3S9SA

Ligand binding domain of ppargamma complexed with a benzimidazole partial agonist
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
269
structure length
258
Chain Sequence
SADLRALAKHLYDSYIKSFPLTKAKARAILTGKSPFVIYDMNSLMMGEDKIKFKHITKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETMSLHPLLQEIYKDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Peroxisome proliferator-activated receptor gamma
publication title Discovery of GSK1997132B a novel centrally penetrant benzimidazole PPARgamma partial agonist.
pubmed doi rcsb
source organism Homo sapiens
total genus 91
structure length 258
sequence length 269
ec nomenclature
pdb deposition date 2011-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 3s9sA00
4MGDB 1L2IA 2ZNOA 3OOKA 2AX7A 4IWCA 4IV4A 4OEAA 1P8DA 1YOWA 2Q7KA 2ZVTA 3B5RA 1H9UA 4OK1A 3TKMA 5DRMA 4POJA 3DR1A 4OEZA 3A2IA 1R20A 1T5ZA 4RFWA 2AAXA 5DIEA 5EI1A 1HJ1A 5G45A 3R8IA 3VRWA 2JF9A 5DMCA 3HVLA 4FN9A 5DVSA 4DOSA 1MZNA 1XVPA 1S19A 3B3KA 3ERDA 4OARA 3VTBA 3OS8C 4MGBA 4DK8A 2YLOA 3VRUA 4TUZA 3CJWA 1ZDUA 4OHAA 5KRLA 4TV1A 4EM9A 3OGTA 5DWJA 3F5CA 4OJBA 4PVUA 2YLPA 4QE6A 3V9TA 3CLDA 3R2AA 4XTAA 3TX7B 3GWSX 3VT9A 4ZO1B 2Q7JA 3OKIA 4L98A 3VSPA 3W0YA 1K74D 3KMRA 5KCTA 5DXEA 2Q3YA 3WFFA 1KV6A 1P93A 3HZFA 2ZMHA 3U9QA 5AAUA 1XNXA 3AX8A 4N73A 2ATHA 4PPSA 1FCZA 5E1CA 5GIDA 4IA1A 5IAWA 1T73A 1XP6A 3B65A 3B0QA 1ZEOA 2AWHA 3SZ1A 1BSXA 1FM6D 2ZMIA 1N83A 5F9BA 2VV2A 5A86A 2OCFA 5IZ0A 2XHSA 4PP3A 5KRCA 4LNWA 5JI0D 1NQ0A 1RK3A 3PBAA 3PRGA 3VI8A 3GN8A 3VT4A 2ACLA 1PQ6A 5DVCA 3HC6A 1I37A 1XB7A 2JFAA 2YATA 3FURA 2HBHA 2QZOA 4WQPA 5FQRA 2J7XA 4RMCA 5E0XA 4DM6A 3JZBA 4O8FA 1T7MA 3E94A 3X36A 2E2RA 3GYUA 1U3QA 5G42A 5HJSA 4UDDA 3D6DA 2P7ZA 3ILZA 2EWPA 4MGCA 2H77A 1XJ7A 1SJ0A 2ZXZA 4XUHA 2AM9A 3B66A 5DXPA 3UP3A 1YMTA 3PCUA 1NQ2A 4G2HA 3T03A 3ET3A 3UUCA 1MV9A 2PIQA 1K4WA 3HO0A 5GIEA 1G50A 2Q7IA 3G8IA 2ZBSA 2LBDA 3P0UA 5HCVA 3P88A 4Q13A 2W8YA 2GP7A 5KRHA 2I4ZA 3CQVA 2GTKA 2B50A 1NQ7A 3N00A 4ZNHA 3LMPA 