2J64A

H-ficolin
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
211
structure length
211
Chain Sequence
b'GPRNCRELLSQGATLSGWYHLCLPEGRALPVFCDMDTEGGGWLVFQRRQDGSVDFFRSWSSYRAGFGNQESEFWLGNENLHQLTLQGNWELRVELEDFNGNRTFAHYATFRLLGEVDHYQLALGKFSEGTAGDSLSLHSGRPFTTYDADHDSSNSNCAVIVHGAWWYASCYRSNLNGRYAVSEAAAHKYGIDWASGRGVGHPYRRVRMMLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FICOLIN-3
publication title Structural Insights Into the Innate Immune Recognition Specificities of L- and H-Ficolins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lectin
total genus 63
structure length 211
sequence length 211
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2006-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00147 Fibrinogen_C Fibrinogen beta and gamma chains, C-terminal globular domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.215.10 Alpha Beta Alpha-Beta Complex Gamma Fibrinogen; Chain A, domain 1 Gamma Fibrinogen, chain A, domain 1 2j64A01
4.10.530.10 Few Secondary Structures Irregular Gamma-fibrinogen Carboxyl Terminal Fragment; domain 2 Gamma-fibrinogen Carboxyl Terminal Fragment, domain 2 2j64A02
2J3OA 1LT9C 2J2PA 1M1JB 2H43B 3E1IB 1LT9B 2Q9IC 3H32C 2XNXC 2J0GA 2JHMF 2JHLF 1N86C 2J3UA 2OYHC 2Q9IB 3H32B 2XNXB 1FZDA 1FZBC 3E1IC 1RF0C 2OYHB 2JHHC 2WNPF 4EPUA 2J1GA 1N73B 2J5ZA 2GY7A 3BVHC 1FICA 1FZBB 1RF0B 3GHGC 4R9TA 1Z3UA 3HUSC 3BVHB 1FIDA 2JHKF 1FZEC 2J3GA 1N73C 3HUSB 1FIBA 2J0YA 1RE3B 1FZFB 1FZEB 1RE4C 1Z3SA 1LWUC 2Z4EC 4NYTA 2HPCC 1RE4B 1LTJB 2OYIC 1RF1C 2FIBA 1FZCC 1LWUB 2Z4EB 1FZGC 2J61A 2FFDB 1FZFC 1RE3C 2HODC 2HPCB 2OYIB 1FZAB 1RF1B 1JC9A 1FZCB 4R9JA 1FZGB 2J3FA 2D39A 2J64A 2J60A 4M7FA 4JZCA 2HODB 1LTJC 4M7HA 2HLOC 2J61B 2FFDC 2J3FD 2J0HA 2JHIF 4ZFGA 3FIBA 1FZAC 4JYOX 2HLOB 1M1JC 1N86B 2H43C
chains in the Genus database with same CATH superfamily
2J3OA 1LT9C 2J2PA 1M1JB 2H43B 3E1IB 1LT9B 2Q9IC 3H32C 2XNXC 2J0GA 2JHMF 2JHLF 1N86C 2J3UA 2OYHC 2Q9IB 3GHGB 3H32B 2XNXB 1FZDA 1FZBC 3E1IC 1RF0C 2OYHB 2JHHC 2WNPF 4EPUA 2J1GA 1N73B 2J5ZA 2GY7A 3BVHC 1FICA 1FZBB 1RF0B 3GHGC 4R9TA 1Z3UA 3HUSC 3BVHB 1FIDA 2JHKF 1FZEC 2J3GA 1N73C 3HUSB 1FIBA 2J0YA 1RE3B 1FZFB 1FZEB 1RE4C 1Z3SA 1LWUC 2Z4EC 4NYTA 2HPCC 1RE4B 1LTJB 2OYIC 1RF1C 2FIBA 1FZCC 1LWUB 2Z4EB 1FZGC 2J61A 2FFDB 1FZFC 1RE3C 2HODC 2HPCB 2OYIB 1FZAB 1RF1B 1JC9A 1FZCB 4R9JA 1FZGB 2J3FA 2D39A 2J64A 2J60A 4M7FA 4JZCA 2HODB 1LTJC 4M7HA 2HLOC 2J61B 2FFDC 2J3FD 2J0HA 2JHIF 4ZFGA 3FIBA 1FZAC 4JYOX 2HLOB 1M1JC 1N86B 2H43C
chains in the Genus database with same CATH topology
2J3OA 1LT9C 2J2PA 1M1JB 2H43B 3E1IB 1LT9B 2Q9IC 3H32C 2XNXC 2J0GA 2JHMF 2JHLF 1N86C 2J3UA 2OYHC 2Q9IB 3H32B 2XNXB 1FZDA 1FZBC 3E1IC 1RF0C 2OYHB 2JHHC 2WNPF 4EPUA 2J1GA 1N73B 2J5ZA 2GY7A 3BVHC 1FICA 1FZBB 1RF0B 3GHGC 4R9TA 1Z3UA 3HUSC 3BVHB 1FIDA 2JHKF 1FZEC 2J3GA 1N73C 3HUSB 1FIBA 2J0YA 1RE3B 1FZFB 1FZEB 1RE4C 1Z3SA 1LWUC 2Z4EC 4NYTA 2HPCC 1RE4B 1LTJB 2OYIC 1RF1C 2FIBA 1FZCC 1LWUB 2Z4EB 1FZGC 2J61A 2FFDB 1FZFC 1RE3C 2HODC 2HPCB 2OYIB 1FZAB 1RF1B 1JC9A 1FZCB 4R9JA 1FZGB 2J3FA 2D39A 2J64A 2J60A 4M7FA 4JZCA 2HODB 1LTJC 4M7HA 2HLOC 2J61B 2FFDC 2J3FD 2J0HA 