3HUSB

Crystal structure of recombinant gamma n308k fibrinogen fragment d with the peptide ligand gly-pro-arg-pro-amide
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
303
structure length
303
Chain Sequence
TVNSNIPTNLRVLRSILENLRSKIQKLESDVSAQMEYCRTPCTVSCNIPVVSGKECEEIIRKGGETSEMYLIQPDSSVKPYRVYCDMNTENGGWTVIQNRQDGSVDFGRKWDPYKQGFGNVATNTDGKNYCGLPGEYWLGNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGGFTVQNEANKYQISVNKYRGTAGNALMDGASQLMGENRTMTIHNGMFFSTYDRDNDGWLTSDPRKQCSKEDGGGWWYNRCHAANPNGRYYWGGQYTWDMAKHGTDDGVVWMNWKGSWYSMRKMSMKIRPFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Impaired protofibril formation in fibrinogen gammaN308K is due to altered D:D and "A:a" interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
molecule keywords Fibrinogen alpha chain
total genus 75
structure length 303
sequence length 303
chains with identical sequence E
ec nomenclature
pdb deposition date 2009-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3husB01
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 3husB02
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 3husB03
2J3UA 1FICA 4R9TA 2J3OA 3HUSC 2Z4EA 1FZAB 2HLOA 2J5ZA 1FZGB 1JY3O 1M1JB 2H43A 2FFDA 3BVHB 2JHLF 1FIBA 4NYTA 2OYHB 1M1JA 2H43B 2Q9IC 3E1IB 1JY2P 1LT9B 2J2PA 1JY3P 2J61A 1FZDA 1RF1A 3E1IC 1RE4B 2J0YA 1FZCB 2J1GA 3E1IA 2A45I 1RF0B 2JHIF 4EPUA 1FZAA 2Z4EB 3GHGB 1FZBC 1FZFB 2OYHC 2J3FA 2A45G 3H32C 4JZCA 1LWUB 2HODB 3H32A 2WNPF 3BVHC 2OYHA 2HPCB 1JY3N 2J3GA 1JY2N 1N73B 1N86B 2Z4EC 3H32B 2OYIC 2GY7A 2A45H 1FZEC 1LTJB 2XNXB 1RE4A 3FIBA 2HPCA 1FZCA 2J0HA 4M7FA 3BVHA 2FFDB 1JY2O 2JHHC 1N86A 1RE3C 2FIBA 1FZBA 1Z3UA 3GHGC 1JC9A 1LT9A 1LT9C 2D39A 3GHGA 1RF1B 2J3FD 1FZGA 4R9JA 2FFDC 1FZCC 1FZEA 2H43C 2JHKF 1RE3B 1RE4C 1FZGC 1RF1C 3HUSA 1FIDA 2J60A 2Q9IB 1RF0A 2J0GA 2OYIA 1FZEB 3HUSB 2Q9IA 1LTJA 2XNXA 1N73C 1FZFA 2J61B 1M1JC 1RE3A 2J64A 1N86C 1LWUA 2HODA 1LWUC 2HODC 4JYOX 4ZFGA 1W2EA 2HPCC 1FZBB 4M7HA 1FZFC 1N73A 1LTJC 2XNXC 2JHMF 1FZAC 2HLOC 2OYIB 1Z3SA 2HLOB 1T3UA 1RF0C
chains in the Genus database with same CATH superfamily
2BCCD 1K73Q 4WWIA 1SQXD 1K9MQ 1ZRTD 1S5LH 3L71D 5CCHA 3TK1A 5TISH 4N3YB 3H1ID 1M1JA 2KSEA 4IL6X 1GZLA 3CCSP 3NMDA 4C46A 1QEXA 3AEDC 1PIXA 1KQFB 2FY8A 4DZOA 5AW4B 3HE5B 3MHVA 1ZMEC 3M9QA 4D6TE 2WSCJ 2MKVA 1NU1D 2WPVB 1NTKD 1VQPP 1N8RQ 4Y28J 1VF5C 4HYTB 1N73B 3H32B 5KJ7A 4Z1MH 3VN0A 3P32A 2GY7A 3CXHI 2E74B 1KB9E 2I1JA 5KAFE 3BATA 2E75B 2M5AA 1JM0A 2P58A 3AECC 3RK2B 1KZUB 5CHXA 2N1TD 1M8OB 2H88C 4RJTA 2QM7A 1SFCC 1YJWP 1FZFA 2WPQA 2J64A 1MV8A 1J1DC 1NWQA 2KYVA 3I56P 5B66E 2AEMA 3P7KA 3CCEP 1JCDA 1KN7A 2J58A 4JF7A 1FZAB 2R32A 2J5ZA 2XV5A 1EZVD 2IBZG 1BCCJ 1BCCD 3BVHB 4W80A 3QWOC 2H43B 1CI6A 1VQ7P 1LT9B 4YPCA 4L73A 3V2RA 1PPJE 1L0LK 2QRXA 4LLHA 3GF3A 1L0NE 1EC5A 2H8PD 1CZQA 1USDA 1S1CX 3MP7B 4WY4D 2B87B 1FZFB 3H32C 1G2CA 4JZCA 4M3LA 3A0BH 3M9HA 2OYHA 3L72D 1LTAC 1OW8A 1GMJA 3AE3C 2WTYA 2BCCJ 2J59M 2HFED 4EYYQ 2ZYAA 1X79B 1BE3D 1L4AC 1YBKA 1JEKA 1RE3C 1SQPJ 4C7NB 3CMEP 4A7PA 2ZJSE 1T8ZA 1JMMA 2KNCA 2LR2A 3A7OA 1GL2B 1RF1B 1GD2E 1RE4C 3TDKA 2QG4A 2XNXA 2B87A 5AVQB 1P84H 1R5SA 2XNXC 1UIXA 1KYOD 1CW5A 2P10A 2M8RA 2ZYDA 3TGUD 1YI2P 3RBZA 2YIUB 1NTKE 2DW3A 3SFDC 5B66H 3ITKA 4Y99C 1EDJA 1FDMA 4BRYA 4H44C 3CC2P 5APSA 1VQLP 1RHZB 3HE5A 3BCCD 3C8VA 1HGZA 1RF1A 5BU5A 3L75D 1AJYA 1Q82Q 3L75G 1E79H 1FOSF 3KHUA 1Q7YQ 2FYNB 3RK3C 2GA1A 3M91A 2WITA 3H32A 3M9BA 2IDBA 3RGUA 3TYYA 2Y9YA 4PD4E 2PP6A 4OGQD 4M7FA 2P67A 2C9LY 2CPBA 2KIKA 5AW2B 1NOHA 3AE1C 1HVVA 2D39A 3KXDA 3L71J 3GHGA 1FS0E 1MUUA 3GF7A 5APTA 1PFIA 3U59A 1SQBJ 2C0XA 2KI7B 1ZR2A 1P84D 1FZEB 1GU5A 1PPJG 4U3FG 3WU2E 3OJAB 2HODA 3H1JE 1NYHA 3O8ZA 1YHQP 1L0LD 2KK7A 2AXTE 3CWBE 2ZAEB 1BE3J 4HB1A 4EDFA 1DEBA 1OVUA 1L0LE 1PGQA 2IBZI 1LTIC 1VQ4P 1PP9E 1PGOA 1SQQJ 4R4MA 5CJ0A 2J61A 1IFNA 2IFNA 5AVVB 5KAFH 2IYOA 2JDIH 4ZKPA 2QVAA 3E1IA 2BCCE 3O6QB 3HE4B 4ASVA 1G2CB 3L35A 4LGDE 4PJ0E 1JCCA 3V4WA 5AVTB 2QM8A 4KJMA 1BCCG 2I8DA 1L0NJ 4O9BA 5KJ7C 5AVXB 2XNXB 1W2BO 1PZQA 1SQQE 3VOPA 3RK2D 5CCGA 1GW4A 3BRTB 5AW3B 1EDLA 1YYCA 1SQQD 1SQVJ 3H1LD 4XFJA 1K04A 1L0NK 2JP3A 3RL0C 3VMXA 1RF1C 3BRVB 5APWA 3CC4P 1N73C 3KZIH 4WY4B 2V7QH 5GTHE 1S5LX 1SLQA 2E5TA 2JEEA 1OIPA 4HH2A 1YJ9P 3CXHH 5AW0B 5AVUB 1ZP0C 1R5LA 3H1KD 1PPJD 1SQVE 3M0AA 3A2AA 2J5UA 2LXCB 1BGYD 4RESB 3JCUE 1SQBE 5K5GB 2AEFA 2LKMA 1GW3A 4DT0A 1GDTA 2IZ1A 3A5TA 3TGUG 1AQTA 2RMZA 3GHGB 1NKNA 