3HUSB

Crystal structure of recombinant gamma n308k fibrinogen fragment d with the peptide ligand gly-pro-arg-pro-amide
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
303
structure length
303
Chain Sequence
TVNSNIPTNLRVLRSILENLRSKIQKLESDVSAQMEYCRTPCTVSCNIPVVSGKECEEIIRKGGETSEMYLIQPDSSVKPYRVYCDMNTENGGWTVIQNRQDGSVDFGRKWDPYKQGFGNVATNTDGKNYCGLPGEYWLGNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGGFTVQNEANKYQISVNKYRGTAGNALMDGASQLMGENRTMTIHNGMFFSTYDRDNDGWLTSDPRKQCSKEDGGGWWYNRCHAANPNGRYYWGGQYTWDMAKHGTDDGVVWMNWKGSWYSMRKMSMKIRPFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Impaired protofibril formation in fibrinogen gammaN308K is due to altered D:D and "A:a" interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
molecule keywords Fibrinogen alpha chain
total genus 75
structure length 303
sequence length 303
chains with identical sequence E
ec nomenclature
pdb deposition date 2009-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3husB01
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 3husB02
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 3husB03
1N73A 2J60A 2JHIF 2A45H 2HODA 1FZCC 2GY7A 3H32A 1Z3SA 2JHHC 1FZFC 1FZGB 1LT9A 2Z4EA 4R9TA 4EPUA 1FZBC 3BVHC 1LTJB 2HLOC 1N86B 2A45G 2J3FA 1LT9B 1FZGA 1N86C 2J0YA 3HUSC 1LTJC 2J3OA 4ZFGA 1JY3N 1FZEC 2H43C 2J2PA 2HODB 2OYHA 2Q9IB 2HPCA 2J3GA 1N73B 3E1IC 1JY2O 2XNXA 1N73C 1RE3B 1RF0B 1M1JC 2OYIA 1FZEB 3H32C 4JYOX 1FZDA 1JC9A 3GHGA 2Z4EC 1RF1B 1RF0C 2HLOB 1FICA 2J61A 1FZAA 1W2EA 3BVHA 2Q9IC 1FZBB 2FIBA 4R9JA 2FFDA 3HUSA 2J1GA 1FZFB 1Z3UA 1RE4B 4M7HA 1RE4A 4M7FA 1FZCB 2H43A 3HUSB 2FFDB 1LWUA 2OYHC 4NYTA 3E1IA 3BVHB 1FIDA 2J3FD 2XNXC 2J61B 1JY2N 2JHKF 1M1JB 1RF1A 1M1JA 2OYIC 1RE3C 3E1IB 4JZCA 3GHGC 2HODC 1RF0A 1LWUB 2JHMF 2H43B 1FZCA 2J0HA 1FZAC 2J3UA 2XNXB 1FZFA 1JY3O 2Q9IA 2HPCB 2D39A 2OYHB 1LT9C 1JY3P 1FIBA 1FZBA 2FFDC 1FZAB 1RE4C 2HLOA 1LWUC 3GHGB 1FZGC 1N86A 3FIBA 1LTJA 1JY2P 2JHLF 2WNPF 1FZEA 2OYIB 2J0GA 1T3UA 1RF1C 2Z4EB 2A45I 1RE3A 2HPCC 2J5ZA 2J64A 3H32B
chains in the Genus database with same CATH superfamily
2W6AA 3V4QA 4PJ0H 4ASWA 1L0LK 1NVOA 4EPUA 3PTZA 4C7NA 1CI6A 1PPJE 4GODA 4HB1A 3RL0B 1S4XA 3GF7A 1KILB 1LT9B 2QJKB 3GLMA 3HUSC 5CCHA 3PJSK 1KYOE 1NH4A 1NWQA 1PP9G 1JY2O 4H0LB 4W7ZA 4TLFA 4PD4E 3CMAP 5KLVJ 2Z4EC 1LTTC 1RF0C 1FZAA 3JCUH 4EDFA 4R9JA 1AQ5A 3Q5SA 4IL6H 3O8ZA 4Z1MH 3TDKA 3BVHB 2M0BA 4PD4D 5KLIB 1FDIA 3ABVC 1GW3A 1KYOD 1BCCG 2B88A 5TJHA 1J1DB 1EDKA 4PV1D 2FYNC 1URQC 2PP6A 3CC7P 1DD3A 3H1ID 1S2EA 4PJ0E 1Q82Q 3ZDMA 2KI7B 2A45I 1RY3A 2KZJA 1KC8Q 1X79B 2J60A 1PZQA 1IK7A 4IL6E 5KLIC 3BVHC 1AVYA 3RK3D 3H1HE 2OYOA 1EDLA 2CK3H 2Q6QA 3HE5A 1KTMA 1KB9D 3PP5A 1U7MA 3TNUB 1T2KC 3CCLP 1N73B 1IFMA 1J1EB 3MUDA 3N7NA 2K88A 1VQMP 1HBWA 1FDMA 4PD4H 5AW8B 1L0NG 5GTIH 1BGYG 2AEJA 1PP9D 2H8PD 3GHGA 2I8DA 2PGDA 3LW5H 1KILD 1KQGB 1GK4A 3I5CA 4PV1B 1HF9A 5E79E 3HUSA 3P7KA 1FZFB 2ITAA 1FZCB 2FFDB 3VMXA 4BRYA 3E1IA 2E74B 1DX7A 2JHKF 1J1DC 5CCGD 1Y9BA 2YXQB 1P84H 1RF0A 3IR9A 1OW8A 5KTBA 3M0DA 2D2CC 2D39A 1FIBA 2Q3IA 3A0HH 5CCHD 2WPRA 3FXEA 1YI2P 1X8YA 4NPEA 1L4AA 1PGQA 2IBZI 3VP9A 2E5TA 1SQPJ 3H1KE 1NKNA 4UB6H 2Z4EB 2Y9ZA 1YJNP 5C39A 3G71P 1NTZE 3BCCJ 4H0LD 1Z3SA 2JHHC 2YKOA 4R9TA 1L0LE 4I7ZC 3AE5C 2LR2A 2WWWA 4XE5B 1FU1A 3LW5J 1NTKK 5AW9B 2NPSA 2WSSH 1JY3N 1N7SA 2BASA 1D7MA 5KJ7A 4ZNCA 2E74D 1L0ND 3L73J 4A7PA 3PHLA 4RJTA 1USEA 3WUTA 1U57A 1L4AB 2JEEA 3M9BA 3V2QA 2ZYAA 1W2EA 2Y0EA 2KS1A 1ZR4A 3EFGA 1NTKD 1QLED 4YTPC 2E43A 2O1JA 3ITKA 4YPCA 1PPJD 2QM7A 3V6IA 3E1IB 3GHGC 1LWUB 2IZ1A 2GA1A 1FZCA 2J0HA 1SQBK 2WSFJ 3RGUA 1YQ4C 3H1HD 3HRNA 1FDOA 4M3LA 3H1JG 1N7SB 2MJZA 1KN7A 3CWBG 2FYNB 3G9RA 3FIBA 3LIEA 3H6PA 1FZEA 5B5EH 3QWOC 1SQBE 5APSA 3TF5A 1YJWP 2HPCC 1EDIA 2P67A 1VQ5P 1Q90D 2QJPB 2QSIA 5KKZB 1NTMG 1YJ9P 3CCJP 1NU1E 2QG4A 3E1RA 3M0DC 1SQPG 2ZVOB 2JP3A 2YNYA 2I1KA 3CXHE 3U1AA 2H88C 2W27A 1P84E 3AE7C 3II6A 4IL6X 4EI2A 2SPZA 2WTYA 3RK2D 2JWAA 1OW6A 3H1HJ 2L5GB 5B66H 2HODB 5CJ4A 3A7OA 2W6JH 1JCDA 3KHUA 2KSEA 1JO5A 4OGQD 1GU4A 2WT7B 2W90A 3OA7A 3KQGA 1IJDB 3M9HA 1HGVA 3FXDA 2IFMA 2FFDA 1JMMA 1K05A 1N7SC 4R4MA 1DIPA 2JR8A 1S5LE 5AW4B 2AXTH 3MHVA 1SQQK 1JY2N 3TGUE 1HGZA 2AXCA 1RF1A 1M1JA 3U59A 1FOSF 3L35A 4WY4B 4D6TG 2HODC 2WPSA 1AV1A 4IFMA 4RESB 1FZAB 5KAFE 4L73A 4JYCA 3P32A 1KZUB 4DZOA 3SSUA 3HD7A 1SQXD 1GL2B 1VQOP 3TYYA 2FBWC 3H1LG 3SFEC 1HWTC 2IZ0A 1LT9A 3A5TA 2YMYA 2R5BA 4LLHA 3AE4C 