2HB8A 1ILHA 2P15A 3EYBA 1ZGYA 4JYHA 2PIOA 1PDUA 2PITA 1RDTD 4IUIA 3WWRA 1R20D 5DWLA 3ERTA 4XT9A 5DKGA 3GZ9A 1XDKB 5EC9A 3OSIA 3AURA 1S0ZA 3NSQA 5DZ0A 4PF3A 3WT7A 2YLQA 3BC5A 4BCRA 1SQNA 3Q95A 2VV0A 3OSAA 5M96A 1ZKYA 4LBDA 3KFCA 4P6WA 1GWQA 1X7BA 5ICKA 3FLIA 2AMBA 2HWQA 3O1DA 5AWKA 3W0HA 3WTQA 5DKEA 1IE9A 1T65A 4PLEA 3MNPA 2VV1A 4PP5A 5DTVA 3UU7A 3WGPA 2VV4B 2QE4A 1GWRA 3L0LA 2AO6A 2QPYA 5AAVA 1PQCA 4MG6A 2ZXMA 4LSJA 4FNEA 1KKQA 3KPZA 5KROA 4X1FA 2HC4A 2REWA 3DY6A 2ZLAA 3FC6A 3D24A 3K23A 2POBA 3VSOA 2I4JA 3A2HA 4RZGA 4MGAA 4XHDA 5E15A 1UOMA 1XPCA 2R40A 4R2UA 5DXGA 1X7JA 2QA8B 2IHQA 2YJAB 2PIXA 3OS9A 4OC7A 3KYTA 3DZYA 1PZLA 1R6GA 3FEJA 1OSHA 5FQTA 4QJRA 1GWXA 4G1YA 5KRAA 5KRIA 3IPSA 5DZ1A 1NRLA 4RUJA 4A4WA 4OKTA 3S9SA 3A9EB 5JJMB 5DLRA 3RUUA 4MG7A 4NIEA 1OVLA 5DXBA 5KYAA 3MNEA 4ZJRA 3FEIA 4ITFA 5SYZA 3JZCA 4WPFA 2GL8A 3OZJA 4IVWA 2Z4BA 4RMEA 2BJ4A 1FCYA 5AZTA 3DZUA 2ZLCA 1T7TA 3RY9A 3UUDA 3FUGA 4OGHA 3VJSA 2AMAA 3OMMA 4IW8A 4MG8B 4MG9B 5G46A 3D57A 3KBAA 2QA6A 1YY4A 2QMVA 4G1ZA 3SP9A 3G0WA 2QNVA 5EITA 5DIGA 2QSEA 5FQSA 2Q1VA 5DK9A 5DKSA 2AYRA 5APHA 1S0XA 3HLVA 1ZUCA 2QR9A 2VSTA 2FAIA 3VJHA 2OVMA 5FQVA 3RUTA 2NPAA 1UHLA 2Q6RA 3G9EA 4WHGA 5DRJA 5ETHA 1YA3A 4QE8A 1FCXA 3CS6A 3UVVB 1A52A 5HYKA 3P89A 5K13A 3PLZA 1ZDTA 4IS8A 2PIRA 5HZCA 2GPOA 3ADVA 3CS8A 2V0VA 4L96A 2G0HA 5DIDA 1FD0A 5DXKA 2P4YA 2HASA 2PINA 1NYXA 2ZK5A 2ZFXA 1XVPB 3H0AD 3IPUA 3O1EA 5DVVA 4MGBB 1UPVA 5HJPA 3ZRAA 4JYIA 4TUZB 4A2JA 4P6XA 3AUNA 1I7GA 2AA7A 3VT8A 3W5RA 3F5CB 4OKBA 3WT5A 2YHDA 1UPWA 2QH6A 4N5GA 4RUOX 1Q4XA 2HVCA 4APUA 4PLDA 3OS8A 4XAOA 1Y0XX 3CWDA 3VHUA 5DWGA 2R40D 3W5PA 1E3KA 4RZEA 4JGVA 3X31A 4DMAA 4DQMA 1PK5A 4OKWA 5EJVA 4FHIA 1EREA 3ADTA 3DZYD 3TY0A 1XNNA 3HM1A 2ZNPA 1YINA 1DKFA 4IW6A 1ZH7A 3B0TA 5DV3A 3ET2A 4E4QA 4ZNWA 2P1VA 3GBKA 3B68A 3V4AA 3VT5A 5DYBA 2B1ZA 3WJ5A 1M7WA 4OJ4A 5AK2A 4IU7A 4KZJA 2JFAB 4JL4A 3LBDA 2QZOB 2ZK0A 3IXPA 3A3ZX 4ZNUA 1X78A 1YYEA 2VV3A 3CTBA 4OH6A 4HEEX 3KMZA 1R1KA 3E7CA 3VJIA 1QKNA 4QL8A 1SR7A 5C4SA 