1URQD 1A02F 4ZKUA 3GMAA 4HKZH 4DOJA 1AVYA 5CJ4A 5CBNA 1N86B 3H1IG 2H89C 1SQXG 2JJLA 2HPCA 1AFOA 3AE8C 1J1DB 2JHHC 2WSSH 3AE6C 2E76B 3JCUH 2YKPA 3U1AA 1WRGA 1NTMD 5C39A 2Q6QA 2B88A 2K3RA 1OZHA 3HUSA 2R5DA 1DH3A 1RF0A 3MD0A 2J0GA 3I5CA 3IN6A 5AVSB 2NPSB 2J61B 2FXMA 1RQUA 3Q1MA 1GU4A 3VMZA 3AE9C 2W6JH 2E74C 5B5EH 3L70E 5KAIE 3S4RA 1JY3O 1Q90D 2W27A 1KMIZ 4JBZA 3L71G 2IX7C 1NTZE 2RN0A 1JY3P 1M7LA 3H1IE 3HD7A 1FZDA 4ASWA 2Y0DA 2J1GA 1CI6B 1QLED 5KKZC 1NO4A 2D2CB 3TGUE 2WT7B 1QVGO 1JO5A 1RF0B 2PAJA 4U3FJ 1OXZA 3L73J 1KILE 1GK4A 1JY3N 2J3GA 2Q3IA 1JOCA 3W67A 1K05A 3B5NB 2A06E 1KD1Q 3EFFK 1BSNA 3S9OA 1E5WA 4L76A 3R2PA 1ZR4A 2E42A 3C1LA 1FZCA 2ZT9B 3BVHA 3MTUE 1YTZT 1NGMB 3WUTA 1WMKA 1IFMA 3P8MC 2BASA 1ZN5A 3G3ZA 5KLIB 5APVA 2GUSA 2ZVOB 5GTHH 2FFDC 2CPSA 2RH0A 3CLQA 1K8AQ 3ZDMA 4H44B 1IZNB 1SQVD 3SWFA 2YKOA 2KZJA 1NJIQ 3L75J 2O01H 1EZVG 3HRNA 4JYOX 5DJTB 4WY4A 2XZRA 3AEBC 1FDIA 1N7SC 2NRGA 3TF5A 1LTJC 1FZAC 3FGAD 2LXBA 1L0ND 1T2KC 2PFXA 3Q5RA 3LIDA 1JB0J 1SP4A 2K37A 4NYTA 1SFCB 3L72E 3CD6P 5CCGC 1Y9BA 1OW7A 2J0YA 1GL2C 3D71A 3H1HD 3IF4A 4U7JA 2M5AB 2JKVA 1ZRTE 5DJUB 2WSFJ 3S1KA 5APUA 1OWAA 3AE7C 3RK3E 3G71P 4IL6H 1URQC 2ZVNB 2OYIC 3OA7A 1NAFA 1HGVA 2A45H 3FWNA 1KQSO 3M0DA 4IFMA 1OX3A 4GOEA 1BE3G 1BE3E 4W7ZA 1Q86Q 3PLNA 2J3FD 5L8RJ 3VMYA 1USEA 3P8CE 4GT1A 1SVFA 2J60A 2NPSA 1ZXGA 3D6YA 3L70J 1NTMK 2KZIA 3CCRP 4H0LB 3HUSB 1S72P 3K5BA 3H1HJ 2HPCC 1FZBB 2WPSA 2O3JA 3H1IJ 3H1LE 2M0BA 2NPSC 1FICA 2KXPB 2POHA 1VF5D 3A0BE 1FZGB 2NZ2A 2FYNC 2OYHB 3HD7B 1L0LJ 3VP8A 3H25A 1JY2P 3AEAC 3OW2O 1BGYJ 2WSFH 1YTZI 3RK2C 5CMZA 4YXWH 2K88A 4TT3H 3VP9A 2JR8A 4C7NA 4N78E 5AVZB 4EPUA 2FYZA 1IK7A 4Y99B 3L75E 1KILA 1FZBC 2QE7H 2HODB 4NPEA 2OQQA 2Z4EC 1QL2A 2L91A 4H0LC 1MFTA 1Q81Q 1M56D 4IOIH 4LC1A 1P84E 1SQXK 3CCVP 1S9KD 2J0HA 1Y8AA 3CCQP 2L5GB 3Q3DA 1KQLA 3V5BA 2OTKE 5TJHA 3MUDC 3Q5SA 2GUVA 3D6ZA 2JHKF 3NFQA 4CPGA 4PV1C 2WVRA 3L73G 3WUVA 1SFCD 1NU1G 1VQ9P 1LTJA 1URQB 1PGPA 2QJYB 3L36A 3V6IA 1R8EA 2N1TC 4HJGH 2MJZA 4ZFGA 3LW5H 3CPWO 1WT6A 1NTZD 4R9TA 4UB6E 3E1RA 4I2LC 2JHLF 2Z5HA 3RK3D 3G4SP 3CWBD 5E79E 3IR9A 2J2PA 2AEJA 3PJSK 4D6TD 1DX7A 3SWYA 1JMBA 3MUDA 2XKMA 2KB7P 1KYOH 2WQYC 2KLVA 2Z4EB 2E76D 1L2PA 4C7RA 1DEEG 3KYQA 1NU1E 3TNUB 2WMMA 3AEEC 1LTSC 5APYA 2FYUJ 3BCCE 2V7QJ 1KYOI 5KJ7D 2M3EA 4MN4C 1SQVG 2HR3A 2B9BA 1N86A 2FIBA 1Z3UA 4GOFA 2QIWA 2WSCH 2C0WA 4JPZB 1KILD 3L72J 5AW9B 2YO2A 2YXRB 2AXCA 1QX8A 3VTPC 1FZGA 2JO1A 1HJ0A 1NTKK 1VQKP 2HG5D 2QSIA 2Q9IB 2ZFCA 4PD4D 2FYUE 3G9RA 2OYIA 3L74J 1J2JB 1N86C 1LWUA 2M3BA 4IL6E 5AW5B 1N7LA 4H13C 1ZW0A 5KLVK 3TNUA 1HTLC 1QL1A 3O6QA 1RF0C 4I7ZB 2J3UA 1M57D 1KB9H 2FYUK 2J3OA 2D2CC 3B4SA 1VF5B 1FOSE 4I6MC 1RQVA 2BEQD 4TLFA 2Q9IC 1FAVA 2VRSA 5KAIH 3FWLA 1IK9A 3CCLP 3L70G 3H1JD 1Z56A 4WBAA 4OWFA 1DD3A 4GDOA 1KILB 2Q1KA 1TU3F 5AW6B 3SFEC 5APQA 3KZIE 2FXOA 2W6AA 2OARA 2WWWA 3UIAA 1NU1K 4DCKA 1G1IA 1JTHB 1LWUB 1BDCA 3H1LG 1N2DC 1PP9G 4OGQC 5KLVJ 4IFDK 1URQA 1LTJB 5KLVG 1L0LG 1GL2A 2B89A 2IFMA 1U7MA 1PV3A 3KDPB 3V2NA 1A02J 1BSHA 1CSBA 3BASA 5AW7B 2QJKB 1SQXE 1QVFO 4AYCA 1KFNA 2G8YA 3ABVC 4U3FE 2QJPB 1J1EB 1P84I 2P1JA 1HBWA 2O01N 1N7SA 2O1JA 1M1JC 3Q2YA 4H13D 3M06A 2HYNA 2ZT9C 1X8YA 1X0TA 2JHMF 2HLOC 1EXIA 1KFMA 1ZOYC 3L74G 2WSEJ 3MZWB 2BCCG 3KQGA 1SQPE 2C9NY 5AVYB 1VQ5P 5CBOA 3B8EB 1S4XA 5AW8B 1VL2A 2O01J 1T3JA 4PJ0H 1KILC 1BDDA 3SSUA 2KS1B 1OVVA 3GLMA 3H1KJ 1OMIA 2YMYA 1EXJA 4BRYB 1LJ2A 4ZNCA 2A45I 4XA4A 1H89A 1AQ5A 4YTPC 3TGUJ 3PP5A 4H13B 3A3YB 4DJGA 4I7ZC 1X9VA 2UWJE 1VQOP 3H1HG 2G3AA 1FZEC 3V2PA 1NHLA 4WB4A 3H1LJ 2IBZE 3L37A 3A0HE 1IO4A 1SFCA 1LTGC 1SQQG 2H43C 1BGYG 2WPRA 1Q2NA 2P2UA 5GTIH 3G6EP 1FU1A 3HD7C 2QA4P 2K9JB 2Q9IA 2OGUA 3CX5H 1NTMJ 2Y9ZA 1YJNP 1OFCX 4RKUJ 1LWUC 2XU6A 1YIJP 4NPDA 3BCCG 4B86A 2O1KA 3M0DC 1FZEA 2WT7A 3CCUP 4PD4H 1HWTC 1LTTC 3B71A 3HUSC 2D2CD 5M1BA 2IYPA 4RO0A 1FJKA 2KP8A 3L72G 2PRRA 3CL3D 3EQ2A 1JUNA 3CI9A 3U1CA 1IC2A 2KOGA 1FZCB 1KQGB 1KC8Q 5KLIC 1NTZG 3L70D 3PTZA 2K9JA 3T97A 5KLVE 1JTHA 1FZAA 3H1JJ 2R44A 1IFPA 1U7JA 4XE5B 3CX5E 4EIJA 5BU8B 4KT0J 2K9YA 1JY2N 2N1TB 1AV1A 1FDOA 2NPSD 3C9IA 4U3FD 2V4HA 5EFWB 3L73D 3PHLA 4GKGA 2OYOA 2OTJP 3L73E 1W5CE 2E75D 2PGDA 3WUUA 2E74D 3RL0B 1FZCC 1RE3B 1OW6A 2Q7CA 2IPPA 2KSJA 3AE4C 2BEZF 3IAOA 4PD4I 1PL5A 1T6AA 2W8ZA 1PGJA 3TSIA 2IZ0A 4R4LA 1N73A 3H1KE 1Z3SA 1YITP 1L0NG 1NTMG 4N78D 2QJPC 2HLOA 1SQBK 2FYUG 1H8AA 3BCCJ 1HF9A 1G1JA 3QH9A 2FYUD 4BXLA 1X22A 1XTCC 3WU2H 1SQBD 3Q5PA 1NTZK 