1FZEC 3KYQA 3CXHD 1OIPA 1Z56A 2E75D 1KILE 1SS1A 3C9IA 2I1JA 3CMEP 2WQYC 4L74A 3M91A 4OVNF 2HLOB 2J5UA 2KUBA 1T2KD 3IAOA 3RBXA 3SWFA 2ZT9C 3CCQP 4LGDE 3CC4P 1FJKA 3OJAB 1J2JB 2KS1B 2QJPC 2YO2A 2FYUE 1H0TA 3FX0A 3SWKA 1BDCA 2VRSA 1KYOH 4H13B 3VMYA 3NFQA 2IDBA 4H44C 4OGQB 3L75D 1MZ9A 2ZT9D 4K3AA 1JY3O 2E42A 2OARA 5DJTB 1ZRTD 4U3FG 5KAIE 2BEZF 1S9KE 4D6TJ 1VQ7P 2FXPA 1WT6A 3B71A 2HFED 4U3FD 3L70G 1W2BO 3JSVC 1IFPA 1FE6A 4BXLA 4C7RA 3TK1A 2KP8A 3RK2B 3CX5I 1RE3A 1EZVG 1SQQD 3L72J 2W6BA 1ZLLA 2Z4EA 4H13C 3RL0g 1FJPA 1HTLC 2WITA 1L4AC 2BEQD 3AE1C 3Q5RA 3IN6A 5KLVG 2WSCJ 3S9OA 2OYIA 1VPCA 2WSCH 1N7LA 4AQRD 2M5AA 1T3JA 5DJUB 1S3JA 5APXA 1IFIA 1L0NE 1AVOA 3WU2E 1BGYE 3WMM0 1L0LD 4GT1A 1NKZB 2XV5A 1RE4A 1NOHA 2QJKC 1YITP 1IO4A 1FAVA 3Q2YA 1GMJA 1FIDA 1JM0A 3H1LD 3AECC 1JB0J 1SQXG 2BCCJ 4K35A 1YYCA 3L74G 1GL2C 3KZIH 1PGPA 2IBZD 2Y0DA 2OYHB 1HUCA 2K9JA 4NPFX 3H1KD 3LIDA 2WSEJ 2HLOA 5AVWB 1N86A 2O3JA 3KDPB 2IBZG 3G6EP 1OVUA 4I2LC 2YO3A 3L70E 4D6TD 2IPPA 2JHIF 3CCEP 1CW5A 1WMKA 1JMBA 1PIXA 1Y47A 3FWNA 5AW0B 1JOCA 3FGAD 1FZFC 4YXDC 1FZGB 1YTZT 1S5LH 1OX3A 1TU3F 2E76C 1HJ0A 4B86A 3EFFK 4W80A 2J3FA 1L0LG 1JTHA 4L75A 1NHLA 3L75E 3SWYA 1S72P 1QL1A 5APYA 3BRTB 3RK3C 5CHXA 5GTIE 5H2FE 1PFIA 1X22A 3E7KA 5KLVD 1ZP0C 3H1IJ 2ZT9B 4UB6E 2Q1KA 1OZHA 3OAKA 4EIJA 4M7FA 1VQ9P 1N7SD 2KZIA 3C8VA 2E75B 4N3YB 2P2UA 2XU6A 1VF5B 4I1LA 4NPDA 3HE4A 3USSA 3BRVB 2AEFA 1SP4A 2H43B 1CZQA 1VQLP 1G2CA 2K37A 4Y28J 2Q9IA 1LTGC 5KAIH 5GTHE 3H1JD 5APTA 2QE7H 3CCVP 3H1HG 3H1JE 3SFDC 2WNPF 3VMZA 2D2CD 1CI6B 2AEMA 5CJ0A 1SQXK 1SQXJ 3T97B 2IBZE 2ZVNB 5CBNA 4ASVA 1GL2A 3H32A 2BCCD 3WUVA 2Z5HA 2QVAA 1KV4A 1NTKG 1SQVJ 1LTIC 1SQVG 1N86C 4XFJA 5AVSB 1LTSC 2C0WA 3TGUD 1NU1D 2ZJSE 2FYZA 1JEKA 3AEAC 1FZEB 3L72D 4WY4A 1NO4A 2FKWB 1JC9A 3RL0C 3CXHI 1KQLA 1BGYJ 2KXPB 2R5DA 4Y99C 3IF4A 4JQ0D 5AW6B 2J1GA 1Z3UA 1G2CB 5AVRB 2HYNA 2H43A 3B5NB 1P84D 2O01N 2XNXC 4MN4C 2J61B 3TSIA 2A06E 2WT7A 1M7LA 3IFMA 1YQ3C 3N4XA 3BCCD 1BE3E 2JHMF 3L71E 2CPBA 2FYUD 1QVFO 4I6MC 1EDJA 1VQPP 1SQQJ 2KYVA 4AYCA 2LXBA 3KZIE 3P8MC 1GU5A 4N78D 4DOJA 3JCUE 2JWDA 2QIWA 4QMAA 1BCCE 2RKLA 1L0NK 3EWKA 3V5BA 1SFCD 2GUVA 5APVA 1HJBA 2RH0A 3V2RA 3H1LE 4EYYQ 1N2DC 3L75J 1FZGA 3A3YB 3PH0A 2KIKA 1QGKB 2KNCB 3E1IC 2M3BA 4GIFA 1HH0A 1M1JC 1VQ4P 2B9BA 3CWBJ 2ZYGA 2R3CA 2KSJA 2GM4A 1LP1B 3L70J 2JO1A 1JNMA 1GZLA 1IFJA 1M90Q 3G4SP 2IX7C 5KKZC 3CWBE 3AE3C 1SVFA 3MGNA 1SQPD 3HD7C 2B87B 2YKQA 3AEFC 2KK7A 2V7QJ 1NTME 2E5YA 2C9NY 1BE3G 3CWBD 1BE3D 1LWUC 2N9BA 1LTJA 5CMZA 4U3FE 5TISH 2L91A 2OYIB 3D70A 1N73A 1URQB 1E79H 1MFZA 2HG5D 1G1IA 1FZBC 2JDIH 3O6QA 1RQUA 2D2CB 3VYIA 2LXCB 3JC22 3B5ND 3CXHH 3EQ2A 1NTZG 1GD2E 1RF0B 2W83C 3T97A 3Q5PA 2M3EA 3WUUA 3HTKB 1X9VA 1U7JA 2N1TA 3AE6C 1IFNA 2QM8A 2QRXA 5CCHC 3AE2C 4L76A 5AVXB 3HUSB 1K9MQ 2G3AA 5APUA 4JZCA 1BDDA 1URQD 3CD6P 3V4WA 1DEEG 1VL2A 3CCUP 4HJGH 2QA4P 4R4LA 5AVUB 3I56P 3HE5B 1SFCB 5KAFH 5AW3B 4KT0J 1OFCX 2OQQA 3W68A 2N1TD 4HKZH 1S1CX 1OXZA 1KYOI 1ZOYC 2Y0CA 1NAFA 1OVRA 3PRJA 3S1KA 3BASA 1IK9A 4IFFA 2AXTE 1DEBA 3M9QA 1PGOA 1UIXA 3CCSP 1IFDA 1LTJC 1K73Q 1KFNA 4YXWH 1GTWA 5KJ7D 1PGJA 4OGQC 2J3GA 3G3ZA 1J1EC 1N73C 1BGYD 3U1CA 1BSNA 1NU1G 1NTZD 3HD7B 1OWAA 3H32C 4JYOX 3VMAA 1BCCJ 5EFWB 2YMKA 3Q1MA 3BVHA 1MKMA 4WBAA 2PAJA 3CPWO 3B8EB 1LJ2A 1SQQE 2P7JA 1PP9E 2P58A 2Q5UA 3L73E 3C1LA 1KQFB 2BCCG 3MUDC 1K8AQ 3L71D 1M1JB 1ZV8A 1AFOA 1T6AA 2N1TC 1ZW0A 1OVVA 2XNXB 2WSFH 2WPQA 3H1LJ 1LT9C 2YIUC 3B5NC 1KILC 1KQSO 1JTHB 1AJYA 3M06A 3H1IG 3HTKA 1Q7YQ 3BCCE 2ZAEB 3MIWA 1DH3A 4XA4A 2YKPA 4GKGA 1OW7A 4HH2A 3A0BE 5AVVB 1BCCD 2OTJP 2FXMA 2O1KA 3CX5H 5AVQB 1NGMB 3NTNA 3OW2O 1RQVA 1YBKA 1N86B 1BE3J 1NTKE 1SFCA 1H8AA 1GW4A 4HYTB 4H0LC 2OYHA 1SQVE 4RKUJ 1FS0E 1M1KQ 2KB7P 1KMIZ 1RE3B 4H44D 1DD4A 2QJYB 1FZDA 4WWIA 4DCKA 3H25A 5AVTB 3I55P 1FICA 1R5SA 2Q9IC 4Y99B 1SQBJ 3CX5D 2OGUA 2NPSC 2XZRA 4M7HA 3QH9A 1A02F 3PLNA 4IFDK 1M8OB 2E76B 3VN0A 2N1TB 3HD7D 5APQA 3B4SA 1BSHA 1RE3C 2XNDH 1H0TB 3CCRP 1LTAC 2P10A 1FZAC 4C46A 2ZXEB 2OTKE 1JY3P 1LP1A 2J58A 1OMIA 3KXDA 1CSBA 1ZMEC 2FYUG 2CPSA 5BVZA 4GOFA 2PFXA 1MV8A 1WRGA 1YTZI 4WY4D 3H1IE 3BCCG 1XTGB 3CCMP 3H1JJ 1QVGO 2M8RA 1W5CE 1IZNB 5L8RJ 2GUSA 1PL5A 1URQA 2Q3EA 2P1JA 1T8ZA 2NPSB 2IYOA 1S9KD 1YHQP 3AE8C 1LTJB 2Z5IA 2A45G 3K5BA 4ZFGA 4DJGA 2H43C 3D71A 1R5LA 3CI9A 3KPEA 2JKVA 2HPCA 1EZVE 4PV1C 2XNXA 3L72G 3P8CE 1L0LJ 2A06D 3NMDA 3TGUG 2G8YA 2XDJA 3CL3D 1KB9I 2E75C 2ZYDA 2B87A 2HR3A 4GOEA 5B66E 1NJIQ 