4QM0A 4S15A 2QXSA 5B41A 2XYJA 2GWXA 3DT3A 3L1BA 1GS4A 1LV2A 4PXMA 4REFA 4WHFA 1NQ1A 4OKXA 4ZNVA 5AVIA 5DUGA 4R6SA 5C4TA 5HYRA 2AB2A 1G5YA 5KYJA 5DX3A 4F9MA 3IMYA 3PO9A 1U9EA 1T79A 3GYTA 1XV9A 1HG4A 4OH5A 5KRKA 4IWFA 1X7EA 2QW4A 4OZTU 4FHHA 1WM0X 3SP6A 5KCFA 4YNKA 2ZL9A 5I4VA 3GWXA 5KCUA 3OMKA 1XQCA 4WLBA 2Q6SA 3RLJA 2ZK3A 5JY3A 5KCWA 2Z4JA 2NW4A 1Y0SA 2OAXA 3L0JA 1XP9A 5L7HA 4LNXA 2QGWA 3VT3A 5IXKA 3OAPA 2G5OA 4QK4A 3OSWA 4ZNSA 5KR9A 3K22A 2GPVA 5H1EA 3RLLA 1NAVA 1FM9A 1U3RA 4UDAA 3Q95B 5DWEA 3OLFA 3B67A 4PWLA 2ABIA 2Q6JA 4ZN7A 2H79A 3W0JA 3KDUA 4OFUA 1K74A 2ZK2A 3GD2A 1XAPA 1YOKA 3UUAA 3WJ4A 4G1DA 3ET1A 4OZTE 5DY8A 2HB7A 2XYXA 3W5QA 4IV2A 4KZMA 5B5BA 3UU7B 4NY9A 3VJTA 3VN2A 3W0AA 4OZRU 1M2ZA 3R29A 5AAVB 3V3QA 2OZ7A 2ZKCA 5DU5A 2Q59A 1FM6A 4RZFA 4M8EA 1I38A 2ZXNA 3NOAA 4OEDA 3FC6B 4OIUA 1S9QA 2ZY0A 4IA7A 4RE8A 3VT7A 2AX9A 3A9EA 4MGAB 5JJMA 5DUHA 3NSPA 3OOFA 2FSZA 2QXMA 1E3GA 1MVCA 3OMPA 1G2NA 5ACCA 3V9VA 2HCDA 4Q50A 3V3EA 3R5MA 4J5WC 2O9IA 1VJBA 3KWYA 1XIUA 2ZNNA 3IA6A 2J14A 1N46A 1XOWA 4NUFA 3PEQA 3FALA 3HODA 4ZO1X 2GPUA 2IOGA 4S14A 4OZRE 4RMDA 4UDCA 3DCUA 4MGDA 1XQ3A 4MG7B 4CI4A 3MNOA 1OVLB 5DXBB 1XZXX 5LGAA 2B23A 4G21A 5KCEA 2P1TA 4UDBA 3ADWA 5AVLA 4E2JA 5G5WA 2AA5A 3HC5A 1DB1A 2PIPL 2NXXA 4MG5A 5KRFA 3UUDB 2GIUA 2Q70A 1XP1A 4J26A 5DSHA 4N8RA 5DZHA 3WFGA 5KCDA 5C4OA 1Z5XU 2QABA 4N1YA 4PPPA 3DCTA 1T74A 3W0GA 3ADUA 2JJ3A 4IVYA 5EGVA 2Q1HA 3B0RA 3UVVA 3X1IA 4ZNTA 4J5WA 5DKBA 3ADSA 5APKA 5G43A 1RDTA 5APJA 4OFRA 1NAXA 2ZASA 4IA2A 4NQAB 2HARA 1N4HA 2YLYA 5FQPA 4IQRA 5DXRA 3TKCA 3VTCA 3VHWA 4TV1B 1UHLB 2AA6A 2Q61A 3B1MA 3OZ0A 1EXAA 2P1UA 4XI3A 5EHJA 4X1GA 4ZI1A 2P54A 2ZK4A 3IPQA 1PQ9A 3QT0A 4CSJA 5LWPA 3UP0A 3K6PA 5DMFA 1FM9D 1Z5XE 3AUQA 1QKUA 3D5FA 3KMGA 4KZIA 2NXXE 4ONIA 1RKGA 4G2IA 3F7DA 4K4JA 1TXIA 1ILGA 4FGYA 2AX8A 4IA3A 5DV8A 2PIUA 3L3XA 3OKHA 1M13A 3HQ5A 3AZ1A 4A4VA 4CI5A 5HJPB 1OT7A 2ZK1A 3AN4A 4Q0AC 3L03A 2G44A 3H52A 3VT6A 4JYGA 5E14A 1ZAFA 3X1HA 2POGA 1A28A 1NDEA 4E4KA 4YMQA 5DI7A 1XLSA 