1MKMA 3SWKA 3F89A 1NTKJ 1VQ6P 4K3AA 4ZMDA 1BGYE 2E76C 3FXEA 1EQ7A 5CCGD 4N6JA 4L74A 2I1KA 1YQ4C 2ITAA 1IFDA 2A45G 1H0TB 2HPCB 1D7MA 2QJYC 1SQPK 1MZ9A 3A0HH 3L4FA 3I55P 3AEFC 3B5ND 1M1KQ 5B5EE 3CCMP 1KTMA 3R4YA 1EZVI 3F5HA 1JY2O 4QMAA 1FZBA 3GHGC 2JWDA 1LT9A 1NTME 4W7YA 3H1KG 1FBMA 4OH8B 4R9JA 2W90A 2XNDH 1XTGB 2ZYGA 1NAYA 1LP1B 2XDJA 1OVRA 2JWAA 4NPFX 4BWNA 2ZXXA 1PP9D 3H6PA 2HODC 4EI2A 1W2EA 2Q3EA 1FZFC 4M7HA 3L74D 2OYIB 1VPCA 1SS1A 1SQXJ 4I1LA 1KORA 2H7HA 1FIBA 3RK3B 4JYBA 3LIEA 3AE2C 1M90Q 4IFFA 1LGHB 1RY3A 4JYCA 1DIPA 1AVOA 3VMAA 2YNYA 1KB9D 2YO3A 3RL0g 3T97B 4WVZA 3B5NA 2N9BA 1ZV8A 2J3FA 2AXTH 3D70A 2WNPF 3PRJA 2YIUC 3JSVC 1VQ8P 1GTWA 2YMKA 4YXDC 3RL0D 4OGQB 4UB6H 3HTKA 1RE4A 1NH4A 4JQ0D 1S5LE 2Q5UA 1JNMA 3USSA 1U57A 1Y47A 2KUBA 1NVOA 1MFZA 1JC9A 2P7JA 4AUWA 5H2FH 1HUCA 4L75A 3GG2A 2GM4A 1BCCE 3V2QA 1VQMP 1LT1A 1FIDA 3PH0A 2K1AA 1KB9I 3HD7D 1H88A 1FJPA 1UIIA 2R5BA 2Y0EA 2A06G 1L4AB 3B5NC 1YQ3C 1FC2C 2HLOB 2W6BA 3KPEA 4PV1B 1SQPG 2Z4EA 3RBXA 4OVNF 1HJBA 1M1JB 4PV1D 3OAKA 4WY4C 5KKZB 2FFDA 3CXHD 1VDFA 2OTLP 5APXA 1EZVE 3EWKA 3H1HE 5BVZA 4EOTA 4GIFA 1RH5B 5TISE 3E1IC 2QJKC 1DD4A 3CWBG 4AQRD 3JC22 4KHXA 3L71E 2JHIF 3II6A 2SPZA 1N7SB 2OYHC 1GL2D 4H0LD 3NTNA 3BVHC 5H2FE 1L4AA 1H0TA 2KLUA 3CC7P 2ZXEB 3EFGA 2FKWB 2CK3H 4H44D 3FIBA 4GODA 1ZLLA 2FFDB 5CCHD 5KLVD 3VYIA 2R3SA 1LT9C 1HH0A 2N9YB 5AW1B 3CX5D 3L74E 1N7SD 3CX5I 3MIWA 2ZT9D 4K35A 1FZGC 2E43A 1NKZB 3FXDA 3HE4A 1S3JA 3P8CD 1LP1A 1GK6A 4UB8H 5E79H 1IFIA 1NTZJ 1KV4A 3H1JG 2YXQB 1T3UA 1QGKB 1EDIA 1EDKA 1KYOE 2Z5IA 2H43A 2R3CA 3N4XA 3N7NA 1SQPD 1L4AD 2QEXP 1IJDB 3AE5C 3E1IB 5GTIE 1SQBG 2A06D 2E75C 3CMAP 1RE4B 1AA0A 2E5YA 2Y0CA 5AVWB 5CCHC 1IFJA 2WZ7A 3NXSA 3AEGC 1NU1J 1FE6A 3CWBJ 3E7KA 4UB8E 2W83C 3V4QA 5KTBA 2RKLA 1PP9J 3CCJP 2FXPA 3IFMA 3HTKB 2N1TA 1S2EA 2KNCB 1J1EC 3WMM0 1S9KE 3GW6A 2IBZD 1VQNP 1LTBC 3CXHE 1NTKG 3LW5J 2FBWC 3W68A 3FX0A 3MGNA 2KS1A 1T2KD 5AVRB 1RE3A 1SQQK 2YKQA 1SQVK 2WSEH 4D6TJ 1LNQA 4D6TG
chains in the Genus database with same CATH topology
1WT6A 5AVUB 4N78D 4R9TA 2HLOA 5CCHA 1SQBK 3TK1A 4I2LC 4N3YB 1H8AA 2JHLF 2Z5HA 1G1JA 3RK3D 1M1JA 3M0AA 1XTCC 3A2AA 1GZLA 3IR9A 3NMDA 2J2PA 4C46A 1NTZK 4RESB 4DZOA 5AW4B 1DX7A 3HE5B 3SWYA 3MUDA 2XKMA 3M9QA 2KB7P 1EQ7A 5CCGD 2LKMA 4N6JA 1GW3A 1GDTA 2I1KA 2KLVA 3A5TA 2Z4EB 3GHGB 1NKNA 4C7RA 1URQD 1A02F 1IFDA 4ZKUA 2A45G 3KYQA 4DOJA 4HYTB 2HPCB 3TNUB 5CJ4A 1N73B 1SQPK 1MZ9A 1N86B 1LTSC 3H32B 5APYA 5KJ7A 3VN0A 3L4FA 3P32A 2GY7A 3B5ND 2JJLA 5KJ7D 2HPCA 2I1JA 1AFOA 1J1DB 1JY2O 3BATA 2JHHC 1N86A 2FIBA 1FZBA 1Z3UA 3GHGC 2WSCH 1LT9A 4W7YA 2C0WA 1KILD 1FBMA 5AW9B 2YO2A 3U1AA 2YKPA 3RK2B 3VTPC 1FZGA 1KZUB 4OH8B 5CHXA 4R9JA 1WRGA 1XTGB 1NTKK 2N1TD 2HG5D 3HUSA 2Q9IB 2ZFCA 2R5DA 2XDJA 1DH3A 1RF0A 3MD0A 2J0GA 3I5CA 2QM7A 1SFCC 2OYIA 5AVSB 2NPSB 1FZFA 2J61B 1J2JB 2WPQA 2J64A 1MV8A 1N86C 1J1DC 1LWUA 3H6PA 1NWQA 2M3BA 2HODC 2FXMA 2KYVA 5AW5B 1N7LA 1GU4A 1W2EA 3VMZA 5KLVK 4M7HA 3TNUA 1FZFC 1HTLC 3P7KA 1JCDA 1QL1A 2OYIB 1RF0C 1VPCA 2J3UA 2J58A 2FYUK 4JF7A 2J3OA 1FZAB 2R32A 2J5ZA 2XV5A 1FOSE 4I6MC 1JY3O 4I1LA 2W27A 2H7HA 3BVHB 4W80A 2IX7C 1FIBA 2H43B 3RK3B 4JYBA 1CI6A 3LIEA 2Q9IC 1LT9B 4IFFA 1FAVA 1JY3P 3V2RA 2VRSA 1M7LA 3HD7A 1L0LK 1LGHB 1IK9A 1FZDA 1RY3A 4JYCA 1Z56A 4WBAA 2YNYA 2J1GA 4LLHA 1CI6B 2YO3A 1NO4A 2WT7B 1KILB 1Z3SA 2H8PD 1CZQA 5AW6B 5APQA 1JO5A 1RF0B 3B5NA 2PAJA 2N9BA 4WY4D 2W6AA 2OARA 1FZFB 2WWWA 1OXZA 1ZV8A 3UIAA 2J3FA 1NU1K 3H32C 1G2CA 1G1IA 1JTHB 4JZCA 1LWUB 4M3LA 3M9HA 1GK4A 2WNPF 2OYHA 1JY3N 2J3GA 1GTWA 1LTAC 2Q3IA 1JOCA 1N2DC 3B5NB 2WTYA 3RL0D 2J59M 2HFED 1E5WA 1ZR4A 3R2PA 2E42A 4IFDK 1X79B 3HTKA 1L4AC 1LTJB 1RE4A 1URQA 1NH4A 1GL2A 1FZCA 2IFMA 3BVHA 2Q5UA 3MTUE 1JNMA 1RE3C 1YTZT 4C7NB 1MFZA 3KDPB 1T8ZA 3V2NA 1JC9A 1A02J 1JMMA 2P7JA 4AUWA 1CSBA 1IFMA 3A7OA 3P8MC 2BASA 1GL2B 1ZN5A 1HUCA 3BASA 3G3ZA 5AW7B 5APVA 1RF1B 1GD2E 2GUSA 2FFDC 2CPSA 4AYCA 1KFNA 1RE4C 3CLQA 2GM4A 3V2QA 1FIDA 1J1EB 3SWFA 2P1JA 1HBWA 2YKOA 3HD7D 1H88A 2XNXA 1N7SA 2O1JA 1M1JC 2O01H 3M06A 2HYNA 1FJPA 3HRNA 5AVQB 4JYOX 4WY4A 2R5BA 2XZRA 1X8YA 1N7SC 2XNXC 1LTJC 1L4AB 2JHMF 1FZAC 2HLOC 1KFMA 3B5NC 1CW5A 2HLOB 1T2KC 2W6BA 2M8RA 3KPEA 3KQGA 2C9NY 5AVYB 2Z4EA 1HJBA 1M1JB 3LIDA 3B8EB 3OAKA 1SP4A 4WY4C 2FFDA 5AW8B 4Y99C 1VDFA 4NYTA 1FDMA 1T3JA 5APXA 1KILC 1SFCB 5APSA 5CCGC 3HE5A 5BVZA 4EOTA 4GIFA 1HGZA 1RF1A 3E1IC 5BU5A 2J0YA 1GL2C 2YMYA 4AQRD 4KHXA 1FOSF 2A45I 4XA4A 2JHIF 3II6A 1H89A 