1USDA 2WVRA 1SQVD 2IYPA 1H89A 1HVVA 1SFCC 4WVZA 5KLVE 2OYHC 4NYTA 2WSEH 3AE9C 1N8RQ 1JCCA 4OH8B 3L71J 3MD0A 1EC5A 3GW6A 4OWFA 2E74C 1FZFA 2MKVA 2O01H 2W8ZA 3RK3E 2YIUB 2KNCA 3RK2C 4N6JA 2FFDC 1FOSE 1FBMA 1NU1K 1P84I 3GHGB 1FZGC 1JY2P 4GDOA 1Q2NA 2UWJE 4JF7A 1SQPK 1RF1C 1ZR2A 4CPGA 1L0NJ 3L73D 2J64A 2ZXXA 3TNUA 1AQTA 2HODA 3S4RA 1SLQA 4H44B 4RO0A 3L36A 1L4AD 3RBZA 2Q7CA 5BU8B 1EXJA 1VQKP 1VQ6P 1NTKJ 1EXIA 1MUUA 1NYHA 2K9YA 1SQBG 2J2PA 3L4FA 3CC2P 4KJMA 1LNQA 1AA0A 4PD4I 5H2FH 1PV3A 2A06G 5CCGA 5K5GB 1VDFA 2XKMA 3L72E 2QEXP 1RF1B 4W7YA 1NAYA 3F5HA 2FIBA 1QEXA 3A0BH 1LWUA 5GTHH 1KB9H 3AEEC 2JJLA 2R32A 5KJ7C 2FYUK 1EQ7A 3M0AA 3F89A 3VP8A 1H88A 1LTBC 4WB4A 2J3UA 2WZ7A 2Y9YA 3BATA 3CLQA 5KLVK 2FYUJ 2FXOA 3H1KG 1Q86Q 1RHZB 1PP9J 3RL0D 4JBZA 3CX5E 3O6QB 1VQNP 3MTUE 1ZN5A 3L74D 3NXSA 1T3UA 1M57D 1M56D 2JHLF 2KOGA 2YXRB 4U3FJ 5BU5A 1FZCC 2GY7A 4WY4C 5AW2B 2LKMA 1KILA 3Q3DA 1NTMJ 4C7NB 3GG2A 4ZMDA 4UB8H 2Q9IB 2FY8A 2KLVA 2N9YB 1VQ8P 2C0XA 3HE4B 4DT0A 3GF3A 1L2PA 1SQBD 3L74E 3L74J 1Q81Q 1KD1Q 2K9JB 1FZBB 2H7HA 3MP7B 4LC1A 1E5WA 1G1JA 2K3RA 3V2NA 4BWNA 1QX8A 1NTMD 1Y8AA 5CCGC 1R8EA 1QL2A 2OYIC 1SQQG 1EZVD 3L73G 1NTZK 2BCCE 1K04A 2DW3A 2WMMA 1GL2D 5B5EE 4UB8E 5AW1B 2V7QH 2O01J 3L37A 3AEDC 2HPCB 3TGUJ 2IFNA 3L70D 3A2AA 1S5LX 1YIJP 1RE4C 2B89A 4IOIH 1NTZJ 1VF5D 3AEGC 2J0GA 3L75G 4ZKUA 1SQPE 3H1KJ 3UIAA 2RN0A 2A45H 2ZFCA 4TT3H 2C9LY 1PPJG 3L71G 2OTLP 3D6ZA 1IC2A 4U7JA 2WPVB 1A02J 2RMZA 2HLOC 2KLUA 5AVZB 2PRRA 1X0TA 3D6YA 2J0YA 2J3OA 1EZVI 3W67A 2NZ2A 2K1AA 5CBOA 3V2PA 3VTPC 5APWA 3R2PA 1KB9E 4ZKPA 2E76D 2J59M 1MFTA 3GMAA 4H13D 1LT1A 1NTMK 5E79H 1ZXGA 2R44A 2J61A 3RK3B 2NRGA 4JPZB 1XTCC 3WU2H 1GDTA 3FWLA 1RH5B 5AVYB 3VOPA 4BRYB 3B5NA 1KORA 5TISE 1RE4B 1JUNA 4AUWA 4EOTA 2H89C 4D6TE 1FC2C 2J3FD 4I7ZB 3R4YA 2QJYC 3P8CD 5AW7B 2M5AB 3AEBC 1SQVK 1KFMA 1VF5C 4O9BA 4KHXA 5AW5B 2R3SA 1LGHB 1FZBA 2NPSD 1GK6A 4N78E 3MZWB 3A0HE 1NU1J 4JYBA 1UIIA 2POHA 2V4HA 1ZRTE 1SQXE 2J5ZA 5M1BA 3H32B
chains in the Genus database with same CATH topology
1GL2B 3V5BA 2W6AA 3TYYA 3V4QA 2M8RA 1HWTC 2GUSA 1URQA 1L0LK 2P1JA 1T8ZA 2NPSB 1SFCD 2GUVA 1LT9A 5APVA 3A5TA 1HJBA 4EPUA 2YMYA 3V2RA 4C7NA 1CI6A 1S9KD 3RL0B 1LTJB 1N2DC 1KILB 2Z5IA 2A45G 1LT9B 1FZGA 3A3YB 3HUSC 5CCHA 2R5BA 4ZFGA 4LLHA 1FZEC 2H43C 3KYQA 1NH4A 3CI9A 3KPEA 1Z56A 1NWQA 2HPCA 3E1IC 1JY2O 2XNXA 2M3BA 4GIFA 3P8CE 1HH0A 3NMDA 4W7ZA 1M1JC 3C9IA 2I1JA 2XDJA 3CL3D 2R3CA 3M91A 2Z4EC 1LTTC 1RF0C 2HLOB 1T2KD 2KSJA 2GM4A 1FZAA 3SWFA 1JNMA 1GZLA 4R9JA 4LGDE 1AQ5A 1IFJA 1H89A 2IX7C 1HVVA 1SFCC 1FJKA 3OJAB 3O8ZA 1J2JB 2OYHC 1SVFA 4NYTA 2YO2A 3MGNA 3BVHB 2WSEH 3HD7C 2VRSA 1JCCA 4OH8B 3VMYA 3NFQA 3MD0A 2YKQA 1GW3A 1J1DB 1MZ9A 1URQC 2PP6A 1FZFA 2C9NY 1JY3O 2O01H 2E42A 2OARA 3RK2C 4N6JA 2FFDC 1S9KE 1WT6A 1FOSE 2HFED 1LWUC 1FBMA 1NU1K 3GHGB 1FZGC 2N9BA 1LTJA 1JY2P 5CMZA 4C7RA 4JF7A 1SQPK 2OYIB 3TK1A 2KP8A 3RK2B 1RF1C 1ZR2A 2A45I 1RY3A 1RE3A 2J64A 1N73A 1URQB 1X79B 2J60A 3TNUA 2HODA 2W6BA 1MFZA 1ZLLA 2HG5D 1SLQA 3L36A 1G1IA 2Z4EA 1FJPA 1FZBC 1L4AD 2Q7CA 1HTLC 5BU8B 3BVHC 3RK3D 2WITA 1L4AC 1MUUA 3VYIA 3HE5A 3PP5A 2J2PA 3L4FA 3TNUB 1T2KC 1N73B 3B5ND 1IFMA 1J1EB 3MUDA 3EQ2A 3N7NA 1HBWA 1FDMA 5AW8B 1GD2E 1RF0B 3T97A 5CCGA 2OYIA 1VDFA 1VPCA 2WSCH 2XKMA 1N7LA 4AQRD 2H8PD 3GHGA 1RF1B 1T3JA 3HTKB 1X9VA 3LW5H 2N1TA 5APXA 1IFIA 1KILD 4W7YA 1IFNA 3WMM0 1GK4A 3I5CA 2FIBA 2QM8A 4GT1A 3HUSA 3P7KA 5CCHC 1NKZB 1FZFB 2XV5A 1RE4A 1FZCB 5AVXB 3HUSB 2FFDB 1LWUA 1NOHA 1IO4A 3VMXA 1FAVA 3E1IA 1FIDA 1DX7A 2JJLA 2JHKF 2R32A 5KJ7C 2FYUK 1EQ7A 1J1DC 5APUA 5CCGD 3M0AA 4JZCA 1RF0A 1URQD 3IR9A 1YYCA 1GL2C 3VP8A 1H88A 1LTBC 5KTBA 4WB4A 3V4WA 2J3UA 2WZ7A 3M0DA 2D39A 2OYHB 1FIBA 5AVUB 2Q3IA 3BATA 1HUCA 5CCHD 3CLQA 3HE5B 1SFCB 2WPRA 5KLVK 5AW3B 3LIDA 2HLOA 1X8YA 3RL0D 5AVWB 1N86A 1L4AA 3KDPB 2N1TD 3MTUE 1ZN5A 4I2LC 3VP9A 3NXSA 1OXZA 1NKNA 1T3UA 2YO3A 2Z4EB 2IPPA 2JHLF 1NAFA 2KOGA 2JHIF 1CW5A 3BASA 5BU5A 1FZCC 1IK9A 4IFFA 4WY4C 5AW0B 5AW2B 1JOCA 1Z3SA 2LKMA 2GY7A 2YKOA 2JHHC 1DEBA 1FZFC 3M9QA 1YTZT 1FZGB 4R9TA 1KILA 2WWWA 4B86A 1IFDA 4C7NB 4XE5B 4W80A 1FU1A 2J3FA 1NTKK 5AW9B 1LTJC 2NPSA 1JTHA 1KFNA 1JY3N 1GTWA 1N7SA 5KJ7D 1NHLA 3SWYA 2BASA 2Q9IB 1QL1A 2J3GA 3G3ZA 1J1EC 5APYA 3BRTB 1N73C 3RK3C 5CHXA 5KJ7A 3U1CA 2KLVA 3HD7B 1OWAA 3H32C 4JYOX 1PFIA 1L4AB 2C0XA 3HE4B 2JEEA 3M9BA 3V2QA 1W2EA 3BVHA 1FZBB 2H7HA 4WBAA 2PAJA 1ZR4A 4EIJA 3OAKA 3EFGA 4M7FA 3B8EB 4LC1A 1N7SD 2P7JA 1E5WA 1G1JA 