2JHIF 4ZFGA 3FIBA 1FZAC 4JYOX 2HLOB 1M1JC 1N86B 2H43C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J3O A;  1LT9 C;  2J2P A;  1M1J B;  2H43 B;  3E1I B;  1LT9 B;  2Q9I C;  3H32 C;  2XNX C;  2J0G A;  2JHM F;  2JHL F;  1N86 C;  2J3U A;  2OYH C;  2Q9I B;  3H32 B;  2XNX B;  1FZD A;  1FZB C;  3E1I C;  1RF0 C;  2OYH B;  2JHH C;  2WNP F;  4EPU A;  2J1G A;  1N73 B;  2J5Z A;  2GY7 A;  3BVH C;  1FIC A;  1FZB B;  1RF0 B;  3GHG C;  4R9T A;  1Z3U A;  3HUS C;  3BVH B;  1FID A;  2JHK F;  1FZE C;  2J3G A;  1N73 C;  3HUS B;  1FIB A;  2J0Y A;  1RE3 B;  1FZF B;  1FZE B;  1RE4 C;  1Z3S A;  1LWU C;  2Z4E C;  4NYT A;  2HPC C;  1RE4 B;  1LTJ B;  2OYI C;  1RF1 C;  2FIB A;  1FZC C;  1LWU B;  2Z4E B;  1FZG C;  2J61 A;  2FFD B;  1FZF C;  1RE3 C;  2HOD C;  2HPC B;  2OYI B;  1FZA B;  1RF1 B;  1JC9 A;  1FZC B;  4R9J A;  1FZG B;  2J3F A;  2D39 A;  2J64 A;  2J60 A;  4M7F A;  4JZC A;  2HOD B;  1LTJ C;  4M7H A;  2HLO C;  2J61 B;  2FFD C;  2J3F D;  2J0H A;  2JHI F;  4ZFG A;  3FIB A;  1FZA C;  4JYO X;  2HLO B;  1M1J C;  1N86 B;  2H43 C; 
#chains in the Genus database with same CATH topology
 2J3O A;  1LT9 C;  2J2P A;  1M1J B;  2H43 B;  3E1I B;  1LT9 B;  2Q9I C;  3H32 C;  2XNX C;  2J0G A;  2JHM F;  2JHL F;  1N86 C;  2J3U A;  2OYH C;  2Q9I B;  3GHG B;  3H32 B;  2XNX B;  1FZD A;  1FZB C;  3E1I C;  1RF0 C;  2OYH B;  2JHH C;  2WNP F;  4EPU A;  2J1G A;  1N73 B;  2J5Z A;  2GY7 A;  3BVH C;  1FIC A;  1FZB B;  1RF0 B;  3GHG C;  4R9T A;  1Z3U A;  3HUS C;  3BVH B;  1FID A;  2JHK F;  1FZE C;  2J3G A;  1N73 C;  3HUS B;  1FIB A;  2J0Y A;  1RE3 B;  1FZF B;  1FZE B;  1RE4 C;  1Z3S A;  1LWU C;  2Z4E C;  4NYT A;  2HPC C;  1RE4 B;  1LTJ B;  2OYI C;  1RF1 C;  2FIB A;  1FZC C;  1LWU B;  2Z4E B;  1FZG C;  2J61 A;  2FFD B;  1FZF C;  1RE3 C;  2HOD C;  2HPC B;  2OYI B;  1FZA B;  1RF1 B;  1JC9 A;  1FZC B;  4R9J A;  1FZG B;  2J3F A;  2D39 A;  2J64 A;  2J60 A;  4M7F A;  4JZC A;  2HOD B;  1LTJ C;  4M7H A;  2HLO C;  2J61 B;  2FFD C;  2J3F D;  2J0H A;  2JHI F;  4ZFG A;  3FIB A;  1FZA C;  4JYO X;  2HLO B;  1M1J C;  1N86 B;  2H43 C; 
#chains in the Genus database with same CATH homology
 2J3O A;  1LT9 C;  2J2P A;  1M1J B;  2H43 B;  3E1I B;  1LT9 B;  2Q9I C;  3H32 C;  2XNX C;  2J0G A;  2JHM F;  2JHL F;  1N86 C;  2J3U A;  2OYH C;  2Q9I B;  3H32 B;  2XNX B;  1FZD A;  1FZB C;  3E1I C;  1RF0 C;  2OYH B;  2JHH C;  2WNP F;  4EPU A;  2J1G A;  1N73 B;  2J5Z A;  2GY7 A;  3BVH C;  1FIC A;  1FZB B;  1RF0 B;  3GHG C;  4R9T A;  1Z3U A;  3HUS C;  3BVH B;  1FID A;  2JHK F;  1FZE C;  2J3G A;  1N73 C;  3HUS B;  1FIB A;  2J0Y A;  1RE3 B;  1FZF B;  1FZE B;  1RE4 C;  1Z3S A;  1LWU C;  2Z4E C;  4NYT A;  2HPC C;  1RE4 B;  1LTJ B;  2OYI C;  1RF1 C;  2FIB A;  1FZC C;  1LWU B;  2Z4E B;  1FZG C;  2J61 A;  2FFD B;  1FZF C;  1RE3 C;  2HOD C;  2HPC B;  2OYI B;  1FZA B;  1RF1 B;  1JC9 A;  1FZC B;  4R9J A;  1FZG B;  2J3F A;  2D39 A;  2J64 A;  2J60 A;  4M7F A;  4JZC A;  2HOD B;  1LTJ C;  4M7H A;  2HLO C;  2J61 B;  2FFD C;  2J3F D;  2J0H A;  2JHI F;  4ZFG A;  3FIB A;  1FZA C;  4JYO X;  2HLO B;  1M1J C;  1N86 B;  2H43 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...