1AQ5A 3RK3C 5APUA 1N7SB 2OYHC 1GL2D 1OWAA 3NTNA 3M91A 2WITA 3H32A 3BVHC 3PP5A 3A3YB 3M9BA 1X9VA 1L4AA 1URQC 2OYIC 2ZXEB 3EFGA 3OA7A 1NAFA 3TYYA 2FKWB 1HGVA 2A45H 1FZEC 3V2PA 3FIBA 1NHLA 3M0DA 4WB4A 2PP6A 1ZLLA 4IFMA 4M7FA 2FFDB 2P67A 5CCHD 2C9LY 2CPBA 5AW2B 1NOHA 3L37A 1IO4A 3VYIA 1LT9C 1HVVA 1LTGC 1HH0A 1SFCA 4W7ZA 2D39A 5AW1B 3GHGA 1N7SD 1MUUA 2J3FD 3MIWA 5APTA 3VMYA 3P8CE 1PFIA 4GT1A 2H43C 3U59A 2WPRA 1FZGC 2P2UA 1SVFA 2E43A 2J60A 2NPSA 1FU1A 2C0XA 1NKZB 3HD7C 1NTMK 3HE4A 1ZR2A 3P8CD 1FZEB 3HUSB 2Q9IA 1GU5A 1GK6A 1IFIA 3OJAB 2HODA 1LWUC 2XU6A 2HPCC 1FZBB 4B86A 2O1KA 3M0DC 2WPSA 1FZEA 2WT7A 3O8ZA 1T3UA 2NPSC 1HWTC 1LTTC 1FICA 3HUSC 2POHA 1FZGB 2Z5IA 1DEBA 2H43A 1FJKA 2R3CA 2KP8A 3N4XA 3N7NA 2OYHB 1L4AD 3HD7B 3VP8A 3CL3D 1IJDB 3E1IB 3EQ2A 1JY2P 1LTIC 1JUNA 5CJ0A 2J61A 3CI9A 1IFNA 2WSFH 1YTZI 3U1CA 1IC2A 2IFNA 5AVVB 3RK2C 1RE4B 2KOGA 5CMZA 4ZKPA 1FZCB 3VP9A 5AVWB 5CCHC 3E1IA 1IFJA 4C7NA 4N78E 2WZ7A 5AVZB 3NXSA 3HE4B 4EPUA 2FYZA 3T97A 1G2CB 1JTHA 4Y99B 1FZAA 1KILA 3L35A 4LGDE 1FZBC 1JCCA 3V4WA 4XE5B 4EIJA 5AVTB 2HODB 5BU8B 2QM8A 1JY2N 3V4QA 5KTBA 2N1TB 2Z4EC 2NPSD 3C9IA 1QL2A 4O9BA 5KJ7C 4LC1A 5AVXB 4GKGA 2XNXB 1SQXK 1S9KD 2J0HA 3IFMA 3VOPA 3HTKB 2N1TA 3RK2D 2L5GB 5CCGA 1GW4A 1J1EC 1KQLA 3WMM0 3V5BA 1S9KE 3BRTB 5AW3B 1YYCA 3RL0B 1L0NK 1FZCC 2GUVA 3RL0C 2JHKF 1RE3B 3NFQA 2Q7CA 3VMXA 2IPPA 1LTBC 2KSJA 1RF1C 3BRVB 5APWA 1SFCD 3MGNA 1LTJA 1URQB 1N73C 4WY4B 1T2KD 3L36A 5AVRB 1RE3A 1SQQK 1SLQA 2N1TC 2YKQA 2JEEA 2MJZA 1SQVK 4ZFGA 3TSIA 3LW5H 2WSEH 4HH2A 1N73A 5AW0B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J3U A;  1FIC A;  4R9T A;  2J3O A;  3HUS C;  2Z4E A;  1FZA B;  2HLO A;  2J5Z A;  1FZG B;  1JY3 O;  1M1J B;  2H43 A;  2FFD A;  3BVH B;  2JHL F;  1FIB A;  4NYT A;  2OYH B;  1M1J A;  2H43 B;  2Q9I C;  3E1I B;  1JY2 P;  1LT9 B;  2J2P A;  1JY3 P;  2J61 A;  1FZD A;  1RF1 A;  3E1I C;  1RE4 B;  2J0Y A;  1FZC B;  2J1G A;  3E1I A;  2A45 I;  1RF0 B;  2JHI F;  4EPU A;  1FZA A;  2Z4E B;  3GHG B;  1FZB C;  1FZF B;  2OYH C;  2J3F A;  2A45 G;  3H32 C;  4JZC A;  1LWU B;  2HOD B;  3H32 A;  2WNP F;  3BVH C;  2OYH A;  2HPC B;  1JY3 N;  2J3G A;  1JY2 N;  1N73 B;  1N86 B;  2Z4E C;  3H32 B;  2OYI C;  2GY7 A;  2A45 H;  1FZE C;  1LTJ B;  2XNX B;  1RE4 A;  3FIB A;  2HPC A;  1FZC A;  2J0H A;  4M7F A;  3BVH A;  2FFD B;  1JY2 O;  2JHH C;  1N86 A;  1RE3 C;  2FIB A;  1FZB A;  1Z3U A;  3GHG C;  1JC9 A;  1LT9 A;  1LT9 C;  2D39 A;  3GHG A;  1RF1 B;  2J3F D;  1FZG A;  4R9J A;  2FFD C;  1FZC C;  1FZE A;  2H43 C;  2JHK F;  1RE3 B;  1RE4 C;  1FZG C;  1RF1 C;  3HUS A;  1FID A;  2J60 A;  2Q9I B;  1RF0 A;  2J0G A;  2OYI A;  1FZE B;  3HUS B;  2Q9I A;  1LTJ A;  2XNX A;  1N73 C;  1FZF A;  2J61 B;  1M1J C;  1RE3 A;  2J64 A;  1N86 C;  1LWU A;  2HOD A;  1LWU C;  2HOD C;  4JYO X;  4ZFG A;  1W2E A;  2HPC C;  1FZB B;  4M7H A;  1FZF C;  1N73 A;  1LTJ C;  2XNX C;  2JHM F;  1FZA C;  2HLO C;  2OYI B;  1Z3S A;  2HLO B;  1T3U A;  1RF0 C; 
#chains in the Genus database with same CATH topology
 2BCC D;  1K73 Q;  4WWI A;  1SQX D;  1K9M Q;  1ZRT D;  1S5L H;  3L71 D;  5CCH A;  3TK1 A;  5TIS H;  4N3Y B;  3H1I D;  1M1J A;  2KSE A;  4IL6 X;  1GZL A;  3CCS P;  3NMD A;  4C46 A;  1QEX A;  3AED C;  1PIX A;  1KQF B;  2FY8 A;  4DZO A;  5AW4 B;  3HE5 B;  3MHV A;  1ZME C;  3M9Q A;  4D6T E;  2WSC J;  2MKV A;  1NU1 D;  2WPV B;  1NTK D;  1VQP P;  1N8R Q;  4Y28 J;  1VF5 C;  4HYT B;  1N73 B;  3H32 B;  5KJ7 A;  4Z1M H;  3VN0 A;  3P32 A;  2GY7 A;  3CXH I;  2E74 B;  1KB9 E;  2I1J A;  5KAF E;  3BAT A;  2E75 B;  2M5A A;  1JM0 A;  2P58 A;  3AEC C;  3RK2 B;  1KZU B;  5CHX A;  2N1T D;  1M8O B;  2H88 C;  4RJT A;  2QM7 A;  1SFC C;  1YJW P;  1FZF A;  2WPQ A;  2J64 A;  1MV8 A;  1J1D C;  1NWQ A;  2KYV A;  3I56 P;  5B66 E;  2AEM A;  3P7K A;  3CCE P;  1JCD A;  1KN7 A;  2J58 A;  4JF7 A;  1FZA B;  2R32 A;  2J5Z A;  2XV5 A;  1EZV D;  2IBZ G;  1BCC J;  1BCC D;  3BVH B;  4W80 A;  3QWO C;  2H43 B;  1CI6 A;  1VQ7 P;  1LT9 B;  4YPC A;  4L73 A;  3V2R A;  1PPJ E;  1L0L K;  2QRX A;  4LLH A;  3GF3 A;  1L0N E;  1EC5 A;  2H8P D;  1CZQ A;  1USD A;  1S1C X;  3MP7 B;  4WY4 D;  2B87 B;  1FZF B;  3H32 C;  1G2C A;  4JZC A;  4M3L A;  3A0B H;  3M9H A;  2OYH A;  3L72 D;  1LTA C;  1OW8 A;  1GMJ A;  3AE3 C;  2WTY A;  2BCC J;  2J59 M;  2HFE D;  4EYY Q;  2ZYA A;  1X79 B;  1BE3 D;  1L4A C;  1YBK A;  1JEK A;  1RE3 C;  1SQP J;  4C7N B;  3CME P;  4A7P A;  2ZJS E;  