2E43A 2Q5UA 3V2NA 2O1JA 4N3YB 2P2UA 2XU6A 4I1LA 1M1JB 2QM7A 3HE4A 5CCGC 1QL2A 2OYIC 3BRVB 1ZV8A 1NTZK 3E1IB 1AFOA 3GHGC 1SP4A 1LWUB 1GL2D 2N1TC 2H43B 1CZQA 1FZCA 1G2CA 1SQBK 2J0HA 5AW1B 2XNXB 3L37A 2WSFH 2WPQA 3HRNA 2HPCB 2Q9IA 4M3LA 2IFNA 1LT9C 1LTGC 3B5NC 1KILC 3A2AA 1N7SB 2MJZA 1RE4C 1JTHB 3M06A 5APTA 3HTKA 3FIBA 3LIEA 3MIWA 1DH3A 3H6PA 4XA4A 2WNPF 3VMZA 1FZEA 2YKPA 4GKGA 1CI6B 5CJ0A 1SQXK 5APSA 4HH2A 2J0GA 5AVVB 2HPCC 4ZKUA 2P67A 2FXMA 2O1KA 3UIAA 2A45H 2ZFCA 2C9LY 5AVQB 1GL2A 3H32A 3M0DC 2Z5HA 3NTNA 1IC2A 2YNYA 2I1KA 1A02J 1LTIC 2HLOC 3U1AA 5AVZB 1N86B 2W27A 1N86C 2J0YA 2J3OA 3II6A 2WTYA 3RK2D 1SFCA 1H8AA 2L5GB 1GW4A 5AVSB 1LTSC 4HYTB 2HODB 2OYHA 3V2PA 5CJ4A 3VTPC 2KB7P 3A7OA 5APWA 1RE3B 2C0WA 3R2PA 4ZKPA 2J59M 2FYZA 1JCDA 1FZEB 4WY4A 1NO4A 2FKWB 1FZDA 1JC9A 1JO5A 5AVTB 1NTMK 1GU4A 2WT7B 1FICA 3RK3B 2J61A 3OA7A 3RL0C 1KQLA 1XTCC 3KQGA 1GDTA 2Q9IC 4Y99B 5AVYB 3VOPA 1IJDB 3M9HA 1HGVA 3B5NA 2R5DA 2IFMA 4Y99C 2FFDA 5AW6B 2NPSC 1JMMA 2J1GA 2XZRA 1Z3UA 1RE4B 4M7HA 1A02F 1N7SC 1G2CB 5AVRB 1JUNA 2HYNA 2H43A 4IFDK 4AUWA 3B5NB 5AW4B 4EOTA 2J3FD 1SQQK 2XNXC 2J61B 1JY2N 3VN0A 3TSIA 2WT7A 2N1TB 3HD7D 5APQA 1M7LA 1HGZA 3IFMA 1RF1A 1M1JA 3P8CD 3U59A 1RE3C 5AW7B 1FOSF 3N4XA 3L35A 4WY4B 1SQVK 2HODC 1LTAC 1KFMA 2JHMF 2WPSA 1FZAC 4O9BA 2CPBA 4KHXA 5AW5B 4C46A 4IFMA 2ZXEB 1JY3P 1LGHB 1FZBA 2NPSD 4I6MC 4RESB 1GK6A 1FZAB 4N78E 2J58A 2KYVA 4JYCA 1CSBA 3P32A 1KZUB 4JYBA 4AYCA 4DZOA 2CPSA 5BVZA 2POHA 1MV8A 3HD7A 1WRGA 3P8MC 1GU5A 4N78D 4DOJA 1YTZI 4WY4D 2J5ZA 3H32B 1XTGB 1L0NK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N73 A;  2J60 A;  2JHI F;  2A45 H;  2HOD A;  1FZC C;  2GY7 A;  3H32 A;  1Z3S A;  2JHH C;  1FZF C;  1FZG B;  1LT9 A;  2Z4E A;  4R9T A;  4EPU A;  1FZB C;  3BVH C;  1LTJ B;  2HLO C;  1N86 B;  2A45 G;  2J3F A;  1LT9 B;  1FZG A;  1N86 C;  2J0Y A;  3HUS C;  1LTJ C;  2J3O A;  4ZFG A;  1JY3 N;  1FZE C;  2H43 C;  2J2P A;  2HOD B;  2OYH A;  2Q9I B;  2HPC A;  2J3G A;  1N73 B;  3E1I C;  1JY2 O;  2XNX A;  1N73 C;  1RE3 B;  1RF0 B;  1M1J C;  2OYI A;  1FZE B;  3H32 C;  4JYO X;  1FZD A;  1JC9 A;  3GHG A;  2Z4E C;  1RF1 B;  1RF0 C;  2HLO B;  1FIC A;  2J61 A;  1FZA A;  1W2E A;  3BVH A;  2Q9I C;  1FZB B;  2FIB A;  4R9J A;  2FFD A;  3HUS A;  2J1G A;  1FZF B;  1Z3U A;  1RE4 B;  4M7H A;  1RE4 A;  4M7F A;  1FZC B;  2H43 A;  3HUS B;  2FFD B;  1LWU A;  2OYH C;  4NYT A;  3E1I A;  3BVH B;  1FID A;  2J3F D;  2XNX C;  2J61 B;  1JY2 N;  2JHK F;  1M1J B;  1RF1 A;  1M1J A;  2OYI C;  1RE3 C;  3E1I B;  4JZC A;  3GHG C;  2HOD C;  1RF0 A;  1LWU B;  2JHM F;  2H43 B;  1FZC A;  2J0H A;  1FZA C;  2J3U A;  2XNX B;  1FZF A;  1JY3 O;  2Q9I A;  2HPC B;  2D39 A;  2OYH B;  1LT9 C;  1JY3 P;  1FIB A;  1FZB A;  2FFD C;  1FZA B;  1RE4 C;  2HLO A;  1LWU C;  3GHG B;  1FZG C;  1N86 A;  3FIB A;  1LTJ A;  1JY2 P;  2JHL F;  2WNP F;  1FZE A;  2OYI B;  2J0G A;  1T3U A;  1RF1 C;  2Z4E B;  2A45 I;  1RE3 A;  2HPC C;  2J5Z A;  2J64 A;  3H32 B; 
#chains in the Genus database with same CATH topology
 2W6A A;  3V4Q A;  4PJ0 H;  4ASW A;  1L0L K;  1NVO A;  4EPU A;  3PTZ A;  4C7N A;  1CI6 A;  1PPJ E;  4GOD A;  4HB1 A;  3RL0 B;  1S4X A;  3GF7 A;  1KIL B;  1LT9 B;  2QJK B;  3GLM A;  3HUS C;  5CCH A;  3PJS K;  1KYO E;  1NH4 A;  1NWQ A;  1PP9 G;  1JY2 O;  4H0L B;  4W7Z A;  4TLF A;  4PD4 E;  3CMA P;  5KLV J;  2Z4E C;  1LTT C;  1RF0 C;  1FZA A;  3JCU H;  4EDF A;  4R9J A;  1AQ5 A;  3Q5S A;  4IL6 H;  3O8Z A;  4Z1M H;  3TDK A;  3BVH B;  2M0B A;  4PD4 D;  5KLI B;  1FDI A;  3ABV C;  1GW3 A;  1KYO D;  1BCC G;  2B88 A;  5TJH A;  1J1D B;  1EDK A;  4PV1 D;  2FYN C;  1URQ C;  2PP6 A;  3CC7 P;  1DD3 A;  3H1I D;  1S2E A;  4PJ0 E;  1Q82 Q;  3ZDM A;  2KI7 B;  2A45 I;  1RY3 A;  2KZJ A;  1KC8 Q;  1X79 B;  2J60 A;  1PZQ A;  1IK7 A;  4IL6 E;  5KLI C;  3BVH C;  1AVY A;  3RK3 D;  3H1H E;  2OYO A;  1EDL A;  2CK3 H;  2Q6Q A;  3HE5 A;  1KTM A;  1KB9 D;  3PP5 A;  1U7M A;  3TNU B;  1T2K C;  3CCL P;  1N73 B;  1IFM A;  1J1E B;  3MUD A;  3N7N A;  2K88 A;  1VQM P;  1HBW A;  1FDM A;  4PD4 H;  5AW8 B;  1L0N G;  5GTI H;  1BGY G;  2AEJ A;  1PP9 D;  2H8P D;  3GHG A;  2I8D A;  2PGD A;  3LW5 H;  1KIL D;  1KQG B;  1GK4 A;  3I5C A;  4PV1 B;  1HF9 A;  5E79 E;  3HUS A;  3P7K A;  1FZF B;  2ITA A;  1FZC B;  2FFD B;  3VMX A;  4BRY A;  3E1I A;  2E74 B;  1DX7 A;  2JHK F;  1J1D C;  5CCG D;  1Y9B A;  2YXQ B;  1P84 H;  1RF0 A;  3IR9 A;  1OW8 A;  5KTB A;  3M0D A;  