 1LTBC 1K05A 3MP7B 3H1LG 1SQXD 3RL0B 1GW3A 1NU1D 3CMEP 1GK6A 1W2BO 3AECC 2O01J 1SP4A 3AE3C 1FZBB 2HODA 3RK3C 2YMKA 1MZ9A 3EQ2A 1EZVE 2HR3A 1FZEA 1LT9A 5KAFH 4AUWA 5KLIC 2AEFA 1SLQA 2QJKB 1L0NG 4WBAA 2G3AA 1BSNA 2K9JB 3KYQA 4R4MA 2QRXA 4AQRD 1XTGB 3HD7B 2RN0A 3I5CA 1KB9H 2A45G 1KQGB 1Q81Q 3N7NA 1JY2O 3P8CE 1T3UA 5AW7B 1FZCB 1YITP 3Q1MA 1YI2P 3M9QA 3U1AA 3A0HE 2R5BA 2C9NY 2FYUE 1RE3B 5AW6B 3MGNA 3WUUA 2Q1KA 2P2UA 5B66E 3CCSP 3UIAA 2KZJA 4Z1MH 1NGMB 5KLVD 3E1RA 1ZLLA 3HE4A 3H1KJ 1DX7A 2B87A 2XV5A 2IPPA 3H1KG 2JHMF 1PP9G 1LWUC 4IFFA 5TISE 1KTMA 2V7QH 3RL0C 3RL0D 3V2PA 1RF0B 1T6AA 2KB7P 4WY4A 1JMBA 2Y9ZA 2GY7A 3V2NA 1UIIA 1J1DC 2ZYAA 1FBMA 2DW3A 2IX7C 2YIUC 2P58A 1M57D 2Q3EA 3S1KA 2QJKC 1QVGO 3L71E 4TLFA 1RE4C 2C0XA 2H89C 2L91A 2WQYC 3L73E 3BVHA 1LTJA 2QG4A 2WWWA 1SFCB 1NJIQ 4IFMA 3HD7C 3HD7D 2A45H 1M8OB 4XE5B 4O9BA 5B5EE 2E43A 2KOGA 1KILA 4U3FD 4YXWH 1OW8A 3Q2YA 4K3AA 2IFMA 1SQBD 3H1JG 4N3YB 4EIJA 2R44A 4PJ0E 3H6PA 1K8AQ 3JC22 1QLED 2Q9IA 4NYTA 2AXTH 1J2JB 3FXDA 2HODB 2Q3IA 1YJWP 1DD3A 1FZEB 1JMMA 1ZXGA 2LXBA 1BGYE 1ZW0A 1SQPK 4UB6H 2FYNB 2BCCG 2AEJA 2J2PA 2IBZG 2O1KA 3CXHD 3AE7C 4WVZA 2H43A 1BCCE 4C46A 1N7SC 1FZAC 1IC2A 4PD4H 2OYIA 5AVSB 2E76B 2PRRA 1N86B 3A2AA 1HJBA 4EOTA 1DEBA 4HKZH 2YKPA 1KYOH 3H1LD 1SFCD 1EZVG 1T2KC 1L0LK 3GG2A 1T2KD 1G1IA 3B71A 5CCHA 4DOJA 4NPFX 2H8PD 1JY3P 3HE4B 1L2PA 1PFIA 3L70G 2B87B 1JO5A 3TYYA 2QEXP 3AEEC 2HG5D 3T97A 4W7YA 3E1IA 1LTAC 2FYUJ 3C9IA 1JB0J 4WY4B 1AA0A 1VPCA 4A7PA 2HODC 2M3BA 3P7KA 1VQNP 1LT9C 3KZIE 2J1GA 2J3FD 3D6ZA 4H0LB 4H13C 1D7MA 1Z3UA 4H13D 1ZR2A 3Q5PA 2FFDA 1SQPE 4RJTA 5DJUB 2Q6QA 2K1AA 2HPCA 2I1JA 1S3JA 1U7JA 1IJDB 3CXHE 5AW1B 3AEFC 1IFNA 4LLHA 1KILB 2JO1A 1SQQD 1NTZG 1T8ZA 2CK3H 2QE7H 3G6EP 1PP9D 3CWBE 3L71J 1SQVK 4JYBA 4IFDK 1N7LA 3L73J 1E79H 2ITAA 2JKVA 4NPDA 5GTHE 2WSFH 1NYHA 5APTA 4PV1B 1HWTC 3H1ID 3RGUA 4DZOA 1PGOA 2YNYA 1USEA 4PD4D 1KORA 1NOHA 1CI6A 1FE6A 2WPRA 1PPJD 2OYHB 4L75A 1FDOA 2GUSA 2HLOC 2Z5HA 1URQB 1AJYA 4WB4A 1KYOD 2ZJSE 3AE6C 1OMIA 1NKNA 1JY2P 3L72G 1IZNB 1PGPA 1Y9BA 4WY4D 3L75J 1QGKB 1X22A 2MJZA 1M90Q 2W6BA 1MFZA 5CBNA 1OW6A 1JUNA 3L75G 4H0LD 2KZIA 3H1JD 1NH4A 3BVHC 1LTJC 3SFEC 3H1HD 1BGYJ 2D39A 2GUVA 4IL6X 3CX5I 2QA4P 3AEAC 2WPVB 1Y47A 3BASA 1Q86Q 3SSUA 4HJGH 4ASVA 3Q3DA 3V6IA 1BGYG 1N73B 4JF7A 3VYIA 1BCCJ 4LC1A 1KILC 1KILD 3KQGA 5KJ7A 3IF4A 5APQA 3L37A 4ASWA 4JYOX 4M7FA 1SQVE 1BCCG 1PIXA 3T97B 1H88A 2BCCD 1R8EA 3KPEA 4N78E 1IFDA 4KJMA 2Q9IC 4MN4C 3G9RA 4PV1C 4PV1D 3PLNA 4EDFA 1KN7A 3RK3B 3H1IE 4JPZB 4U7JA 1KQSO 5KLIB 1N2DC 3H25A 5K5GB 1ZMEC 1GL2A 3G71P 5KTBA 3TNUB 1URQD 4NPEA 1HVVA 2RH0A 1LTIC 5BVZA 2YKOA 4D6TE 2H43C 1N7SA 2Y0DA 2JEEA 1EQ7A 3V4WA 4YTPC 1R5LA 3WUVA 1FZAA 3L70D 2YXRB 2OYIC 2K9YA 5AW9B 4HB1A 2YMYA 3TGUD 1JY3N 4RESB 4LGDE 2E75C 2E75D 2QM8A 1SQPJ 1IK9A 1BE3G 1NTKK 4XFJA 2O1JA 3H1HE 5CCHC 3L4FA 2XDJA 2FXMA 1MFTA 2H88C 2QM7A 2KYVA 1IO4A 1VDFA 1CI6B 3P32A 2A06G 3AE9C 1M1JC 1DH3A 1HTLC 2E74B 1PGJA 1Z56A 3E1IC 1LWUB 2J64A 1FZGC 2B88A 2PFXA 3CWBJ 2CPBA 1JEKA 1JTHA 5CJ0A 1OZHA 2FBWC 1SQXK 1AQTA 3F89A 2FIBA 5H2FH 5AVQB 1NU1K 1L0LJ 1GU4A 1VQ7P 3CMAP 3Q5SA 3CL3D 1IFPA 3CWBG 1J1DB 3CI9A 3RK3D 4IL6H 2AEMA 2YIUB 1YJ9P 1L4AA 1L0LG 1LP1A 1S5LX 2XKMA 1BSHA 1RE4B 1AVOA 3L74J 4C7NA 2FFDC 1KD1Q 2HPCC 1LJ2A 3AE8C 1P84E 3L74G 3CX5E 2WSEJ 3NXSA 3OAKA 1K9MQ 3I55P 1S4XA 3U59A 2HYNA 5GTIH 3AE2C 3VMXA 4R9JA 3V5BA 2WITA 4M7HA 2N9BA 4I2LC 2J0HA 1NTMD 1EXIA 1RF1A 1NTMK 3M9HA 1NTKE 4N6JA 3L72D 2R5DA 5KLVK 3MZWB 2PP6A 2QIWA 1NO4A 2C9LY 4K35A 2POHA 5AVVB 2WSCH 1G2CA 2KIKA 1JY2N 3FIBA 1M1KQ 3MTUE 1VF5B 2HLOA 4R9TA 2E74C 2E74D 4EPUA 5M1BA 3BCCD 3PTZA 3JSVC 1SQVJ 2OGUA 1PZQA 2QJPC 1SQXE 2JP3A 