1T8Z A;  1JMM A;  2KNC A;  2LR2 A;  3A7O A;  1GL2 B;  1RF1 B;  1GD2 E;  1RE4 C;  3TDK A;  2QG4 A;  2XNX A;  2B87 A;  5AVQ B;  1P84 H;  1R5S A;  2XNX C;  1UIX A;  1KYO D;  1CW5 A;  2P10 A;  2M8R A;  2ZYD A;  3TGU D;  1YI2 P;  3RBZ A;  2YIU B;  1NTK E;  2DW3 A;  3SFD C;  5B66 H;  3ITK A;  4Y99 C;  1EDJ A;  1FDM A;  4BRY A;  4H44 C;  3CC2 P;  5APS A;  1VQL P;  1RHZ B;  3HE5 A;  3BCC D;  3C8V A;  1HGZ A;  1RF1 A;  5BU5 A;  3L75 D;  1AJY A;  1Q82 Q;  3L75 G;  1E79 H;  1FOS F;  3KHU A;  1Q7Y Q;  2FYN B;  3RK3 C;  2GA1 A;  3M91 A;  2WIT A;  3H32 A;  3M9B A;  2IDB A;  3RGU A;  3TYY A;  2Y9Y A;  4PD4 E;  2PP6 A;  4OGQ D;  4M7F A;  2P67 A;  2C9L Y;  2CPB A;  2KIK A;  5AW2 B;  1NOH A;  3AE1 C;  1HVV A;  2D39 A;  3KXD A;  3L71 J;  3GHG A;  1FS0 E;  1MUU A;  3GF7 A;  5APT A;  1PFI A;  3U59 A;  1SQB J;  2C0X A;  2KI7 B;  1ZR2 A;  1P84 D;  1FZE B;  1GU5 A;  1PPJ G;  4U3F G;  3WU2 E;  3OJA B;  2HOD A;  3H1J E;  1NYH A;  3O8Z A;  1YHQ P;  1L0L D;  2KK7 A;  2AXT E;  3CWB E;  2ZAE B;  1BE3 J;  4HB1 A;  4EDF A;  1DEB A;  1OVU A;  1L0L E;  1PGQ A;  2IBZ I;  1LTI C;  1VQ4 P;  1PP9 E;  1PGO A;  1SQQ J;  4R4M A;  5CJ0 A;  2J61 A;  1IFN A;  2IFN A;  5AVV B;  5KAF H;  2IYO A;  2JDI H;  4ZKP A;  2QVA A;  3E1I A;  2BCC E;  3O6Q B;  3HE4 B;  4ASV A;  1G2C B;  3L35 A;  4LGD E;  4PJ0 E;  1JCC A;  3V4W A;  5AVT B;  2QM8 A;  4KJM A;  1BCC G;  2I8D A;  1L0N J;  4O9B A;  5KJ7 C;  5AVX B;  2XNX B;  1W2B O;  1PZQ A;  1SQQ E;  3VOP A;  3RK2 D;  5CCG A;  1GW4 A;  3BRT B;  5AW3 B;  1EDL A;  1YYC A;  1SQQ D;  1SQV J;  3H1L D;  4XFJ A;  1K04 A;  1L0N K;  2JP3 A;  3RL0 C;  3VMX A;  1RF1 C;  3BRV B;  5APW A;  3CC4 P;  1N73 C;  3KZI H;  4WY4 B;  2V7Q H;  5GTH E;  1S5L X;  1SLQ A;  2E5T A;  2JEE A;  1OIP A;  4HH2 A;  1YJ9 P;  3CXH H;  5AW0 B;  5AVU B;  1ZP0 C;  1R5L A;  3H1K D;  1PPJ D;  1SQV E;  3M0A A;  3A2A A;  2J5U A;  2LXC B;  1BGY D;  4RES B;  3JCU E;  1SQB E;  5K5G B;  2AEF A;  2LKM A;  1GW3 A;  4DT0 A;  1GDT A;  2IZ1 A;  3A5T A;  3TGU G;  1AQT A;  2RMZ A;  3GHG B;  1NKN A;  1URQ D;  1A02 F;  4ZKU A;  3GMA A;  4HKZ H;  4DOJ A;  1AVY A;  5CJ4 A;  5CBN A;  1N86 B;  3H1I G;  2H89 C;  1SQX G;  2JJL A;  2HPC A;  1AFO A;  3AE8 C;  1J1D B;  2JHH C;  2WSS H;  3AE6 C;  2E76 B;  3JCU H;  2YKP A;  3U1A A;  1WRG A;  1NTM D;  5C39 A;  2Q6Q A;  2B88 A;  2K3R A;  1OZH A;  3HUS A;  2R5D A;  1DH3 A;  1RF0 A;  3MD0 A;  2J0G A;  3I5C A;  3IN6 A;  5AVS B;  2NPS B;  2J61 B;  2FXM A;  1RQU A;  3Q1M A;  1GU4 A;  3VMZ A;  3AE9 C;  2W6J H;  2E74 C;  5B5E H;  3L70 E;  5KAI E;  3S4R A;  1JY3 O;  1Q90 D;  2W27 A;  1KMI Z;  4JBZ A;  3L71 G;  2IX7 C;  1NTZ E;  2RN0 A;  1JY3 P;  1M7L A;  3H1I E;  3HD7 A;  1FZD A;  4ASW A;  2Y0D A;  2J1G A;  1CI6 B;  1QLE D;  5KKZ C;  1NO4 A;  2D2C B;  3TGU E;  2WT7 B;  1QVG O;  1JO5 A;  1RF0 B;  2PAJ A;  4U3F J;  1OXZ A;  3L73 J;  1KIL E;  1GK4 A;  1JY3 N;  2J3G A;  2Q3I A;  1JOC A;  3W67 A;  1K05 A;  3B5N B;  2A06 E;  1KD1 Q;  3EFF K;  1BSN A;  3S9O A;  1E5W A;  4L76 A;  3R2P A;  1ZR4 A;  2E42 A;  3C1L A;  1FZC A;  2ZT9 B;  3BVH A;  3MTU E;  1YTZ T;  1NGM B;  3WUT A;  1WMK A;  1IFM A;  3P8M C;  2BAS A;  1ZN5 A;  3G3Z A;  5KLI B;  5APV A;  2GUS A;  2ZVO B;  5GTH H;  2FFD C;  2CPS A;  2RH0 A;  3CLQ A;  1K8A Q;  3ZDM A;  4H44 B;  1IZN B;  1SQV D;  3SWF A;  2YKO A;  2KZJ A;  1NJI Q;  3L75 J;  2O01 H;  1EZV G;  3HRN A;  4JYO X;  5DJT B;  4WY4 A;  2XZR A;  3AEB C;  1FDI A;  1N7S C;  2NRG A;  3TF5 A;  1LTJ C;  1FZA C;  3FGA D;  2LXB A;  1L0N D;  1T2K C;  2PFX A;  3Q5R A;  3LID A;  1JB0 J;  1SP4 A;  2K37 A;  4NYT A;  1SFC B;  3L72 E;  3CD6 P;  5CCG C;  1Y9B A;  1OW7 A;  2J0Y A;  1GL2 C;  3D71 A;  3H1H D;  3IF4 A;  4U7J A;  2M5A B;  2JKV A;  1ZRT E;  5DJU B;  2WSF J;  3S1K A;  5APU A;  1OWA A;  3AE7 C;  3RK3 E;  3G71 P;  4IL6 H;  1URQ C;  2ZVN B;  2OYI C;  3OA7 A;  1NAF A;  1HGV A;  2A45 H;  3FWN A;  1KQS O;  3M0D A;  4IFM A;  1OX3 A;  4GOE A;  1BE3 G;  1BE3 E;  4W7Z A;  1Q86 Q;  3PLN A;  2J3F D;  5L8R J;  3VMY A;  1USE A;  3P8C E;  4GT1 A;  1SVF A;  2J60 A;  2NPS A;  1ZXG A;  3D6Y A;  3L70 J;  1NTM K;  2KZI A;  3CCR P;  4H0L B;  3HUS B;  1S72 P;  3K5B A;  3H1H J;  2HPC C;  1FZB B;  2WPS A;  2O3J A;  3H1I J;  3H1L E;  2M0B A;  2NPS C;  1FIC A;  2KXP B;  2POH A;  1VF5 D;  3A0B E;  1FZG B;  2NZ2 A;  2FYN C;  2OYH B;  3HD7 B;  1L0L J;  3VP8 A;  3H25 A;  1JY2 P;  3AEA C;  3OW2 O;  1BGY J;  