2D2C C;  2D39 A;  1FIB A;  2Q3I A;  3A0H H;  5CCH D;  2WPR A;  3FXE A;  1YI2 P;  1X8Y A;  4NPE A;  1L4A A;  1PGQ A;  2IBZ I;  3VP9 A;  2E5T A;  1SQP J;  3H1K E;  1NKN A;  4UB6 H;  2Z4E B;  2Y9Z A;  1YJN P;  5C39 A;  3G71 P;  1NTZ E;  3BCC J;  4H0L D;  1Z3S A;  2JHH C;  2YKO A;  4R9T A;  1L0L E;  4I7Z C;  3AE5 C;  2LR2 A;  2WWW A;  4XE5 B;  1FU1 A;  3LW5 J;  1NTK K;  5AW9 B;  2NPS A;  2WSS H;  1JY3 N;  1N7S A;  2BAS A;  1D7M A;  5KJ7 A;  4ZNC A;  2E74 D;  1L0N D;  3L73 J;  4A7P A;  3PHL A;  4RJT A;  1USE A;  3WUT A;  1U57 A;  1L4A B;  2JEE A;  3M9B A;  3V2Q A;  2ZYA A;  1W2E A;  2Y0E A;  2KS1 A;  1ZR4 A;  3EFG A;  1NTK D;  1QLE D;  4YTP C;  2E43 A;  2O1J A;  3ITK A;  4YPC A;  1PPJ D;  2QM7 A;  3V6I A;  3E1I B;  3GHG C;  1LWU B;  2IZ1 A;  2GA1 A;  1FZC A;  2J0H A;  1SQB K;  2WSF J;  3RGU A;  1YQ4 C;  3H1H D;  3HRN A;  1FDO A;  4M3L A;  3H1J G;  1N7S B;  2MJZ A;  1KN7 A;  3CWB G;  2FYN B;  3G9R A;  3FIB A;  3LIE A;  3H6P A;  1FZE A;  5B5E H;  3QWO C;  1SQB E;  5APS A;  3TF5 A;  1YJW P;  2HPC C;  1EDI A;  2P67 A;  1VQ5 P;  1Q90 D;  2QJP B;  2QSI A;  5KKZ B;  1NTM G;  1YJ9 P;  3CCJ P;  1NU1 E;  2QG4 A;  3E1R A;  3M0D C;  1SQP G;  2ZVO B;  2JP3 A;  2YNY A;  2I1K A;  3CXH E;  3U1A A;  2H88 C;  2W27 A;  1P84 E;  3AE7 C;  3II6 A;  4IL6 X;  4EI2 A;  2SPZ A;  2WTY A;  3RK2 D;  2JWA A;  1OW6 A;  3H1H J;  2L5G B;  5B66 H;  2HOD B;  5CJ4 A;  3A7O A;  2W6J H;  1JCD A;  3KHU A;  2KSE A;  1JO5 A;  4OGQ D;  1GU4 A;  2WT7 B;  2W90 A;  3OA7 A;  3KQG A;  1IJD B;  3M9H A;  1HGV A;  3FXD A;  2IFM A;  2FFD A;  1JMM A;  1K05 A;  1N7S C;  4R4M A;  1DIP A;  2JR8 A;  1S5L E;  5AW4 B;  2AXT H;  3MHV A;  1SQQ K;  1JY2 N;  3TGU E;  1HGZ A;  2AXC A;  1RF1 A;  1M1J A;  3U59 A;  1FOS F;  3L35 A;  4WY4 B;  4D6T G;  2HOD C;  2WPS A;  1AV1 A;  4IFM A;  4RES B;  1FZA B;  5KAF E;  4L73 A;  4JYC A;  3P32 A;  1KZU B;  4DZO A;  3SSU A;  3HD7 A;  1SQX D;  1GL2 B;  1VQO P;  3TYY A;  2FBW C;  3H1L G;  3SFE C;  1HWT C;  2IZ0 A;  1LT9 A;  3A5T A;  2YMY A;  2R5B A;  4LLH A;  3AE4 C;  1FZE C;  3KYQ A;  3CXH D;  1OIP A;  1Z56 A;  2E75 D;  1KIL E;  1SS1 A;  3C9I A;  2I1J A;  3CME P;  2WQY C;  4L74 A;  3M91 A;  4OVN F;  2HLO B;  2J5U A;  2KUB A;  1T2K D;  3IAO A;  3RBX A;  3SWF A;  2ZT9 C;  3CCQ P;  4LGD E;  3CC4 P;  1FJK A;  3OJA B;  1J2J B;  2KS1 B;  2QJP C;  2YO2 A;  2FYU E;  1H0T A;  3FX0 A;  3SWK A;  1BDC A;  2VRS A;  1KYO H;  4H13 B;  3VMY A;  3NFQ A;  2IDB A;  4H44 C;  4OGQ B;  3L75 D;  1MZ9 A;  2ZT9 D;  4K3A A;  1JY3 O;  2E42 A;  2OAR A;  5DJT B;  1ZRT D;  4U3F G;  5KAI E;  2BEZ F;  1S9K E;  4D6T J;  1VQ7 P;  2FXP A;  1WT6 A;  3B71 A;  2HFE D;  4U3F D;  3L70 G;  1W2B O;  3JSV C;  1IFP A;  1FE6 A;  4BXL A;  4C7R A;  3TK1 A;  2KP8 A;  3RK2 B;  3CX5 I;  1RE3 A;  1EZV G;  1SQQ D;  3L72 J;  2W6B A;  1ZLL A;  2Z4E A;  4H13 C;  3RL0 g;  1FJP A;  1HTL C;  2WIT A;  1L4A C;  2BEQ D;  3AE1 C;  3Q5R A;  3IN6 A;  5KLV G;  2WSC J;  3S9O A;  2OYI A;  1VPC A;  2WSC H;  1N7L A;  4AQR D;  2M5A A;  1T3J A;  5DJU B;  1S3J A;  5APX A;  1IFI A;  1L0N E;  1AVO A;  3WU2 E;  1BGY E;  3WMM 0;  1L0L D;  4GT1 A;  1NKZ B;  2XV5 A;  1RE4 A;  1NOH A;  2QJK C;  1YIT P;  1IO4 A;  1FAV A;  3Q2Y A;  1GMJ A;  1FID A;  1JM0 A;  3H1L D;  3AEC C;  1JB0 J;  1SQX G;  2BCC J;  4K35 A;  1YYC A;  3L74 G;  1GL2 C;  3KZI H;  1PGP A;  2IBZ D;  2Y0D A;  2OYH B;  1HUC A;  2K9J A;  4NPF X;  3H1K D;  3LID A;  2WSE J;  2HLO A;  5AVW B;  1N86 A;  2O3J A;  3KDP B;  2IBZ G;  3G6E P;  1OVU A;  4I2L C;  2YO3 A;  3L70 E;  4D6T D;  2IPP A;  2JHI F;  3CCE P;  1CW5 A;  1WMK A;  1JMB A;  1PIX A;  1Y47 A;  3FWN A;  5AW0 B;  1JOC A;  3FGA D;  1FZF C;  4YXD C;  1FZG B;  1YTZ T;  1S5L H;  1OX3 A;  1TU3 F;  2E76 C;  1HJ0 A;  4B86 A;  3EFF K;  4W80 A;  2J3F A;  1L0L G;  1JTH A;  4L75 A;  1NHL A;  3L75 E;  3SWY A;  1S72 P;  1QL1 A;  5APY A;  3BRT B;  3RK3 C;  5CHX A;  5GTI E;  5H2F E;  1PFI A;  1X22 A;  3E7K A;  5KLV D;  1ZP0 C;  3H1I J;  2ZT9 B;  4UB6 E;  2Q1K A;  1OZH A;  3OAK A;  4EIJ A;  4M7F A;  1VQ9 P;  1N7S D;  2KZI A;  3C8V A;  2E75 B;  4N3Y B;  2P2U A;  2XU6 A;  1VF5 B;  4I1L A;  4NPD A;  3HE4 A;  3USS A;  3BRV B;  2AEF A;  1SP4 A;  2H43 B;  1CZQ A;  1VQL P;  1G2C A;  2K37 A;  4Y28 J;  2Q9I A;  1LTG C;  5KAI H;  5GTH E;  3H1J D;  5APT A;  2QE7 H;  3CCV P;  3H1H G;  3H1J E;  3SFD C;  2WNP F;  3VMZ A;  2D2C D;  1CI6 B;  2AEM A;  5CJ0 A;  1SQX K;  