2ZXEB 1NU1E 1S9KD 1GK4A 5KAIH 3CCQP 2PAJA 1N7SB 1SQVG 2M8RA 1NHLA 1FZAB 2O01H 3RK3E 2E5YA 3C1LA 3H1IJ 1FDMA 1FS0E 2KSJA 1Q2NA 4W7ZA 3B5NA 5E79E 3A3YB 1VQLP 4BWNA 5AW5B 2J61A 2IDBA 3LW5J 1AFOA 3HRNA 3CXHI 2M5AA 4D6TJ 1YIJP 3WU2E 1GW4A 1H89A 2XNDH 1WRGA 1MKMA 1N8RQ 4GKGA 4D6TG 1VQPP 5KJ7C 4UB8E 1SQBK 1NTME 1EDJA 3D70A 2UWJE 1CZQA 1S5LH 1KB9D 5BU8B 4B86A 2ZVOB 1KMIZ 5KLVE 2YKQA 4JBZA 3AE5C 3JCUE 1FZDA 1LT9B 1L4AB 2MKVA 4H13B 1LP1B 1VF5C 1VF5D 1GL2C 3CCVP 3WUTA 2K3RA 1GL2D 1BE3D 1CSBA 3VP8A 2M3EA 3BCCE 1YTZT 3KHUA 1H8AA 1A02F 2KSEA 2NRGA 1S9KE 1N7SD 5CBOA 2KS1A 2Q5UA 1JCDA 5CCGA 1EDKA 2D2CC 2A06D 1QVFO 3L35A 2QJYC 5C39A 3M06A 1GU5A 3AE1C 5AW4B 3II6A 2FY8A 3VN0A 1A02J 2WPQA 3LW5H 1SVFA 2P7JA 3AEBC 1UIXA 1NKZB 4DT0A 1L0ND 1G2CB 1GD2E 2J0GA 4U3FE 1M1JA 1X0TA 2LKMA 1IK7A 1L0NK 1YTZI 1JC9A 5AVZB 2HLOB 1SQBE 4YPCA 1FZGA 2YO2A 5EFWB 5AVRB 1NTKJ 2P1JA 3NTNA 2JWAA 1KB9E 2IYOA 1FJKA 3ABVC 2FYUG 4PD4I 3A0BH 1NTKG 1L4AC 1U7MA 1L4AD 2R3SA 2Y9YA 2H7HA 2W6AA 2ZAEB 1VQKP 3BVHB 1LTJB 1Z3SA 3R2PA 2ZFCA 2J61B 1KFNA 1S72P 2Z4EA 3G4SP 1YQ3C 1SQXJ 1DIPA
chains in the Genus database with same CATH topology
1RE3C 1XTGB 3HD7B 1FAVA 3I5CA 2A45G 3N7NA 1JY2O 3RK3B 3P8CE 1T3UA 1SQQK 4C7NB 5AW7B 5APVA 3WMM0 1FZCB 3M9QA 3U1AA 1N2DC 3M0DC 1GL2A 1RF1C 5KTBA 3TNUB 3OA7A 1URQD 2A45I 2R5BA 2OYHA 2R32A 2C9NY 1G1JA 5AVTB 2Q9IB 1HVVA 1FICA 2P67A 1URQA 1LTIC 1NWQA 1RE3B 5AW6B 3MGNA 5BVZA 2YKOA 1QL1A 2P2UA 3GHGC 2H43C 3UIAA 2N1TC 2N1TD 1N7SA 2Z5IA 1RF0C 5AW3B 2JEEA 1EQ7A 1ZLLA 3V4WA 2J0YA 3HE5A 1FZAA 3HE4A 5APXA 2NPSB 2OYIC 1FZFA 2J60A 3H32B 1RF1B 2JJLA 1DX7A 1LGHB 1NAFA 1IFMA 2KLVA 5AW9B 2YMYA 5BU5A 2XV5A 3NMDA 1JY3N 4RESB 2IPPA 4LGDE 2JHMF 2QM8A 1IK9A 1NTKK 2XNXC 4I6MC 1LWUC 4IFFA 2OARA 2E42A 2O1JA 4JYCA 2H43B 3RL0C 1OWAA 3RL0D 3V2PA 4W80A 3HTKB 1SFCC 2C0WA 3LIDA 1RF0B 5CCHC 2KB7P 3L4FA 2XDJA 4WY4A 4KHXA 1GZLA 2FXMA 3EFGA 2QM7A 2OYIB 2GY7A 3V2NA 1J1DC 1LTGC 2KYVA 1IO4A 1N73A 1FBMA 1VDFA 3V4QA 3B5NC 1KFMA 2IX7C 1ZR4A 1CI6B 2WZ7A 3P32A 1M1JC 1DH3A 1HBWA 2J3UA 3M0AA 1RE4C 1HTLC 1Z56A 1HGZA 2XNXB 1LWUB 2J64A 2C0XA 3E1IC 1FZGC 5AVWB 3BVHA 1LTJA 2CPBA 1JTHA 5CJ0A 2WWWA 2JHLF 1YYCA 1KQLA 1SFCB 3BRTB 4IFMA 1IFIA 1SQXK 2FIBA 2JHIF 5APWA 5AVQB 1NU1K 1GU4A 3HD7C 3BRVB 3HD7D 2A45H 3CL3D 1XTCC 1J1DB 4XE5B 2CPSA 3CI9A 3RK3D 4O9BA 2E43A 3B5NB 1L4AA 1X9VA 2KOGA 1T3JA 1KILA 2XKMA 1M1JB 1RE4B 3E1IB 1HH0A 4C7NA 1FZEC 2FKWB 2FFDC 1FZGB 1FZCA 2IFMA 4N3YB 3P8MC 4EIJA 1ZV8A 3TNUA 1GDTA 2HPCC 3H6PA 2L5GB 2Q9IA 2Q7CA 4NYTA 3NXSA 3OAKA 3IR9A 1OXZA 3U59A 1J2JB 2HYNA 3VMXA 4R9JA 5CJ4A 3V5BA 1MV8A 2NPSC 3H32C 2NPSD 2WITA 3SWYA 2HODB 2N9BA 4M7HA 2KP8A 3L36A 2Q3IA 1FZEB 4I2LC 2FFDB 2J0HA 3NFQA 1JOCA 5AVXB 1JMMA 2J3OA 3M0DA 3HUSA 1RF1A 1NTMK 3M9HA 1N86C 1SQPK 2HPCB 5AVYB 1RY3A 5APUA 4N6JA 4N78D 2J2PA 1LTSC 2R5DA 2O1KA 3VP9A 5KLVK 3GHGA 4GT1A 3U1CA 3KDPB 2H43A 2N1TA 5CCGC 2PP6A 3VMZA 5CCGD 1GTWA 1NO4A 2C9LY 3TSIA 1N7SC 4C46A 4ZKPA 2POHA 5AVVB 3V2RA 2WSCH 1G2CA 1JY2N 3VMYA 1FZAC 3P8CD 5APYA 3FIBA 1IC2A 2OYIA 3MTUE 5AVSB 2HLOA 3VTPC 4R9TA 1WT6A 1N86B 3A2AA 2J59M 1HJBA 4EPUA 1E5WA 4Y99C 4EOTA 1DEBA 1X8YA 2YKPA 3CLQA 1SFCD 1W2EA 5CCHD 1LWUA 1T2KC 2ZXEB 1S9KD 1L0LK 1T2KD 1G1IA 1GK4A 2PAJA 1N7SB 5CCHA 2M8RA 4DOJA 3BATA 3V2QA 1NHLA 4HH2A 4WY4C 2VRSA 3B5ND 2H8PD 1FZAB 2O01H 1JY3P 1FZBA 3HE4B 1PFIA 3G3ZA 1FDMA 3MIWA 2KSJA 4W7ZA 3B5NA 1FJPA 3A3YB 1JO5A 1FOSE 4Y99B 5AW5B 3TYYA 2WT7A 2J61A 2HG5D 3T97A 2GM4A 1RE4A 4W7YA 1J1EC 2WTYA 3E1IA 1AFOA 3HRNA 5AW8B 4ZKUA 1LTAC 4HYTB 3C9IA 5AVUB 1HGVA 3HD7A 4WY4B 1GW4A 1H89A 1VPCA 2J5ZA 1NTZK 1QL2A 1WRGA 2HODC 2M3BA 3P7KA 1X79B 3OJAB 4GKGA 1LT9C 1ZN5A 4OH8B 5KJ7C 2J1GA 2J3FD 2YO3A 