2WSF H;  1YTZ I;  3RK2 C;  5CMZ A;  4YXW H;  2K88 A;  4TT3 H;  3VP9 A;  2JR8 A;  4C7N A;  4N78 E;  5AVZ B;  4EPU A;  2FYZ A;  1IK7 A;  4Y99 B;  3L75 E;  1KIL A;  1FZB C;  2QE7 H;  2HOD B;  4NPE A;  2OQQ A;  2Z4E C;  1QL2 A;  2L91 A;  4H0L C;  1MFT A;  1Q81 Q;  1M56 D;  4IOI H;  4LC1 A;  1P84 E;  1SQX K;  3CCV P;  1S9K D;  2J0H A;  1Y8A A;  3CCQ P;  2L5G B;  3Q3D A;  1KQL A;  3V5B A;  2OTK E;  5TJH A;  3MUD C;  3Q5S A;  2GUV A;  3D6Z A;  2JHK F;  3NFQ A;  4CPG A;  4PV1 C;  2WVR A;  3L73 G;  3WUV A;  1SFC D;  1NU1 G;  1VQ9 P;  1LTJ A;  1URQ B;  1PGP A;  2QJY B;  3L36 A;  3V6I A;  1R8E A;  2N1T C;  4HJG H;  2MJZ A;  4ZFG A;  3LW5 H;  3CPW O;  1WT6 A;  1NTZ D;  4R9T A;  4UB6 E;  3E1R A;  4I2L C;  2JHL F;  2Z5H A;  3RK3 D;  3G4S P;  3CWB D;  5E79 E;  3IR9 A;  2J2P A;  2AEJ A;  3PJS K;  4D6T D;  1DX7 A;  3SWY A;  1JMB A;  3MUD A;  2XKM A;  2KB7 P;  1KYO H;  2WQY C;  2KLV A;  2Z4E B;  2E76 D;  1L2P A;  4C7R A;  1DEE G;  3KYQ A;  1NU1 E;  3TNU B;  2WMM A;  3AEE C;  1LTS C;  5APY A;  2FYU J;  3BCC E;  2V7Q J;  1KYO I;  5KJ7 D;  2M3E A;  4MN4 C;  1SQV G;  2HR3 A;  2B9B A;  1N86 A;  2FIB A;  1Z3U A;  4GOF A;  2QIW A;  2WSC H;  2C0W A;  4JPZ B;  1KIL D;  3L72 J;  5AW9 B;  2YO2 A;  2YXR B;  2AXC A;  1QX8 A;  3VTP C;  1FZG A;  2JO1 A;  1HJ0 A;  1NTK K;  1VQK P;  2HG5 D;  2QSI A;  2Q9I B;  2ZFC A;  4PD4 D;  2FYU E;  3G9R A;  2OYI A;  3L74 J;  1J2J B;  1N86 C;  1LWU A;  2M3B A;  4IL6 E;  5AW5 B;  1N7L A;  4H13 C;  1ZW0 A;  5KLV K;  3TNU A;  1HTL C;  1QL1 A;  3O6Q A;  1RF0 C;  4I7Z B;  2J3U A;  1M57 D;  1KB9 H;  2FYU K;  2J3O A;  2D2C C;  3B4S A;  1VF5 B;  1FOS E;  4I6M C;  1RQV A;  2BEQ D;  4TLF A;  2Q9I C;  1FAV A;  2VRS A;  5KAI H;  3FWL A;  1IK9 A;  3CCL P;  3L70 G;  3H1J D;  1Z56 A;  4WBA A;  4OWF A;  1DD3 A;  4GDO A;  1KIL B;  2Q1K A;  1TU3 F;  5AW6 B;  3SFE C;  5APQ A;  3KZI E;  2FXO A;  2W6A A;  2OAR A;  2WWW A;  3UIA A;  1NU1 K;  4DCK A;  1G1I A;  1JTH B;  1LWU B;  1BDC A;  3H1L G;  1N2D C;  1PP9 G;  4OGQ C;  5KLV J;  4IFD K;  1URQ A;  1LTJ B;  5KLV G;  1L0L G;  1GL2 A;  2B89 A;  2IFM A;  1U7M A;  1PV3 A;  3KDP B;  3V2N A;  1A02 J;  1BSH A;  1CSB A;  3BAS A;  5AW7 B;  2QJK B;  1SQX E;  1QVF O;  4AYC A;  1KFN A;  2G8Y A;  3ABV C;  4U3F E;  2QJP B;  1J1E B;  1P84 I;  2P1J A;  1HBW A;  2O01 N;  1N7S A;  2O1J A;  1M1J C;  3Q2Y A;  4H13 D;  3M06 A;  2HYN A;  2ZT9 C;  1X8Y A;  1X0T A;  2JHM F;  2HLO C;  1EXI A;  1KFM A;  1ZOY C;  3L74 G;  2WSE J;  3MZW B;  2BCC G;  3KQG A;  1SQP E;  2C9N Y;  5AVY B;  1VQ5 P;  5CBO A;  3B8E B;  1S4X A;  5AW8 B;  1VL2 A;  2O01 J;  1T3J A;  4PJ0 H;  1KIL C;  1BDD A;  3SSU A;  2KS1 B;  1OVV A;  3GLM A;  3H1K J;  1OMI A;  2YMY A;  1EXJ A;  4BRY B;  1LJ2 A;  4ZNC A;  2A45 I;  4XA4 A;  1H89 A;  1AQ5 A;  4YTP C;  3TGU J;  3PP5 A;  4H13 B;  3A3Y B;  4DJG A;  4I7Z C;  1X9V A;  2UWJ E;  1VQO P;  3H1H G;  2G3A A;  1FZE C;  3V2P A;  1NHL A;  4WB4 A;  3H1L J;  2IBZ E;  3L37 A;  3A0H E;  1IO4 A;  1SFC A;  1LTG C;  1SQQ G;  2H43 C;  1BGY G;  2WPR A;  1Q2N A;  2P2U A;  5GTI H;  3G6E P;  1FU1 A;  3HD7 C;  2QA4 P;  2K9J B;  2Q9I A;  2OGU A;  3CX5 H;  1NTM J;  2Y9Z A;  1YJN P;  1OFC X;  4RKU J;  1LWU C;  2XU6 A;  1YIJ P;  4NPD A;  3BCC G;  4B86 A;  2O1K A;  3M0D C;  1FZE A;  2WT7 A;  3CCU P;  4PD4 H;  1HWT C;  1LTT C;  3B71 A;  3HUS C;  2D2C D;  5M1B A;  2IYP A;  4RO0 A;  1FJK A;  2KP8 A;  3L72 G;  2PRR A;  3CL3 D;  3EQ2 A;  1JUN A;  3CI9 A;  3U1C A;  1IC2 A;  2KOG A;  1FZC B;  1KQG B;  1KC8 Q;  5KLI C;  1NTZ G;  3L70 D;  3PTZ A;  2K9J A;  3T97 A;  5KLV E;  1JTH A;  1FZA A;  3H1J J;  2R44 A;  1IFP A;  1U7J A;  4XE5 B;  3CX5 E;  4EIJ A;  5BU8 B;  4KT0 J;  2K9Y A;  1JY2 N;  2N1T B;  1AV1 A;  1FDO A;  2NPS D;  3C9I A;  4U3F D;  2V4H A;  5EFW B;  3L73 D;  3PHL A;  4GKG A;  2OYO A;  2OTJ P;  3L73 E;  1W5C E;  2E75 D;  2PGD A;  3WUU A;  2E74 D;  3RL0 B;  1FZC C;  1RE3 B;  1OW6 A;  2Q7C A;  2IPP A;  2KSJ A;  3AE4 C;  2BEZ F;  3IAO A;  4PD4 I;  1PL5 A;  1T6A A;  2W8Z A;  1PGJ A;  3TSI A;  2IZ0 A;  4R4L A;  1N73 A;  3H1K E;  1Z3S A;  1YIT P;  1L0N G;  1NTM G;  4N78 D;  2QJP C;  2HLO A;  1SQB K;  2FYU G;  1H8A A;  3BCC J;  1HF9 A;  1G1J A;  3QH9 A;  2FYU D;  4BXL A;  1X22 A;  1XTC C;  3WU2 H;  1SQB D;  3Q5P A;  1NTZ K;  1MKM A;  3SWK A;  3F89 A;  1NTK J;  1VQ6 P;  4K3A A;  4ZMD A;  1BGY E;  2E76 C;  3FXE A;  1EQ7 A;  5CCG D;  4N6J A;  4L74 A;  2I1K A;  1YQ4 