1SQX J;  3T97 B;  2IBZ E;  2ZVN B;  5CBN A;  4ASV A;  1GL2 A;  3H32 A;  2BCC D;  3WUV A;  2Z5H A;  2QVA A;  1KV4 A;  1NTK G;  1SQV J;  1LTI C;  1SQV G;  1N86 C;  4XFJ A;  5AVS B;  1LTS C;  2C0W A;  3TGU D;  1NU1 D;  2ZJS E;  2FYZ A;  1JEK A;  3AEA C;  1FZE B;  3L72 D;  4WY4 A;  1NO4 A;  2FKW B;  1JC9 A;  3RL0 C;  3CXH I;  1KQL A;  1BGY J;  2KXP B;  2R5D A;  4Y99 C;  3IF4 A;  4JQ0 D;  5AW6 B;  2J1G A;  1Z3U A;  1G2C B;  5AVR B;  2HYN A;  2H43 A;  3B5N B;  1P84 D;  2O01 N;  2XNX C;  4MN4 C;  2J61 B;  3TSI A;  2A06 E;  2WT7 A;  1M7L A;  3IFM A;  1YQ3 C;  3N4X A;  3BCC D;  1BE3 E;  2JHM F;  3L71 E;  2CPB A;  2FYU D;  1QVF O;  4I6M C;  1EDJ A;  1VQP P;  1SQQ J;  2KYV A;  4AYC A;  2LXB A;  3KZI E;  3P8M C;  1GU5 A;  4N78 D;  4DOJ A;  3JCU E;  2JWD A;  2QIW A;  4QMA A;  1BCC E;  2RKL A;  1L0N K;  3EWK A;  3V5B A;  1SFC D;  2GUV A;  5APV A;  1HJB A;  2RH0 A;  3V2R A;  3H1L E;  4EYY Q;  1N2D C;  3L75 J;  1FZG A;  3A3Y B;  3PH0 A;  2KIK A;  1QGK B;  2KNC B;  3E1I C;  2M3B A;  4GIF A;  1HH0 A;  1M1J C;  1VQ4 P;  2B9B A;  3CWB J;  2ZYG A;  2R3C A;  2KSJ A;  2GM4 A;  1LP1 B;  3L70 J;  2JO1 A;  1JNM A;  1GZL A;  1IFJ A;  1M90 Q;  3G4S P;  2IX7 C;  5KKZ C;  3CWB E;  3AE3 C;  1SVF A;  3MGN A;  1SQP D;  3HD7 C;  2B87 B;  2YKQ A;  3AEF C;  2KK7 A;  2V7Q J;  1NTM E;  2E5Y A;  2C9N Y;  1BE3 G;  3CWB D;  1BE3 D;  1LWU C;  2N9B A;  1LTJ A;  5CMZ A;  4U3F E;  5TIS H;  2L91 A;  2OYI B;  3D70 A;  1N73 A;  1URQ B;  1E79 H;  1MFZ A;  2HG5 D;  1G1I A;  1FZB C;  2JDI H;  3O6Q A;  1RQU A;  2D2C B;  3VYI A;  2LXC B;  3JC2 2;  3B5N D;  3CXH H;  3EQ2 A;  1NTZ G;  1GD2 E;  1RF0 B;  2W83 C;  3T97 A;  3Q5P A;  2M3E A;  3WUU A;  3HTK B;  1X9V A;  1U7J A;  2N1T A;  3AE6 C;  1IFN A;  2QM8 A;  2QRX A;  5CCH C;  3AE2 C;  4L76 A;  5AVX B;  3HUS B;  1K9M Q;  2G3A A;  5APU A;  4JZC A;  1BDD A;  1URQ D;  3CD6 P;  3V4W A;  1DEE G;  1VL2 A;  3CCU P;  4HJG H;  2QA4 P;  4R4L A;  5AVU B;  3I56 P;  3HE5 B;  1SFC B;  5KAF H;  5AW3 B;  4KT0 J;  1OFC X;  2OQQ A;  3W68 A;  2N1T D;  4HKZ H;  1S1C X;  1OXZ A;  1KYO I;  1ZOY C;  2Y0C A;  1NAF A;  1OVR A;  3PRJ A;  3S1K A;  3BAS A;  1IK9 A;  4IFF A;  2AXT E;  1DEB A;  3M9Q A;  1PGO A;  1UIX A;  3CCS P;  1IFD A;  1LTJ C;  1K73 Q;  1KFN A;  4YXW H;  1GTW A;  5KJ7 D;  1PGJ A;  4OGQ C;  2J3G A;  3G3Z A;  1J1E C;  1N73 C;  1BGY D;  3U1C A;  1BSN A;  1NU1 G;  1NTZ D;  3HD7 B;  1OWA A;  3H32 C;  4JYO X;  3VMA A;  1BCC J;  5EFW B;  2YMK A;  3Q1M A;  3BVH A;  1MKM A;  4WBA A;  2PAJ A;  3CPW O;  3B8E B;  1LJ2 A;  1SQQ E;  2P7J A;  1PP9 E;  2P58 A;  2Q5U A;  3L73 E;  3C1L A;  1KQF B;  2BCC G;  3MUD C;  1K8A Q;  3L71 D;  1M1J B;  1ZV8 A;  1AFO A;  1T6A A;  2N1T C;  1ZW0 A;  1OVV A;  2XNX B;  2WSF H;  2WPQ A;  3H1L J;  1LT9 C;  2YIU C;  3B5N C;  1KIL C;  1KQS O;  1JTH B;  1AJY A;  3M06 A;  3H1I G;  3HTK A;  1Q7Y Q;  3BCC E;  2ZAE B;  3MIW A;  1DH3 A;  4XA4 A;  2YKP A;  4GKG A;  1OW7 A;  4HH2 A;  3A0B E;  5AVV B;  1BCC D;  2OTJ P;  2FXM A;  2O1K A;  3CX5 H;  5AVQ B;  1NGM B;  3NTN A;  3OW2 O;  1RQV A;  1YBK A;  1N86 B;  1BE3 J;  1NTK E;  1SFC A;  1H8A A;  1GW4 A;  4HYT B;  4H0L C;  2OYH A;  1SQV E;  4RKU J;  1FS0 E;  1M1K Q;  2KB7 P;  1KMI Z;  1RE3 B;  4H44 D;  1DD4 A;  2QJY B;  1FZD A;  4WWI A;  4DCK A;  3H25 A;  5AVT B;  3I55 P;  1FIC A;  1R5S A;  2Q9I C;  4Y99 B;  1SQB J;  3CX5 D;  2OGU A;  2NPS C;  2XZR A;  4M7H A;  3QH9 A;  1A02 F;  3PLN A;  4IFD K;  1M8O B;  2E76 B;  3VN0 A;  2N1T B;  3HD7 D;  5APQ A;  3B4S A;  1BSH A;  1RE3 C;  2XND H;  1H0T B;  3CCR P;  1LTA C;  2P10 A;  1FZA C;  4C46 A;  2ZXE B;  2OTK E;  1JY3 P;  1LP1 A;  2J58 A;  1OMI A;  3KXD A;  1CSB A;  1ZME C;  2FYU G;  2CPS A;  5BVZ A;  4GOF A;  2PFX A;  1MV8 A;  1WRG A;  1YTZ I;  4WY4 D;  3H1I E;  3BCC G;  1XTG B;  3CCM P;  3H1J J;  1QVG O;  2M8R A;  1W5C E;  1IZN B;  5L8R J;  2GUS A;  1PL5 A;  1URQ A;  2Q3E A;  2P1J A;  1T8Z A;  2NPS B;  2IYO A;  1S9K D;  1YHQ P;  3AE8 C;  1LTJ B;  2Z5I A;  2A45 G;  3K5B A;  4ZFG A;  4DJG A;  2H43 C;  3D71 A;  1R5L A;  3CI9 A;  3KPE A;  2JKV A;  2HPC A;  1EZV E;  4PV1 C;  2XNX A;  3L72 G;  3P8C E;  1L0L J;  2A06 D;  3NMD A;  3TGU G;  2G8Y A;  2XDJ A;  3CL3 D;  1KB9 I;  2E75 C;  2ZYD A;  2B87 A;  2HR3 A;  4GOE A;  5B66 E;  1NJI Q;  1USD A;  2WVR A;  1SQV D;  2IYP A;  1H89 A;  1HVV A;  1SFC C;  4WVZ A;  5KLV E;  2OYH C;  4NYT A;  2WSE H;  3AE9 C;  1N8R Q;  1JCC A;  4OH8 