4AYCA 1Z3UA 1ZR2A 1SQBK 2WPSA 5AW2B 3O8ZA 3B8EB 1J1EB 2J3FA 2FFDA 4ZFGA 1FOSF 4I1LA 1CZQA 3N4XA 2Z4EC 1RE3A 5BU8B 3LIEA 4JZCA 4B86A 2HPCA 1HUCA 2I1JA 2YKQA 1MUUA 1CW5A 1IJDB 5AW1B 2HFED 3IFMA 1FZDA 1LT9B 1L4AB 4XA4A 1IFNA 1FU1A 2NPSA 3M91A 3H32A 4LLHA 1KILB 3A7OA 1GL2C 1T8ZA 1FIBA 2J3GA 1GL2D 3M9BA 1JY3O 2FYZA 4GIFA 2XU6A 2OYHC 1CSBA 4JYBA 1SQVK 3VP8A 2Z4EB 4IFDK 1URQC 3HUSC 1N86A 1FIDA 1YTZT 1N7LA 5CHXA 1H8AA 1A02F 3HTKA 1RF0A 3RK2C 2R3CA 2WSFH 1N7SD 4C7RA 1S9KE 3RK2D 5APTA 1HWTC 2Q5UA 1JCDA 5CCGA 4DZOA 1FZFC 2I1KA 1GL2B 1M7LA 2YNYA 3L35A 5AW0B 1NOHA 1CI6A 3PP5A 2XZRA 2WPRA 2OYHB 1KZUB 1JNMA 3M06A 1GU5A 2GUSA 5AW4B 2Z5HA 2HLOC 1URQB 3HUSB 3II6A 4WB4A 2XNXA 2W27A 5APSA 2JHHC 1SFCA 3VN0A 2FYUK 3RK2B 3SWFA 1NKNA 3HE5B 1A02J 1JY2P 2WPQA 3LW5H 4WY4D 3GHGB 1SVFA 2JHKF 2N1TB 2P7JA 2MJZA 1FZFB 1NKZB 1LTTC 2W6BA 1N73C 1MFZA 1IFJA 1G2CB 1GD2E 1JUNA 2J0GA 2J58A 1M1JA 2LKMA 1FZBC 1L0NK 1YTZI 5AVZB 4M3LA 2HLOB 1AQ5A 1NH4A 1FZGA 2BASA 3TK1A 3BVHC 1LTJC 2YO2A 1LTBC 2D39A 2GUVA 5AVRB 2P1JA 3NTNA 3BASA 3RL0B 2IFNA 1GW3A 1GK6A 1FJKA 2WSEH 1JCCA 1N73B 3VOPA 4JF7A 1L4AC 5KJ7D 1SP4A 3VYIA 1L4AD 4LC1A 1FZBB 3MUDA 1KILC 2H7HA 2HODA 1KILD 2W6AA 3MD0A 3RK3C 1MZ9A 3EQ2A 1FZEA 1LT9A 3KQGA 5KJ7A 4AUWA 1FZCC 5APQA 1SLQA 3BVHB 1LTJB 3L37A 3R2PA 5CMZA 1Z3SA 4JYOX 1JTHB 2WT7B 2ZFCA 4M7FA 2J61B 1H88A 2WNPF 3KPEA 1KFNA 4WBAA 4N78E 3KYQA 1IFDA 2Q9IC 2Z4EA 4AQRD 3A5TA 1JC9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RF0 A;  1RE3 C;  2A45 H;  2A45 G;  1JY2 O;  1FZA B;  1JY3 P;  1FZF C;  1FZB A;  1T3U A;  1FZC B;  1M1J B;  1RE4 B;  2OYH B;  1RF1 C;  3E1I B;  1FZE C;  1FZG B;  2A45 I;  2FFD C;  1FZC A;  2HLO C;  3HUS B;  2J61 A;  2XNX A;  1RE4 A;  2OYH A;  3E1I A;  2Q9I B;  1FIC A;  2JHH C;  1RE3 B;  2HPC C;  2Q9I A;  3GHG C;  2H43 C;  1JY2 P;  4NYT A;  3GHG B;  2JHK F;  1RF0 C;  1FZF B;  2J5Z A;  2J0Y A;  4R9J A;  2HOD C;  1FZA A;  1N73 C;  3H32 C;  2HOD B;  4M7H A;  2J0G A;  2OYI C;  1FZF A;  2J60 A;  1LT9 C;  3H32 B;  1M1J A;  2J1G A;  1FZB C;  1RF1 B;  2J3F D;  1FZE B;  2J0H A;  2FFD B;  2HLO B;  1Z3U A;  1FZG A;  2J3O A;  3HUS A;  1RF1 A;  1JY3 N;  2J3F A;  2FFD A;  3BVH C;  1LTJ C;  1N86 C;  2JHM F;  4ZFG A;  2D39 A;  2HPC B;  2XNX C;  1LWU C;  2Z4E C;  1RE3 A;  2H43 B;  2J2P A;  4JZC A;  2HPC A;  1RF0 B;  3GHG A;  2H43 A;  1N73 B;  2OYI B;  1FZD A;  2GY7 A;  1LT9 B;  1FZB B;  2HOD A;  1N73 A;  1JY2 N;  3H32 A;  1FZA C;  3FIB A;  1FZE A;  2OYI A;  1FIB A;  1LT9 A;  2J3G A;  2HLO A;  1JY3 O;  4R9T A;  1FZC C;  1M1J C;  3BVH B;  1LTJ B;  1N86 B;  1Z3S A;  2J3U A;  4JYO X;  4M7F A;  1RE4 C;  2OYH C;  4EPU A;  2J61 B;  2XNX B;  3E1I C;  1LWU B;  2J64 A;  2WNP F;  1FZG C;  2Z4E B;  3HUS C;  3BVH A;  1LTJ A;  1N86 A;  1FID A;  1W2E A;  2JHL F;  2Q9I C;  1LWU A;  2Z4E A;  2FIB A;  2JHI F;  1JC9 A; 
#chains in the Genus database with same CATH topology
 2M5A B;  1NU1 J;  3CD6 P;  3CCL P;  1EDI A;  1FAV A;  1Q82 Q;  3AED C;  3H1K D;  1SQX G;  1QEX A;  1SQQ K;  1RF1 C;  4QMA A;  2R32 A;  3H1L E;  1G1J A;  3Q5R A;  2Q9I B;  1FIC A;  2P67 A;  3L71 G;  3QH9 A;  3QWO C;  1VL2 A;  3L73 G;  1K04 A;  2Z5I A;  1R5S A;  3HE5 A;  5APX A;  3S4R A;  1RHZ B;  1OFC X;  1FZF A;  1L0N E;  2B9B A;  2JJL A;  2QSI A;  1NAF A;  1VQ8 P;  5BU5 A;  3A0H H;  2XNX C;  1OVR A;  4I6M C;  2H43 B;  4JQ0 D;  3F5H A;  4W80 A;  3LID A;  1ZRT D;  1Q7Y Q;  5KLV J;  2KS1 B;  1GZL A;  5B66 H;  5TJH A;  2JR8 A;  4L76 A;  2OYI B;  3B5N C;  5KLV G;  2ZYD A;  1P84 I;  2E75 B;  2OTL P;  1HF9 A;  1HGZ A;  2JHL F;  1YYC A;  3BCC J;  1KQL A;  2AXT E;  5APW A;  5TIS H;  3BRV B;  1VQ6 P;  3SWK A;  1XTC C;  3B4S A;  