C;  2ITA A;  1IFD A;  2A45 G;  1H0T B;  2HPC B;  1D7M A;  2QJY C;  1SQP K;  1MZ9 A;  3A0H H;  3L4F A;  3I55 P;  3AEF C;  3B5N D;  1M1K Q;  5B5E E;  3CCM P;  1KTM A;  3R4Y A;  1EZV I;  3F5H A;  1JY2 O;  4QMA A;  1FZB A;  3GHG C;  2JWD A;  1LT9 A;  1NTM E;  4W7Y A;  3H1K G;  1FBM A;  4OH8 B;  4R9J A;  2W90 A;  2XND H;  1XTG B;  2ZYG A;  1NAY A;  1LP1 B;  2XDJ A;  1OVR A;  2JWA A;  4NPF X;  4BWN A;  2ZXX A;  1PP9 D;  3H6P A;  2HOD C;  4EI2 A;  1W2E A;  2Q3E A;  1FZF C;  4M7H A;  3L74 D;  2OYI B;  1VPC A;  1SS1 A;  1SQX J;  4I1L A;  1KOR A;  2H7H A;  1FIB A;  3RK3 B;  4JYB A;  3LIE A;  3AE2 C;  1M90 Q;  4IFF A;  1LGH B;  1RY3 A;  4JYC A;  1DIP A;  1AVO A;  3VMA A;  2YNY A;  1KB9 D;  2YO3 A;  3RL0 g;  3T97 B;  4WVZ A;  3B5N A;  2N9B A;  1ZV8 A;  2J3F A;  2AXT H;  3D70 A;  2WNP F;  3PRJ A;  2YIU C;  3JSV C;  1VQ8 P;  1GTW A;  2YMK A;  4YXD C;  3RL0 D;  4OGQ B;  4UB6 H;  3HTK A;  1RE4 A;  1NH4 A;  4JQ0 D;  1S5L E;  2Q5U A;  1JNM A;  3USS A;  1U57 A;  1Y47 A;  2KUB A;  1NVO A;  1MFZ A;  1JC9 A;  2P7J A;  4AUW A;  5H2F H;  1HUC A;  4L75 A;  3GG2 A;  2GM4 A;  1BCC E;  3V2Q A;  1VQM P;  1LT1 A;  1FID A;  3PH0 A;  2K1A A;  1KB9 I;  3HD7 D;  1H88 A;  1FJP A;  1UII A;  2R5B A;  2Y0E A;  2A06 G;  1L4A B;  3B5N C;  1YQ3 C;  1FC2 C;  2HLO B;  2W6B A;  3KPE A;  4PV1 B;  1SQP G;  2Z4E A;  3RBX A;  4OVN F;  1HJB A;  1M1J B;  4PV1 D;  3OAK A;  4WY4 C;  5KKZ B;  2FFD A;  3CXH D;  1VDF A;  2OTL P;  5APX A;  1EZV E;  3EWK A;  3H1H E;  5BVZ A;  4EOT A;  4GIF A;  1RH5 B;  5TIS E;  3E1I C;  2QJK C;  1DD4 A;  3CWB G;  4AQR D;  3JC2 2;  4KHX A;  3L71 E;  2JHI F;  3II6 A;  2SPZ A;  1N7S B;  2OYH C;  1GL2 D;  4H0L D;  3NTN A;  3BVH C;  5H2F E;  1L4A A;  1H0T A;  2KLU A;  3CC7 P;  2ZXE B;  3EFG A;  2FKW B;  2CK3 H;  4H44 D;  3FIB A;  4GOD A;  1ZLL A;  2FFD B;  5CCH D;  5KLV D;  3VYI A;  2R3S A;  1LT9 C;  1HH0 A;  2N9Y B;  5AW1 B;  3CX5 D;  3L74 E;  1N7S D;  3CX5 I;  3MIW A;  2ZT9 D;  4K35 A;  1FZG C;  2E43 A;  1NKZ B;  3FXD A;  3HE4 A;  1S3J A;  3P8C D;  1LP1 A;  1GK6 A;  4UB8 H;  5E79 H;  1IFI A;  1NTZ J;  1KV4 A;  3H1J G;  2YXQ B;  1T3U A;  1QGK B;  1EDI A;  1EDK A;  1KYO E;  2Z5I A;  2H43 A;  2R3C A;  3N4X A;  3N7N A;  1SQP D;  1L4A D;  2QEX P;  1IJD B;  3AE5 C;  3E1I B;  5GTI E;  1SQB G;  2A06 D;  2E75 C;  3CMA P;  1RE4 B;  1AA0 A;  2E5Y A;  2Y0C A;  5AVW B;  5CCH C;  1IFJ A;  2WZ7 A;  3NXS A;  3AEG C;  1NU1 J;  1FE6 A;  3CWB J;  3E7K A;  4UB8 E;  2W83 C;  3V4Q A;  5KTB A;  2RKL A;  1PP9 J;  3CCJ P;  2FXP A;  3IFM A;  3HTK B;  2N1T A;  1S2E A;  2KNC B;  1J1E C;  3WMM 0;  1S9K E;  3GW6 A;  2IBZ D;  1VQN P;  1LTB C;  3CXH E;  1NTK G;  3LW5 J;  2FBW C;  3W68 A;  3FX0 A;  3MGN A;  2KS1 A;  1T2K D;  5AVR B;  1RE3 A;  1SQQ K;  2YKQ A;  1SQV K;  2WSE H;  4D6T J;  1LNQ A;  4D6T G; 
#chains in the Genus database with same CATH homology
 1WT6 A;  5AVU B;  4N78 D;  4R9T A;  2HLO A;  5CCH A;  1SQB K;  3TK1 A;  4I2L C;  4N3Y B;  1H8A A;  2JHL F;  2Z5H A;  1G1J A;  3RK3 D;  1M1J A;  3M0A A;  1XTC C;  3A2A A;  1GZL A;  3IR9 A;  3NMD A;  2J2P A;  4C46 A;  1NTZ K;  4RES B;  4DZO A;  5AW4 B;  1DX7 A;  3HE5 B;  3SWY A;  3MUD A;  2XKM A;  3M9Q A;  2KB7 P;  1EQ7 A;  5CCG D;  2LKM A;  4N6J A;  1GW3 A;  1GDT A;  2I1K A;  2KLV A;  3A5T A;  2Z4E B;  3GHG B;  1NKN A;  4C7R A;  1URQ D;  1A02 F;  1IFD A;  4ZKU A;  2A45 G;  3KYQ A;  4DOJ A;  4HYT B;  2HPC B;  3TNU B;  5CJ4 A;  1N73 B;  1SQP K;  1MZ9 A;  1N86 B;  1LTS C;  3H32 B;  5APY A;  5KJ7 A;  3VN0 A;  3L4F A;  3P32 A;  2GY7 A;  3B5N D;  2JJL A;  5KJ7 D;  2HPC A;  2I1J A;  1AFO A;  1J1D B;  1JY2 O;  3BAT A;  2JHH C;  1N86 A;  2FIB A;  1FZB A;  1Z3U A;  3GHG C;  2WSC H;  1LT9 A;  4W7Y A;  2C0W A;  1KIL D;  1FBM A;  5AW9 B;  2YO2 A;  3U1A A;  2YKP A;  3RK2 B;  3VTP C;  1FZG A;  1KZU B;  4OH8 B;  5CHX A;  4R9J A;  1WRG A;  1XTG B;  1NTK K;  2N1T D;  2HG5 D;  3HUS A;  2Q9I B;  2ZFC A;  2R5D A;  2XDJ A;  1DH3 A;  1RF0 A;  3MD0 A;  2J0G A;  3I5C A;  2QM7 A;  1SFC C;  2OYI A;  5AVS B;  2NPS B;  1FZF A;  2J61 B;  1J2J B;  2WPQ A;  2J64 A;  1MV8 A;  1N86 C;  1J1D C;  1LWU A;  3H6P A;  1NWQ A;  2M3B A;  2HOD C;  2FXM A;  2KYV A;  5AW5 B;  1N7L A;  1GU4 A;  1W2E A;  3VMZ A;  5KLV K;  4M7H A;  3TNU A;  1FZF C;  1HTL C;  3P7K A;  1JCD A;  1QL1 A;  2OYI B;  1RF0 C;  1VPC A;  2J3U A;  2J58 A;  2FYU K;  4JF7 A;  2J3O A;  1FZA B;  2R32 A;  2J5Z A;  2XV5 A;  1FOS