B;  3L71 J;  3MD0 A;  1EC5 A;  3GW6 A;  4OWF A;  2E74 C;  1FZF A;  2MKV A;  2O01 H;  2W8Z A;  3RK3 E;  2YIU B;  2KNC A;  3RK2 C;  4N6J A;  2FFD C;  1FOS E;  1FBM A;  1NU1 K;  1P84 I;  3GHG B;  1FZG C;  1JY2 P;  4GDO A;  1Q2N A;  2UWJ E;  4JF7 A;  1SQP K;  1RF1 C;  1ZR2 A;  4CPG A;  1L0N J;  3L73 D;  2J64 A;  2ZXX A;  3TNU A;  1AQT A;  2HOD A;  3S4R A;  1SLQ A;  4H44 B;  4RO0 A;  3L36 A;  1L4A D;  3RBZ A;  2Q7C A;  5BU8 B;  1EXJ A;  1VQK P;  1VQ6 P;  1NTK J;  1EXI A;  1MUU A;  1NYH A;  2K9Y A;  1SQB G;  2J2P A;  3L4F A;  3CC2 P;  4KJM A;  1LNQ A;  1AA0 A;  4PD4 I;  5H2F H;  1PV3 A;  2A06 G;  5CCG A;  5K5G B;  1VDF A;  2XKM A;  3L72 E;  2QEX P;  1RF1 B;  4W7Y A;  1NAY A;  3F5H A;  2FIB A;  1QEX A;  3A0B H;  1LWU A;  5GTH H;  1KB9 H;  3AEE C;  2JJL A;  2R32 A;  5KJ7 C;  2FYU K;  1EQ7 A;  3M0A A;  3F89 A;  3VP8 A;  1H88 A;  1LTB C;  4WB4 A;  2J3U A;  2WZ7 A;  2Y9Y A;  3BAT A;  3CLQ A;  5KLV K;  2FYU J;  2FXO A;  3H1K G;  1Q86 Q;  1RHZ B;  1PP9 J;  3RL0 D;  4JBZ A;  3CX5 E;  3O6Q B;  1VQN P;  3MTU E;  1ZN5 A;  3L74 D;  3NXS A;  1T3U A;  1M57 D;  1M56 D;  2JHL F;  2KOG A;  2YXR B;  4U3F J;  5BU5 A;  1FZC C;  2GY7 A;  4WY4 C;  5AW2 B;  2LKM A;  1KIL A;  3Q3D A;  1NTM J;  4C7N B;  3GG2 A;  4ZMD A;  4UB8 H;  2Q9I B;  2FY8 A;  2KLV A;  2N9Y B;  1VQ8 P;  2C0X A;  3HE4 B;  4DT0 A;  3GF3 A;  1L2P A;  1SQB D;  3L74 E;  3L74 J;  1Q81 Q;  1KD1 Q;  2K9J B;  1FZB B;  2H7H A;  3MP7 B;  4LC1 A;  1E5W A;  1G1J A;  2K3R A;  3V2N A;  4BWN A;  1QX8 A;  1NTM D;  1Y8A A;  5CCG C;  1R8E A;  1QL2 A;  2OYI C;  1SQQ G;  1EZV D;  3L73 G;  1NTZ K;  2BCC E;  1K04 A;  2DW3 A;  2WMM A;  1GL2 D;  5B5E E;  4UB8 E;  5AW1 B;  2V7Q H;  2O01 J;  3L37 A;  3AED C;  2HPC B;  3TGU J;  2IFN A;  3L70 D;  3A2A A;  1S5L X;  1YIJ P;  1RE4 C;  2B89 A;  4IOI H;  1NTZ J;  1VF5 D;  3AEG C;  2J0G A;  3L75 G;  4ZKU A;  1SQP E;  3H1K J;  3UIA A;  2RN0 A;  2A45 H;  2ZFC A;  4TT3 H;  2C9L Y;  1PPJ G;  3L71 G;  2OTL P;  3D6Z A;  1IC2 A;  4U7J A;  2WPV B;  1A02 J;  2RMZ A;  2HLO C;  2KLU A;  5AVZ B;  2PRR A;  1X0T A;  3D6Y A;  2J0Y A;  2J3O A;  1EZV I;  3W67 A;  2NZ2 A;  2K1A A;  5CBO A;  3V2P A;  3VTP C;  5APW A;  3R2P A;  1KB9 E;  4ZKP A;  2E76 D;  2J59 M;  1MFT A;  3GMA A;  4H13 D;  1LT1 A;  1NTM K;  5E79 H;  1ZXG A;  2R44 A;  2J61 A;  3RK3 B;  2NRG A;  4JPZ B;  1XTC C;  3WU2 H;  1GDT A;  3FWL A;  1RH5 B;  5AVY B;  3VOP A;  4BRY B;  3B5N A;  1KOR A;  5TIS E;  1RE4 B;  1JUN A;  4AUW A;  4EOT A;  2H89 C;  4D6T E;  1FC2 C;  2J3F D;  4I7Z B;  3R4Y A;  2QJY C;  3P8C D;  5AW7 B;  2M5A B;  3AEB C;  1SQV K;  1KFM A;  1VF5 C;  4O9B A;  4KHX A;  5AW5 B;  2R3S A;  1LGH B;  1FZB A;  2NPS D;  1GK6 A;  4N78 E;  3MZW B;  3A0H E;  1NU1 J;  4JYB A;  1UII A;  2POH A;  2V4H A;  1ZRT E;  1SQX E;  2J5Z A;  5M1B A;  3H32 B; 
#chains in the Genus database with same CATH homology
 1GL2 B;  3V5B A;  2W6A A;  3TYY A;  3V4Q A;  2M8R A;  1HWT C;  2GUS A;  1URQ A;  1L0L K;  2P1J A;  1T8Z A;  2NPS B;  1SFC D;  2GUV A;  1LT9 A;  5APV A;  3A5T A;  1HJB A;  4EPU A;  2YMY A;  3V2R A;  4C7N A;  1CI6 A;  1S9K D;  3RL0 B;  1LTJ B;  1N2D C;  1KIL B;  2Z5I A;  2A45 G;  1LT9 B;  1FZG A;  3A3Y B;  3HUS C;  5CCH A;  2R5B A;  4ZFG A;  4LLH A;  1FZE C;  2H43 C;  3KYQ A;  1NH4 A;  3CI9 A;  3KPE A;  1Z56 A;  1NWQ A;  2HPC A;  3E1I C;  1JY2 O;  2XNX A;  2M3B A;  4GIF A;  3P8C E;  1HH0 A;  3NMD A;  4W7Z A;  1M1J C;  3C9I A;  2I1J A;  2XDJ A;  3CL3 D;  2R3C A;  3M91 A;  2Z4E C;  1LTT C;  1RF0 C;  2HLO B;  1T2K D;  2KSJ A;  2GM4 A;  1FZA A;  3SWF A;  1JNM A;  1GZL A;  4R9J A;  4LGD E;  1AQ5 A;  1IFJ A;  1H89 A;  2IX7 C;  1HVV A;  1SFC C;  1FJK A;  3OJA B;  3O8Z A;  1J2J B;  2OYH C;  1SVF A;  4NYT A;  2YO2 A;  3MGN A;  3BVH B;  2WSE H;  3HD7 C;  2VRS A;  1JCC A;  4OH8 B;  3VMY A;  3NFQ A;  3MD0 A;  2YKQ A;  1GW3 A;  1J1D B;  1MZ9 A;  1URQ C;  2PP6 A;  1FZF A;  2C9N Y;  1JY3 O;  2O01 H;  2E42 A;  2OAR A;  3RK2 C;  4N6J A;  2FFD C;  1S9K E;  1WT6 A;  1FOS E;  2HFE D;  1LWU C;  1FBM A;  1NU1 K;  3GHG B;  1FZG C;  2N9B A;  1LTJ A;  1JY2 P;  5CMZ A;  4C7R A;  4JF7 A;  1SQP K;  2OYI B;  3TK1 A;  2KP8 A;  3RK2 B;  1RF1 C;  1ZR2 A;  2A45 I;  1RY3 A;  1RE3 A;  2J64 A;  1N73 A;  1URQ B;  1X79 B;  2J60 A;  3TNU A;  2HOD A;  2W6B A;  1MFZ A;  1ZLL A;  2HG5 D;  1SLQ A;  3L36 A;  1G1I A;  2Z4E A;  1FJP A;  1FZB C;  1L4A D;  2Q7C A;  1HTL C;  5BU8 B;  3BVH C;  3RK3 