3FWL A;  1KC8 Q;  2LR2 A;  1SQQ E;  1M1J B;  3MUD C;  3H1K E;  3D71 A;  2WVR A;  1PP9 E;  3E1I B;  1FZG B;  2FKW B;  2IBZ D;  1FZC A;  3I56 P;  1ZV8 A;  2FXP A;  2L5G B;  2Q7C A;  3IR9 A;  1OXZ A;  4PD4 E;  3SWY A;  1PGQ A;  5B5E H;  1EC5 A;  1PPJ E;  2J5U A;  2FFD B;  3PJS K;  1EZV D;  1JOC A;  3NFQ A;  4U3F J;  3M0D A;  3C8V A;  1SQB J;  1KYO E;  1LNQ A;  2HPC B;  5AVY B;  2N9Y B;  3FWN A;  2Y0E A;  4PJ0 H;  3VP9 A;  3GHG A;  4GT1 A;  3CCM P;  3U1C A;  2OYO A;  2N1T A;  5CCG C;  5CCG D;  1GTW A;  4IOI H;  1ZRT E;  3TSI A;  4ZKP A;  3W67 A;  3TF5 A;  2I8D A;  3V2R A;  2QVA A;  3H1J E;  3VMY A;  3P8C D;  3RBX A;  3RBZ A;  4I7Z C;  3VTP C;  2K37 A;  1WT6 A;  2NZ2 A;  2J59 M;  2ZT9 C;  4Y99 C;  1E5W A;  2V4H A;  1OVU A;  4GDO A;  1K73 Q;  3CLQ A;  5KKZ C;  5CCH D;  1SQP G;  2FYU D;  1PV3 A;  4OVN F;  3BAT A;  3V2Q A;  1KIL E;  3PRJ A;  2KUB A;  1JM0 A;  3MIW A;  1FJP A;  3CC7 P;  2OTJ P;  2BCC E;  3FXE A;  2WT7 A;  3W68 A;  2IBZ E;  1J1E C;  2QJP B;  4CPG A;  3H1L J;  2V7Q J;  1VQM P;  5AW8 B;  1FC2 C;  3CCE P;  5AVU B;  4GOF A;  1NTZ D;  1WMK A;  2IZ0 A;  1NTZ K;  1QL2 A;  3CCJ P;  1RH5 B;  3OJA B;  1L0N J;  1NAY A;  2YO3 A;  4AYC A;  1YBK A;  5AW2 B;  3O8Z A;  2J3F A;  3L71 D;  4ZFG A;  1FOS F;  3CCR P;  3FX0 A;  2Z4E C;  3L73 D;  4JZC A;  1KV4 A;  4GOE A;  1MUU A;  1CW5 A;  3L70 E;  4OGQ C;  4OGQ D;  4WWI A;  4XA4 A;  2NPS A;  3M91 A;  3H32 A;  3A7O A;  1FIB A;  2J3G A;  1USD A;  2KNC A;  3M9B A;  2FYZ A;  3TGU E;  3KZI H;  2XU6 A;  3HUS C;  1N86 A;  5CHX A;  2ZXX A;  3IN6 A;  1DEE G;  3HTK A;  3AEG C;  3RK2 C;  3L75 D;  3RK2 D;  2AXC A;  1FZF C;  2I1K A;  3CXH H;  1GL2 B;  2P10 A;  1M7L A;  4R4L A;  5AW0 B;  1SQQ J;  2W8Z A;  3PP5 A;  3O6Q A;  1RQU A;  1KZU B;  1JNM A;  1PP9 J;  2XNX A;  1KB9 I;  1BGY D;  2BEZ F;  1SQQ G;  4Y28 J;  1EDL A;  3GHG B;  2N1T B;  5GTH H;  4YXD C;  1NTZ E;  2D2C B;  1LTT C;  2QJY B;  1IFJ A;  1BCC D;  1OW7 A;  2J58 A;  1FZB C;  3H1I G;  1OX3 A;  2BAS A;  3IAO A;  1PPJ G;  2WMM A;  3AE4 C;  2IFN A;  2WSE H;  1JCC A;  2FXO A;  3SFD C;  3VOP A;  5KJ7 D;  1SS1 A;  3MUD A;  3MD0 A;  4TT3 H;  4L74 A;  3H1J J;  3PHL A;  1FZC C;  3GW6 A;  5CMZ A;  1JTH B;  2WT7 B;  2SPZ A;  2WNP F;  3H1H J;  3L72 E;  4OWF A;  2GA1 A;  3A5T A;  4EI2 A;  1RE3 C;  3H1H G;  3L75 E;  2RMZ A;  3USS A;  4C7N B;  5APV A;  3WMM 0;  2Y0C A;  3M0D C;  3OA7 A;  2A45 I;  3EWK A;  3PH0 A;  3VMA A;  2BCC J;  2OYH A;  5AVT B;  1SQP D;  1URQ A;  1NWQ A;  1ZP0 C;  1QL1 A;  3GHG C;  2N1T C;  4GOD A;  2N1T D;  1RF0 C;  2D2C D;  5AW3 B;  2J0Y A;  2IYP A;  2NPS B;  2J60 A;  3H32 B;  1RF1 B;  1LGH B;  2KNC B;  1IFM A;  2KLV A;  3NMD A;  2OQQ A;  1DD4 A;  1U57 A;  1YJN P;  3CWB D;  5H2F E;  2OAR A;  2E42 A;  4JYC A;  1OWA A;  3KXD A;  3HTK B;  2WSF J;  1L0L D;  1SFC C;  2C0W A;  1QX8 A;  1GMJ A;  1OVV A;  4KHX A;  4IL6 E;  5KAF E;  3EFG A;  3L70 J;  1LTG C;  1N73 A;  3V4Q A;  4L73 A;  1KFM A;  3E7K A;  1ZR4 A;  2WZ7 A;  1PL5 A;  3O6Q B;  1Y8A A;  5DJT B;  1HBW A;  3L74 D;  2J3U A;  3M0A A;  3TGU J;  1OIP A;  2XNX B;  2W83 C;  5AVW B;  3BRT B;  3OW2 O;  1IFI A;  3GMA A;  2JHI F;  3TGU G;  5GTI E;  3CC2 P;  4BRY A;  1KQF B;  3GLM A;  2CPS A;  1S1C X;  2OTK E;  2KLU A;  3B5N B;  1KYO I;  1X9V A;  1T3J A;  1BE3 E;  1HH0 A;  1FZE C;  1YHQ P;  3P8M C;  3TNU A;  3TDK A;  1GDT A;  1H0T A;  2FYN C;  3GF3 A;  2K88 A;  2ZVN B;  1NU1 G;  5CJ4 A;  2A06 E;  1NTZ J;  1MV8 A;  2NPS C;  3H32 C;  2NPS D;  3MHV A;  2KP8 A;  3L36 A;  4H44 B;  2PGD A;  5AVX B;  2J3O A;  2E76 C;  2E76 D;  3HUS A;  4KT0 J;  1N86 C;  1SQV D;  2W90 A;  1EXJ A;  1RY3 A;  5APU A;  5KAI E;  4N78 