E;  4I6M C;  1JY3 O;  4I1L A;  2W27 A;  2H7H A;  3BVH B;  4W80 A;  2IX7 C;  1FIB A;  2H43 B;  3RK3 B;  4JYB A;  1CI6 A;  3LIE A;  2Q9I C;  1LT9 B;  4IFF A;  1FAV A;  1JY3 P;  3V2R A;  2VRS A;  1M7L A;  3HD7 A;  1L0L K;  1LGH B;  1IK9 A;  1FZD A;  1RY3 A;  4JYC A;  1Z56 A;  4WBA A;  2YNY A;  2J1G A;  4LLH A;  1CI6 B;  2YO3 A;  1NO4 A;  2WT7 B;  1KIL B;  1Z3S A;  2H8P D;  1CZQ A;  5AW6 B;  5APQ A;  1JO5 A;  1RF0 B;  3B5N A;  2PAJ A;  2N9B A;  4WY4 D;  2W6A A;  2OAR A;  1FZF B;  2WWW A;  1OXZ A;  1ZV8 A;  3UIA A;  2J3F A;  1NU1 K;  3H32 C;  1G2C A;  1G1I A;  1JTH B;  4JZC A;  1LWU B;  4M3L A;  3M9H A;  1GK4 A;  2WNP F;  2OYH A;  1JY3 N;  2J3G A;  1GTW A;  1LTA C;  2Q3I A;  1JOC A;  1N2D C;  3B5N B;  2WTY A;  3RL0 D;  2J59 M;  2HFE D;  1E5W A;  1ZR4 A;  3R2P A;  2E42 A;  4IFD K;  1X79 B;  3HTK A;  1L4A C;  1LTJ B;  1RE4 A;  1URQ A;  1NH4 A;  1GL2 A;  1FZC A;  2IFM A;  3BVH A;  2Q5U A;  3MTU E;  1JNM A;  1RE3 C;  1YTZ T;  4C7N B;  1MFZ A;  3KDP B;  1T8Z A;  3V2N A;  1JC9 A;  1A02 J;  1JMM A;  2P7J A;  4AUW A;  1CSB A;  1IFM A;  3A7O A;  3P8M C;  2BAS A;  1GL2 B;  1ZN5 A;  1HUC A;  3BAS A;  3G3Z A;  5AW7 B;  5APV A;  1RF1 B;  1GD2 E;  2GUS A;  2FFD C;  2CPS A;  4AYC A;  1KFN A;  1RE4 C;  3CLQ A;  2GM4 A;  3V2Q A;  1FID A;  1J1E B;  3SWF A;  2P1J A;  1HBW A;  2YKO A;  3HD7 D;  1H88 A;  2XNX A;  1N7S A;  2O1J A;  1M1J C;  2O01 H;  3M06 A;  2HYN A;  1FJP A;  3HRN A;  5AVQ B;  4JYO X;  4WY4 A;  2R5B A;  2XZR A;  1X8Y A;  1N7S C;  2XNX C;  1LTJ C;  1L4A B;  2JHM F;  1FZA C;  2HLO C;  1KFM A;  3B5N C;  1CW5 A;  2HLO B;  1T2K C;  2W6B A;  2M8R A;  3KPE A;  3KQG A;  2C9N Y;  5AVY B;  2Z4E A;  1HJB A;  1M1J B;  3LID A;  3B8E B;  3OAK A;  1SP4 A;  4WY4 C;  2FFD A;  5AW8 B;  4Y99 C;  1VDF A;  4NYT A;  1FDM A;  1T3J A;  5APX A;  1KIL C;  1SFC B;  5APS A;  5CCG C;  3HE5 A;  5BVZ A;  4EOT A;  4GIF A;  1HGZ A;  1RF1 A;  3E1I C;  5BU5 A;  2J0Y A;  1GL2 C;  2YMY A;  4AQR D;  4KHX A;  1FOS F;  2A45 I;  4XA4 A;  2JHI F;  3II6 A;  1H89 A;  1AQ5 A;  3RK3 C;  5APU A;  1N7S B;  2OYH C;  1GL2 D;  1OWA A;  3NTN A;  3M91 A;  2WIT A;  3H32 A;  3BVH C;  3PP5 A;  3A3Y B;  3M9B A;  1X9V A;  1L4A A;  1URQ C;  2OYI C;  2ZXE B;  3EFG A;  3OA7 A;  1NAF A;  3TYY A;  2FKW B;  1HGV A;  2A45 H;  1FZE C;  3V2P A;  3FIB A;  1NHL A;  3M0D A;  4WB4 A;  2PP6 A;  1ZLL A;  4IFM A;  4M7F A;  2FFD B;  2P67 A;  5CCH D;  2C9L Y;  2CPB A;  5AW2 B;  1NOH A;  3L37 A;  1IO4 A;  3VYI A;  1LT9 C;  1HVV A;  1LTG C;  1HH0 A;  1SFC A;  4W7Z A;  2D39 A;  5AW1 B;  3GHG A;  1N7S D;  1MUU A;  2J3F D;  3MIW A;  5APT A;  3VMY A;  3P8C E;  1PFI A;  4GT1 A;  2H43 C;  3U59 A;  2WPR A;  1FZG C;  2P2U A;  1SVF A;  2E43 A;  2J60 A;  2NPS A;  1FU1 A;  2C0X A;  1NKZ B;  3HD7 C;  1NTM K;  3HE4 A;  1ZR2 A;  3P8C D;  1FZE B;  3HUS B;  2Q9I A;  1GU5 A;  1GK6 A;  1IFI A;  3OJA B;  2HOD A;  1LWU C;  2XU6 A;  2HPC C;  1FZB B;  4B86 A;  2O1K A;  3M0D C;  2WPS A;  1FZE A;  2WT7 A;  3O8Z A;  1T3U A;  2NPS C;  1HWT C;  1LTT C;  1FIC A;  3HUS C;  2POH A;  1FZG B;  2Z5I A;  1DEB A;  2H43 A;  1FJK A;  2R3C A;  2KP8 A;  3N4X A;  3N7N A;  2OYH B;  1L4A D;  3HD7 B;  3VP8 A;  3CL3 D;  1IJD B;  3E1I B;  3EQ2 A;  1JY2 P;  1LTI C;  1JUN A;  5CJ0 A;  2J61 A;  3CI9 A;  1IFN A;  2WSF H;  1YTZ I;  3U1C A;  1IC2 A;  2IFN A;  5AVV B;  3RK2 C;  1RE4 B;  2KOG A;  5CMZ A;  4ZKP A;  1FZC B;  3VP9 A;  5AVW B;  5CCH C;  3E1I A;  1IFJ A;  4C7N A;  4N78 E;  2WZ7 A;  5AVZ B;  3NXS A;  3HE4 B;  4EPU A;  2FYZ A;  3T97 A;  1G2C B;  1JTH A;  4Y99 B;  1FZA A;  1KIL A;  3L35 A;  4LGD E;  1FZB C;  1JCC A;  3V4W A;  4XE5 B;  4EIJ A;  5AVT B;  2HOD B;  5BU8 B;  2QM8 A;  1JY2 N;  3V4Q A;  5KTB A;  2N1T B;  2Z4E C;  2NPS D;  3C9I A;  1QL2 A;  4O9B A;  5KJ7 C;  4LC1 A;  5AVX B;  4GKG A;  2XNX B;  1SQX K;  1S9K D;  2J0H A;  3IFM A;  3VOP A;  3HTK B;  2N1T A;  3RK2 D;  2L5G B;  5CCG A;  1GW4 A;  1J1E C;  1KQL A;  3WMM 0;  3V5B A;  1S9K E;  3BRT B;  5AW3 B;  1YYC A;  3RL0 B;  1L0N K;  1FZC C;  2GUV A;  3RL0 C;  2JHK F;  1RE3 B;  3NFQ A;  2Q7C A;  3VMX A;  2IPP A;  1LTB C;  2KSJ A;  1RF1 C;  3BRV B;  5APW A;  1SFC D;  3MGN A;  1LTJ A;  1URQ B;  1N73 C;  4WY4 B;  1T2K D;  3L36 A;  5AVR B;  1RE3 A;  1SQQ K;  1SLQ A;  2N1T C;  2YKQ A;  2JEE A;  2MJZ A;  1SQV K;  4ZFG A;  3TSI A;  3LW5 H;  2WSE H;  4HH2 A;  1N73 A;  5AW0 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...