D;  2WIT A;  1L4A C;  1MUU A;  3VYI A;  3HE5 A;  3PP5 A;  2J2P A;  3L4F A;  3TNU B;  1T2K C;  1N73 B;  3B5N D;  1IFM A;  1J1E B;  3MUD A;  3EQ2 A;  3N7N A;  1HBW A;  1FDM A;  5AW8 B;  1GD2 E;  1RF0 B;  3T97 A;  5CCG A;  2OYI A;  1VDF A;  1VPC A;  2WSC H;  2XKM A;  1N7L A;  4AQR D;  2H8P D;  3GHG A;  1RF1 B;  1T3J A;  3HTK B;  1X9V A;  3LW5 H;  2N1T A;  5APX A;  1IFI A;  1KIL D;  4W7Y A;  1IFN A;  3WMM 0;  1GK4 A;  3I5C A;  2FIB A;  2QM8 A;  4GT1 A;  3HUS A;  3P7K A;  5CCH C;  1NKZ B;  1FZF B;  2XV5 A;  1RE4 A;  1FZC B;  5AVX B;  3HUS B;  2FFD B;  1LWU A;  1NOH A;  1IO4 A;  3VMX A;  1FAV A;  3E1I A;  1FID A;  1DX7 A;  2JJL A;  2JHK F;  2R32 A;  5KJ7 C;  2FYU K;  1EQ7 A;  1J1D C;  5APU A;  5CCG D;  3M0A A;  4JZC A;  1RF0 A;  1URQ D;  3IR9 A;  1YYC A;  1GL2 C;  3VP8 A;  1H88 A;  1LTB C;  5KTB A;  4WB4 A;  3V4W A;  2J3U A;  2WZ7 A;  3M0D A;  2D39 A;  2OYH B;  1FIB A;  5AVU B;  2Q3I A;  3BAT A;  1HUC A;  5CCH D;  3CLQ A;  3HE5 B;  1SFC B;  2WPR A;  5KLV K;  5AW3 B;  3LID A;  2HLO A;  1X8Y A;  3RL0 D;  5AVW B;  1N86 A;  1L4A A;  3KDP B;  2N1T D;  3MTU E;  1ZN5 A;  4I2L C;  3VP9 A;  3NXS A;  1OXZ A;  1NKN A;  1T3U A;  2YO3 A;  2Z4E B;  2IPP A;  2JHL F;  1NAF A;  2KOG A;  2JHI F;  1CW5 A;  3BAS A;  5BU5 A;  1FZC C;  1IK9 A;  4IFF A;  4WY4 C;  5AW0 B;  5AW2 B;  1JOC A;  1Z3S A;  2LKM A;  2GY7 A;  2YKO A;  2JHH C;  1DEB A;  1FZF C;  3M9Q A;  1YTZ T;  1FZG B;  4R9T A;  1KIL A;  2WWW A;  4B86 A;  1IFD A;  4C7N B;  4XE5 B;  4W80 A;  1FU1 A;  2J3F A;  1NTK K;  5AW9 B;  1LTJ C;  2NPS A;  1JTH A;  1KFN A;  1JY3 N;  1GTW A;  1N7S A;  5KJ7 D;  1NHL A;  3SWY A;  2BAS A;  2Q9I B;  1QL1 A;  2J3G A;  3G3Z A;  1J1E C;  5APY A;  3BRT B;  1N73 C;  3RK3 C;  5CHX A;  5KJ7 A;  3U1C A;  2KLV A;  3HD7 B;  1OWA A;  3H32 C;  4JYO X;  1PFI A;  1L4A B;  2C0X A;  3HE4 B;  2JEE A;  3M9B A;  3V2Q A;  1W2E A;  3BVH A;  1FZB B;  2H7H A;  4WBA A;  2PAJ A;  1ZR4 A;  4EIJ A;  3OAK A;  3EFG A;  4M7F A;  3B8E B;  4LC1 A;  1N7S D;  2P7J A;  1E5W A;  1G1J A;  2E43 A;  2Q5U A;  3V2N A;  2O1J A;  4N3Y B;  2P2U A;  2XU6 A;  4I1L A;  1M1J B;  2QM7 A;  3HE4 A;  5CCG C;  1QL2 A;  2OYI C;  3BRV B;  1ZV8 A;  1NTZ K;  3E1I B;  1AFO A;  3GHG C;  1SP4 A;  1LWU B;  1GL2 D;  2N1T C;  2H43 B;  1CZQ A;  1FZC A;  1G2C A;  1SQB K;  2J0H A;  5AW1 B;  2XNX B;  3L37 A;  2WSF H;  2WPQ A;  3HRN A;  2HPC B;  2Q9I A;  4M3L A;  2IFN A;  1LT9 C;  1LTG C;  3B5N C;  1KIL C;  3A2A A;  1N7S B;  2MJZ A;  1RE4 C;  1JTH B;  3M06 A;  5APT A;  3HTK A;  3FIB A;  3LIE A;  3MIW A;  1DH3 A;  3H6P A;  4XA4 A;  2WNP F;  3VMZ A;  1FZE A;  2YKP A;  4GKG A;  1CI6 B;  5CJ0 A;  1SQX K;  5APS A;  4HH2 A;  2J0G A;  5AVV B;  2HPC C;  4ZKU A;  2P67 A;  2FXM A;  2O1K A;  3UIA A;  2A45 H;  2ZFC A;  2C9L Y;  5AVQ B;  1GL2 A;  3H32 A;  3M0D C;  2Z5H A;  3NTN A;  1IC2 A;  2YNY A;  2I1K A;  1A02 J;  1LTI C;  2HLO C;  3U1A A;  5AVZ B;  1N86 B;  2W27 A;  1N86 C;  2J0Y A;  2J3O A;  3II6 A;  2WTY A;  3RK2 D;  1SFC A;  1H8A A;  2L5G B;  1GW4 A;  5AVS B;  1LTS C;  4HYT B;  2HOD B;  2OYH A;  3V2P A;  5CJ4 A;  3VTP C;  2KB7 P;  3A7O A;  5APW A;  1RE3 B;  2C0W A;  3R2P A;  4ZKP A;  2J59 M;  2FYZ A;  1JCD A;  1FZE B;  4WY4 A;  1NO4 A;  2FKW B;  1FZD A;  1JC9 A;  1JO5 A;  5AVT B;  1NTM K;  1GU4 A;  2WT7 B;  1FIC A;  3RK3 B;  2J61 A;  3OA7 A;  3RL0 C;  1KQL A;  1XTC C;  3KQG A;  1GDT A;  2Q9I C;  4Y99 B;  5AVY B;  3VOP A;  1IJD B;  3M9H A;  1HGV A;  3B5N A;  2R5D A;  2IFM A;  4Y99 C;  2FFD A;  5AW6 B;  2NPS C;  1JMM A;  2J1G A;  2XZR A;  1Z3U A;  1RE4 B;  4M7H A;  1A02 F;  1N7S C;  1G2C B;  5AVR B;  1JUN A;  2HYN A;  2H43 A;  4IFD K;  4AUW A;  3B5N B;  5AW4 B;  4EOT A;  2J3F D;  1SQQ K;  2XNX C;  2J61 B;  1JY2 N;  3VN0 A;  3TSI A;  2WT7 A;  2N1T B;  3HD7 D;  5APQ A;  1M7L A;  1HGZ A;  3IFM A;  1RF1 A;  1M1J A;  3P8C D;  3U59 A;  1RE3 C;  5AW7 B;  1FOS F;  3N4X A;  3L35 A;  4WY4 B;  1SQV K;  2HOD C;  1LTA C;  1KFM A;  2JHM F;  2WPS A;  1FZA C;  4O9B A;  2CPB A;  4KHX A;  5AW5 B;  4C46 A;  4IFM A;  2ZXE B;  1JY3 P;  1LGH B;  1FZB A;  2NPS D;  4I6M C;  4RES B;  1GK6 A;  1FZA B;  4N78 E;  2J58 A;  2KYV A;  4JYC A;  1CSB A;  3P32 A;  1KZU B;  4JYB A;  4AYC A;  4DZO A;  2CPS A;  5BVZ A;  2POH A;  1MV8 A;  3HD7 A;  1WRG A;  3P8M C;  1GU5 A;  4N78 D;  4DOJ A;  1YTZ I;  4WY4 D;  2J5Z A;  3H32 B;  1XTG B;  1L0N K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...