D;  1VQ9 P;  1LTS C;  2JDI H;  2W6J H;  4EYY Q;  1P84 H;  3CX5 H;  3KDP B;  1L0L E;  3VMZ A;  1FDI A;  2IBZ I;  5APY A;  4ZNC A;  3ITK A;  1NTM J;  4BXL A;  3S9O A;  1ZOY C;  1VQ5 P;  4DCK A;  3L74 E;  1X8Y A;  3CC4 P;  1HJ0 A;  3K5B A;  1AVY A;  1NVO A;  1W2E A;  2LXC B;  2BEQ D;  3L72 J;  1NTM G;  2O3J A;  1LWU A;  4D6T D;  4HH2 A;  4WY4 C;  2VRS A;  3B5N D;  1EZV I;  1FZB A;  2O01 N;  4I7Z B;  1YQ4 C;  3G3Z A;  2ZT9 B;  1FOS E;  4Y99 B;  2IZ1 A;  4H0L C;  5KKZ B;  2GM4 A;  1RE4 A;  3GF7 A;  1S5L E;  2WTY A;  1Q90 D;  2K9J A;  4RKU J;  3D6Y A;  4ZKU A;  4HYT B;  2E5T A;  2YXQ B;  3BCC G;  1HGV A;  3HD7 A;  2J5Z A;  1X79 B;  4H44 C;  1BDC A;  4H44 D;  4UB6 E;  1ZN5 A;  4OH8 B;  3EFF K;  2WPS A;  3B8E B;  1J1E B;  5E79 H;  3CCU P;  4I1L A;  3N4X A;  1AV1 A;  1RE3 A;  3LIE A;  1HUC A;  1LT1 A;  2KI7 B;  4BRY B;  2WSS H;  2HFE D;  3IFM A;  3WU2 H;  4ZMD A;  3FGA D;  1FU1 A;  1JY3 O;  4DJG A;  4GIF A;  4UB8 H;  2OYH C;  4U3F G;  2Z4E B;  2G8Y A;  1URQ C;  1SQB G;  1FID A;  1TU3 F;  1H0T B;  4RO0 A;  1RF0 A;  2B89 A;  1P84 D;  2R3C A;  3CX5 D;  4C7R A;  4OGQ B;  3JCU H;  2JWD A;  5L8R J;  1VQO P;  2XZR A;  2ZT9 D;  1BE3 J;  3HUS B;  1W5C E;  1BDD A;  2W27 A;  5APS A;  1VQ4 P;  2JHH C;  1NTK D;  1SFC A;  2FYU K;  3RK2 B;  2ZYG A;  3SWF A;  1M56 D;  3HE5 B;  1RQV A;  3A0B E;  2JHK F;  1FZF B;  1S2E A;  2WSC J;  1N73 C;  3R4Y A;  2KK7 A;  2M0B A;  2KXP B;  3CPW O;  2RKL A;  4M3L A;  1AQ5 A;  3TK1 A;  3RL0 g;  3ZDM A;  1LTB C;  1K05 A;  3MP7 B;  3H1L G;  1SQX D;  3RL0 B;  1GW3 A;  1NU1 D;  3CME P;  1GK6 A;  1W2B O;  3AEC C;  2O01 J;  1SP4 A;  3AE3 C;  1FZB B;  2HOD A;  3RK3 C;  2YMK A;  1MZ9 A;  3EQ2 A;  1EZV E;  2HR3 A;  1FZE A;  1LT9 A;  5KAF H;  4AUW A;  5KLI C;  2AEF A;  1SLQ A;  2QJK B;  1L0N G;  4WBA A;  2G3A A;  1BSN A;  2K9J B;  3KYQ A;  4R4M A;  2QRX A;  4AQR D;  1XTG B;  3HD7 B;  2RN0 A;  3I5C A;  1KB9 H;  2A45 G;  1KQG B;  1Q81 Q;  3N7N A;  1JY2 O;  3P8C E;  1T3U A;  5AW7 B;  1FZC B;  1YIT P;  3Q1M A;  1YI2 P;  3M9Q A;  3U1A A;  3A0H E;  2R5B A;  2C9N Y;  2FYU E;  1RE3 B;  5AW6 B;  3MGN A;  3WUU A;  2Q1K A;  2P2U A;  5B66 E;  3CCS P;  3UIA A;  2KZJ A;  4Z1M H;  1NGM B;  5KLV D;  3E1R A;  1ZLL A;  3HE4 A;  3H1K J;  1DX7 A;  2B87 A;  2XV5 A;  2IPP A;  3H1K G;  2JHM F;  1PP9 G;  1LWU C;  4IFF A;  5TIS E;  1KTM A;  2V7Q H;  3RL0 C;  3RL0 D;  3V2P A;  1RF0 B;  1T6A A;  2KB7 P;  4WY4 A;  1JMB A;  2Y9Z A;  2GY7 A;  3V2N A;  1UII A;  1J1D C;  2ZYA A;  1FBM A;  2DW3 A;  2IX7 C;  2YIU C;  2P58 A;  1M57 D;  2Q3E A;  3S1K A;  2QJK C;  1QVG O;  3L71 E;  4TLF A;  1RE4 C;  2C0X A;  2H89 C;  2L91 A;  2WQY C;  3L73 E;  3BVH A;  1LTJ A;  2QG4 A;  2WWW A;  1SFC B;  1NJI Q;  4IFM A;  3HD7 C;  3HD7 D;  2A45 H;  1M8O B;  4XE5 B;  4O9B A;  5B5E E;  2E43 A;  2KOG A;  1KIL A;  4U3F D;  4YXW H;  1OW8 A;  3Q2Y A;  4K3A A;  2IFM A;  1SQB D;  3H1J G;  4N3Y B;  4EIJ A;  2R44 A;  4PJ0 E;  3H6P A;  1K8A Q;  3JC2 2;  1QLE D;  2Q9I A;  4NYT A;  2AXT H;  1J2J B;  3FXD A;  2HOD B;  2Q3I A;  1YJW P;  1DD3 A;  1FZE B;  1JMM A;  1ZXG A;  2LXB A;  1BGY E;  1ZW0 A;  1SQP K;  4UB6 H;  2FYN B;  2BCC G;  2AEJ A;  2J2P A;  2IBZ G;  2O1K A;  3CXH D;  3AE7 C;  4WVZ A;  2H43 A;  1BCC E;  4C46 A;  1N7S C;  1FZA C;  1IC2 A;  4PD4 H;  2OYI A;  5AVS B;  2E76 B;  2PRR A;  1N86 B;  3A2A A;  1HJB A;  4EOT A;  1DEB A;  4HKZ H;  2YKP A;  1KYO H;  3H1L D;  1SFC D;  1EZV G;  1T2K C;  1L0L K;  3GG2 A;  1T2K D;  1G1I A;  3B71 A;  5CCH A;  4DOJ A;  4NPF X;  2H8P D;  1JY3 P;  3HE4 B;  1L2P A;  1PFI A;  3L70 G;  2B87 B;  1JO5 A;  3TYY A;  2QEX P;  3AEE C;  2HG5 D;  3T97 A;  4W7Y A;  3E1I A;  1LTA C;  2FYU J;  3C9I A;  1JB0 J;  4WY4 B;  1AA0 A;  1VPC A;  4A7P A;  2HOD C;  2M3B A;  3P7K A;  1VQN P;  1LT9 C;  3KZI E;  2J1G A;  2J3F D;  3D6Z A;  4H0L B;  4H13 C;  1D7M A;  1Z3U A;  4H13 D;  1ZR2 A;  3Q5P A;  2FFD A;  1SQP E;  4RJT A;  5DJU B;  2Q6Q A;  2K1A A;  2HPC A;  2I1J A;  1S3J A;  1U7J A;  1IJD B;  3CXH E;  5AW1 B;  3AEF C;  1IFN A;  4LLH A;  1KIL B;  2JO1 A;  1SQQ D;  1NTZ G;  1T8Z A;  2CK3 H;  2QE7 H;  3G6E P;  1PP9 D;  3CWB E;  3L71 J;  1SQV K;  4JYB A;  4IFD K;  1N7L A;  3L73 J;  1E79 H;  2ITA A;  2JKV A;  4NPD A;  5GTH E;  2WSF H;  1NYH A;  5APT A;  4PV1 B;  1HWT C;  3H1I D;  3RGU A;  4DZO A;  1PGO A;  2YNY A;  1USE A;  4PD4 D;  1KOR A;  1NOH A;  1CI6 A;  1FE6 A;  2WPR A;  1PPJ D;  2OYH B;  4L75 A;  1FDO A;  2GUS A;  2HLO C;  2Z5H A;  1URQ B;  1AJY A;  4WB4 A;  1KYO D;  2ZJS E;  3AE6 C;  1OMI A;  1NKN A;  1JY2 P;  3L72 G;  1IZN B;  1PGP A;  1Y9B A;  4WY4 D;  3L75 J;  1QGK B;  1X22 A;  2MJZ A;  1M90 Q;  2W6B A;  1MFZ A;  5CBN A;  1OW6 A;  1JUN A;  3L75 G;  4H0L D;  2KZI A;  3H1J D;  1NH4 A;  3BVH C;  1LTJ C;  3SFE C;  3H1H D;  1BGY J;  2D39 A;  2GUV A;  4IL6 X;  3CX5 I;  2QA4 P;  3AEA C;  2WPV B;  1Y47 A;  3BAS A;  1Q86 Q;  3SSU A;  4HJG H;  4ASV A;  3Q3D A;  3V6I A;  1BGY G;  1N73 B;  4JF7 A;  3VYI A;  1BCC J;  4LC1 A;  1KIL C;  1KIL D;  3KQG A;  5KJ7 A;  3IF4 A;  5APQ A;  3L37 A;  4ASW A;  4JYO X;  4M7F A;  1SQV E;  1BCC G;  1PIX A;  3T97 B;  1H88 A;  2BCC D;  1R8E A;  3KPE A;  4N78 E;  1IFD A;  4KJM A;  2Q9I C;  4MN4 C;  3G9R A;  4PV1 C;  4PV1 D;  3PLN A;  4EDF A;  1KN7 A;  3RK3 B;  3H1I E;  4JPZ B;  4U7J A;  1KQS O;  5KLI B;  1N2D C;  3H25 A;  5K5G B;  1ZME C;  1GL2 A;  3G71 P;  5KTB A;  3TNU B;  1URQ D;  4NPE A;  1HVV A;  2RH0 A;  1LTI C;  5BVZ A;  2YKO A;  4D6T E;  2H43 C;  1N7S A;  2Y0D A;  2JEE A;  1EQ7 A;  3V4W A;  4YTP C;  1R5L A;  3WUV A;  1FZA A;  3L70 D;  2YXR B;  2OYI C;  2K9Y A;  5AW9 B;  4HB1 A;  2YMY A;  3TGU D;  1JY3 N;  4RES B;  4LGD E;  2E75 C;  2E75 D;  2QM8 A;  1SQP J;  1IK9 A;  1BE3 G;  1NTK K;  4XFJ A;  2O1J A;  3H1H E;  5CCH C;  3L4F A;  2XDJ A;  2FXM A;  1MFT A;  2H88 C;  2QM7 A;  2KYV A;  1IO4 A;  1VDF A;  1CI6 B;  3P32 A;  2A06 G;  3AE9 C;  1M1J C;  1DH3 A;  1HTL C;  2E74 B;  1PGJ A;  1Z56 A;  3E1I C;  1LWU B;  2J64 A;  1FZG C;  2B88 A;  2PFX A;  3CWB J;  2CPB A;  1JEK A;  1JTH A;  5CJ0 A;  1OZH A;  2FBW C;  1SQX K;  1AQT A;  3F89 A;  2FIB A;  5H2F H;  5AVQ B;  1NU1 K;  1L0L J;  1GU4 A;  1VQ7 P;  3CMA P;  3Q5S A;  3CL3 D;  1IFP A;  3CWB G;  1J1D B;  3CI9 A;  3RK3 D;  4IL6 H;  2AEM A;  2YIU B;  1YJ9 P;  1L4A A;  1L0L G;  1LP1 A;  1S5L X;  2XKM A;  1BSH A;  1RE4 B;  1AVO A;  3L74 J;  4C7N A;  2FFD C;  1KD1 Q;  2HPC C;  1LJ2 A;  3AE8 C;  1P84 E;  3L74 G;  3CX5 E;  2WSE J;  3NXS A;  3OAK A;  1K9M Q;  3I55 P;  1S4X A;  3U59 A;  2HYN A;  5GTI H;  3AE2 C;  3VMX A;  4R9J A;  3V5B A;  2WIT A;  4M7H A;  2N9B A;  4I2L C;  2J0H A;  1NTM D;  1EXI A;  1RF1 A;  1NTM K;  3M9H A;  1NTK E;  4N6J A;  3L72 D;  2R5D A;  5KLV K;  3MZW B;  2PP6 A;  2QIW A;  1NO4 A;  2C9L Y;  4K35 A;  2POH A;  5AVV B;  2WSC H;  1G2C A;  2KIK A;  1JY2 N;  3FIB A;  1M1K Q;  3MTU E;  1VF5 B;  2HLO A;  4R9T A;  2E74 C;  2E74 D;  4EPU A;  5M1B A;  3BCC D;  3PTZ A;  3JSV C;  1SQV J;  2OGU A;  1PZQ A;  2QJP C;  1SQX E;  2JP3 A;  2ZXE B;  1NU1 E;  1S9K D;  1GK4 A;  5KAI H;  3CCQ P;  2PAJ A;  1N7S B;  1SQV G;  2M8R A;  1NHL A;  1FZA B;  2O01 H;  3RK3 E;  2E5Y A;  3C1L A;  3H1I J;  1FDM A;  1FS0 E;  2KSJ A;  1Q2N A;  4W7Z A;  3B5N A;  5E79 E;  3A3Y B;  1VQL P;  4BWN A;  5AW5 B;  2J61 A;  2IDB A;  3LW5 J;  1AFO A;  3HRN A;  3CXH I;  2M5A A;  4D6T J;  1YIJ P;  3WU2 E;  1GW4 A;  1H89 A;  2XND H;  1WRG A;  1MKM A;  1N8R Q;  4GKG A;  4D6T G;  1VQP P;  5KJ7 C;  4UB8 E;  1SQB K;  1NTM E;  1EDJ A;  3D70 A;  2UWJ E;  1CZQ A;  1S5L H;  1KB9 D;  5BU8 B;  4B86 A;  2ZVO B;  1KMI Z;  5KLV E;  2YKQ A;  4JBZ A;  3AE5 C;  3JCU E;  1FZD A;  1LT9 B;  1L4A B;  2MKV A;  4H13 B;  1LP1 B;  1VF5 C;  1VF5 D;  1GL2 C;  3CCV P;  3WUT A;  2K3R A;  1GL2 D;  1BE3 D;  1CSB A;  3VP8 A;  2M3E A;  3BCC E;  1YTZ T;  3KHU A;  1H8A A;  1A02 F;  2KSE A;  2NRG A;  1S9K E;  1N7S D;  5CBO A;  2KS1 A;  2Q5U A;  1JCD A;  5CCG A;  1EDK A;  2D2C C;  2A06 D;  1QVF O;  3L35 A;  2QJY C;  5C39 A;  3M06 A;  1GU5 A;  3AE1 C;  5AW4 B;  3II6 A;  2FY8 A;  3VN0 A;  1A02 J;  2WPQ A;  3LW5 H;  1SVF A;  2P7J A;  3AEB C;  1UIX A;  1NKZ B;  4DT0 A;  1L0N D;  1G2C B;  1GD2 E;  2J0G A;  4U3F E;  1M1J A;  1X0T A;  2LKM A;  1IK7 A;  1L0N K;  1YTZ I;  1JC9 A;  5AVZ B;  2HLO B;  1SQB E;  4YPC A;  1FZG A;  2YO2 A;  5EFW B;  5AVR B;  1NTK J;  2P1J A;  3NTN A;  2JWA A;  1KB9 E;  2IYO A;  1FJK A;  3ABV C;  2FYU G;  4PD4 I;  3A0B H;  1NTK G;  1L4A C;  1U7M A;  1L4A D;  2R3S A;  2Y9Y A;  2H7H A;  2W6A A;  2ZAE B;  1VQK P;  3BVH B;  1LTJ B;  1Z3S A;  3R2P A;  2ZFC A;  2J61 B;  1KFN A;  1S72 P;  2Z4E A;  3G4S P;  1YQ3 C;  1SQX J;  1DIP A; 
#chains in the Genus database with same CATH homology
 1RE3 C;  1XTG B;  3HD7 B;  1FAV A;  3I5C A;  2A45 G;  3N7N A;  1JY2 O;  3RK3 B;  3P8C E;  1T3U A;  1SQQ K;  4C7N B;  5AW7 B;  5APV A;  3WMM 0;  1FZC B;  3M9Q A;  3U1A A;  1N2D C;  3M0D C;  1GL2 A;  1RF1 C;  5KTB A;  3TNU B;  3OA7 A;  1URQ D;  2A45 I;  2R5B A;  2OYH A;  2R32 A;  2C9N Y;  1G1J A;  5AVT B;  2Q9I B;  1HVV A;  1FIC A;  2P67 A;  1URQ A;  1LTI C;  1NWQ A;  1RE3 B;  5AW6 B;  3MGN A;  5BVZ A;  2YKO A;  1QL1 A;  2P2U A;  3GHG C;  2H43 C;  3UIA A;  2N1T C;  2N1T D;  1N7S A;  2Z5I A;  1RF0 C;  5AW3 B;  2JEE A;  1EQ7 A;  1ZLL A;  3V4W A;  2J0Y A;  3HE5 A;  1FZA A;  3HE4 A;  5APX A;  2NPS B;  2OYI C;  1FZF A;  2J60 A;  3H32 B;  1RF1 B;  2JJL A;  1DX7 A;  1LGH B;  1NAF A;  1IFM A;  2KLV A;  5AW9 B;  2YMY A;  5BU5 A;  2XV5 A;  3NMD A;  1JY3 N;  4RES B;  2IPP A;  4LGD E;  2JHM F;  2QM8 A;  1IK9 A;  1NTK K;  2XNX C;  4I6M C;  1LWU C;  4IFF A;  2OAR A;  2E42 A;  2O1J A;  4JYC A;  2H43 B;  3RL0 C;  1OWA A;  3RL0 D;  3V2P A;  4W80 A;  3HTK B;  1SFC C;  2C0W A;  3LID A;  1RF0 B;  5CCH C;  2KB7 P;  3L4F A;  2XDJ A;  4WY4 A;  4KHX A;  1GZL A;  2FXM A;  3EFG A;  2QM7 A;  2OYI B;  2GY7 A;  3V2N A;  1J1D C;  1LTG C;  2KYV A;  1IO4 A;  1N73 A;  1FBM A;  1VDF A;  3V4Q A;  3B5N C;  1KFM A;  2IX7 C;  1ZR4 A;  1CI6 B;  2WZ7 A;  3P32 A;  1M1J C;  1DH3 A;  1HBW A;  2J3U A;  3M0A A;  1RE4 C;  1HTL C;  1Z56 A;  1HGZ A;  2XNX B;  1LWU B;  2J64 A;  2C0X A;  3E1I C;  1FZG C;  5AVW B;  3BVH A;  1LTJ A;  2CPB A;  1JTH A;  5CJ0 A;  2WWW A;  2JHL F;  1YYC A;  1KQL A;  1SFC B;  3BRT B;  4IFM A;  1IFI A;  1SQX K;  2FIB A;  2JHI F;  5APW A;  5AVQ B;  1NU1 K;  1GU4 A;  3HD7 C;  3BRV B;  3HD7 D;  2A45 H;  3CL3 D;  1XTC C;  1J1D B;  4XE5 B;  2CPS A;  3CI9 A;  3RK3 D;  4O9B A;  2E43 A;  3B5N B;  1L4A A;  1X9V A;  2KOG A;  1T3J A;  1KIL A;  2XKM A;  1M1J B;  1RE4 B;  3E1I B;  1HH0 A;  4C7N A;  1FZE C;  2FKW B;  2FFD C;  1FZG B;  1FZC A;  2IFM A;  4N3Y B;  3P8M C;  4EIJ A;  1ZV8 A;  3TNU A;  1GDT A;  2HPC C;  3H6P A;  2L5G B;  2Q9I A;  2Q7C A;  4NYT A;  3NXS A;  3OAK A;  3IR9 A;  1OXZ A;  3U59 A;  1J2J B;  2HYN A;  3VMX A;  4R9J A;  5CJ4 A;  3V5B A;  1MV8 A;  2NPS C;  3H32 C;  2NPS D;  2WIT A;  3SWY A;  2HOD B;  2N9B A;  4M7H A;  2KP8 A;  3L36 A;  2Q3I A;  1FZE B;  4I2L C;  2FFD B;  2J0H A;  3NFQ A;  1JOC A;  5AVX B;  1JMM A;  2J3O A;  3M0D A;  3HUS A;  1RF1 A;  1NTM K;  3M9H A;  1N86 C;  1SQP K;  2HPC B;  5AVY B;  1RY3 A;  5APU A;  4N6J A;  4N78 D;  2J2P A;  1LTS C;  2R5D A;  2O1K A;  3VP9 A;  5KLV K;  3GHG A;  4GT1 A;  3U1C A;  3KDP B;  2H43 A;  2N1T A;  5CCG C;  2PP6 A;  3VMZ A;  5CCG D;  1GTW A;  1NO4 A;  2C9L Y;  3TSI A;  1N7S C;  4C46 A;  4ZKP A;  2POH A;  5AVV B;  3V2R A;  2WSC H;  1G2C A;  1JY2 N;  3VMY A;  1FZA C;  3P8C D;  5APY A;  3FIB A;  1IC2 A;  2OYI A;  3MTU E;  5AVS B;  2HLO A;  3VTP C;  4R9T A;  1WT6 A;  1N86 B;  3A2A A;  2J59 M;  1HJB A;  4EPU A;  1E5W A;  4Y99 C;  4EOT A;  1DEB A;  1X8Y A;  2YKP A;  3CLQ A;  1SFC D;  1W2E A;  5CCH D;  1LWU A;  1T2K C;  2ZXE B;  1S9K D;  1L0L K;  1T2K D;  1G1I A;  1GK4 A;  2PAJ A;  1N7S B;  5CCH A;  2M8R A;  4DOJ A;  3BAT A;  3V2Q A;  1NHL A;  4HH2 A;  4WY4 C;  2VRS A;  3B5N D;  2H8P D;  1FZA B;  2O01 H;  1JY3 P;  1FZB A;  3HE4 B;  1PFI A;  3G3Z A;  1FDM A;  3MIW A;  2KSJ A;  4W7Z A;  3B5N A;  1FJP A;  3A3Y B;  1JO5 A;  1FOS E;  4Y99 B;  5AW5 B;  3TYY A;  2WT7 A;  2J61 A;  2HG5 D;  3T97 A;  2GM4 A;  1RE4 A;  4W7Y A;  1J1E C;  2WTY A;  3E1I A;  1AFO A;  3HRN A;  5AW8 B;  4ZKU A;  1LTA C;  4HYT B;  3C9I A;  5AVU B;  1HGV A;  3HD7 A;  4WY4 B;  1GW4 A;  1H89 A;  1VPC A;  2J5Z A;  1NTZ K;  1QL2 A;  1WRG A;  2HOD C;  2M3B A;  3P7K A;  1X79 B;  3OJA B;  4GKG A;  1LT9 C;  1ZN5 A;  4OH8 B;  5KJ7 C;  2J1G A;  2J3F D;  2YO3 A;  4AYC A;  1Z3U A;  1ZR2 A;  1SQB K;  2WPS A;  5AW2 B;  3O8Z A;  3B8E B;  1J1E B;  2J3F A;  2FFD A;  4ZFG A;  1FOS F;  4I1L A;  1CZQ A;  3N4X A;  2Z4E C;  1RE3 A;  5BU8 B;  3LIE A;  4JZC A;  4B86 A;  2HPC A;  1HUC A;  2I1J A;  2YKQ A;  1MUU A;  1CW5 A;  1IJD B;  5AW1 B;  2HFE D;  3IFM A;  1FZD A;  1LT9 B;  1L4A B;  4XA4 A;  1IFN A;  1FU1 A;  2NPS A;  3M91 A;  3H32 A;  4LLH A;  1KIL B;  3A7O A;  1GL2 C;  1T8Z A;  1FIB A;  2J3G A;  1GL2 D;  3M9B A;  1JY3 O;  2FYZ A;  4GIF A;  2XU6 A;  2OYH C;  1CSB A;  4JYB A;  1SQV K;  3VP8 A;  2Z4E B;  4IFD K;  1URQ C;  3HUS C;  1N86 A;  1FID A;  1YTZ T;  1N7L A;  5CHX A;  1H8A A;  1A02 F;  3HTK A;  1RF0 A;  3RK2 C;  2R3C A;  2WSF H;  1N7S D;  4C7R A;  1S9K E;  3RK2 D;  5APT A;  1HWT C;  2Q5U A;  1JCD A;  5CCG A;  4DZO A;  1FZF C;  2I1K A;  1GL2 B;  1M7L A;  2YNY A;  3L35 A;  5AW0 B;  1NOH A;  1CI6 A;  3PP5 A;  2XZR A;  2WPR A;  2OYH B;  1KZU B;  1JNM A;  3M06 A;  1GU5 A;  2GUS A;  5AW4 B;  2Z5H A;  2HLO C;  1URQ B;  3HUS B;  3II6 A;  4WB4 A;  2XNX A;  2W27 A;  5APS A;  2JHH C;  1SFC A;  3VN0 A;  2FYU K;  3RK2 B;  3SWF A;  1NKN A;  3HE5 B;  1A02 J;  1JY2 P;  2WPQ A;  3LW5 H;  4WY4 D;  3GHG B;  1SVF A;  2JHK F;  2N1T B;  2P7J A;  2MJZ A;  1FZF B;  1NKZ B;  1LTT C;  2W6B A;  1N73 C;  1MFZ A;  1IFJ A;  1G2C B;  1GD2 E;  1JUN A;  2J0G A;  2J58 A;  1M1J A;  2LKM A;  1FZB C;  1L0N K;  1YTZ I;  5AVZ B;  4M3L A;  2HLO B;  1AQ5 A;  1NH4 A;  1FZG A;  2BAS A;  3TK1 A;  3BVH C;  1LTJ C;  2YO2 A;  1LTB C;  2D39 A;  2GUV A;  5AVR B;  2P1J A;  3NTN A;  3BAS A;  3RL0 B;  2IFN A;  1GW3 A;  1GK6 A;  1FJK A;  2WSE H;  1JCC A;  1N73 B;  3VOP A;  4JF7 A;  1L4A C;  5KJ7 D;  1SP4 A;  3VYI A;  1L4A D;  4LC1 A;  1FZB B;  3MUD A;  1KIL C;  2H7H A;  2HOD A;  1KIL D;  2W6A A;  3MD0 A;  3RK3 C;  1MZ9 A;  3EQ2 A;  1FZE A;  1LT9 A;  3KQG A;  5KJ7 A;  4AUW A;  1FZC C;  5APQ A;  1SLQ A;  3BVH B;  1LTJ B;  3L37 A;  3R2P A;  5CMZ A;  1Z3S A;  4JYO X;  1JTH B;  2WT7 B;  2ZFC A;  4M7F A;  2J61 B;  1H88 A;  2WNP F;  3KPE A;  1KFN A;  4WBA A;  4N78 E;  3KYQ A;  1IFD A;  2Q9I C;  2Z4E A;  4AQR D;  3A5T A;  1JC9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...