5KRMA 4S0TA 1L2JA 2ACLB 3B0WA 3ZR7A 3A2JA 5DXMA 1NUOA 2OM9A 3AZ3A 3ZQTA 1YUCA 2PKLA 5E0WA 1ERRA 5KRJA 4DK7A 3E00A 3CDSA 2Q5SA 3DZUD 3D90A 3K8SA 4HLWA 4PRGA 4OIVA 1DKFB 5KD9A 5AYGA 2NV7A 3BQDA 2HAMA 2I0JA 1U3SA 4POHA 1YP0A 3L3ZA 4J24A 5AWJA 4XLDA 2R6WA 1S9PA 3KDTA 5DV6A 1KNUA 3CS4A 3A40X 2PRGA 1IE8A 5E7VA 1T63A 1T7FA 1Z95A 1SKXA 2IOKA 3AFRA 1I7IA 1XDKA 4OEYA 1XLSE 2BAWA 2R6YA 4OJ9A 4DORA 4YPQA 1X7RA 5DWIA 2ZNQA 2GPPA 4DM8A 1EXXA 5DP0A 2F4BA 5GICA 2OVHA 4K7AA 5DZ3A 2PJLA 4ZOMA 1RJKA 4J5XC 2YFEA 1G1UA 3M7RA 2PIWA 2I4PA 3AN3A 5DX3B 2B1VA 1YIMA 5L7EA 1X76A 2YJDA 1XV9B 2VV4A 2QTUA 2ZK6A 2Q7LA 4XUMA 4R06A 2ZMJA 3W0CA 3VTDA 2XYWA 2O4RA 1K7LA 3ZRBA 2HWRA 2XKWA 4LTWA 2QGTA 1TFCA 3WMHA 3G8OA 4NB6A 5C4UA 3VHVA 4S0SA 1RKHA 2QA8A 3OMOA 2J4AA 2VV1B 3ADXA 5G44A 4ZJWA 5DUEA 4REEA 3AZ2A 3H0AA 4Y29A 3BEJA 2Q8SA 4ITEA 2AX6A 2VSRA 4MDDA 2I0GA 4B7WA 2PIVA 1PRGA 4YT1A 2O4JA 3OLLA 3R5NA 2Q5PA 4J5XA 2AA2A 1LBDA 5L11A 1NHZA 5DXQA 2PNUA 2J7YA 3R8DA 1FBYA 2HFPA 4OILA 5DZIA 3UUAB 1PCGA 1OSVA 4JAZA 1QKMA 2P7AA 3IXPD 5CJ6A 3RVFA 5GT4A 2OUZA 3E00D 3FS1A 2V7CA 4OLMA 1R1KD 5DYDA 4WVDA 2Q59B 3L0EA 4MG8A 4MG9A 1QKTA 5E19A 3A78A 1YJEA 4RAKA 5DL4A 4RUPA 3W5TA 4EMAA 3CDPA 5KCCA 5L7GA 2P7GA 1R5KA 1T76A 2G0GA 3V49A 1T7RA 2Q5GA 3OMQA 4PP6A 4G20A 5AZVA 2BJ4B 3VRTA 4ZN9A 3OLSA 2AXAA 4M8HA 2A3IA 4K6IA 5G3JA 3FXVA 3P8XA 3R8AA 3V9YA 3WT6A 3VRVA 4RWVA 3W0IA 1Y9RA 2Q60A 3FALB 3ET0A 2FVJA
chains in the Genus database with same CATH superfamily
4MGDB 1L2IA 2ZNOA 3OOKA 2AX7A 4IWCA 4IV4A 4OEAA 1P8DA 1YOWA 2Q7KA 2ZVTA 3B5RA 1H9UA 4OK1A 3TKMA 5DRMA 4POJA 3DR1A 4OEZA 3A2IA 1R20A 1T5ZA 4RFWA 2AAXA 5DIEA 5EI1A 1HJ1A 5G45A 3R8IA 3VRWA 2JF9A 5DMCA 3HVLA 4FN9A 5DVSA 4DOSA 1MZNA 1XVPA 1S19A 3B3KA 3ERDA 4OARA 3VTBA 3OS8C 4MGBA 4DK8A 2YLOA 3VRUA 4TUZA 3CJWA 1ZDUA 4OHAA 5KRLA 4TV1A 4EM9A 3OGTA 5DWJA 3F5CA 4OJBA 4PVUA 2YLPA 4QE6A 3V9TA 3CLDA 3R2AA 4XTAA 3TX7B 3GWSX 3VT9A 4ZO1B 2Q7JA 3OKIA 4L98A 3VSPA 3W0YA 1K74D 3KMRA 5KCTA 5DXEA 2Q3YA 3WFFA 1KV6A 1P93A 3HZFA 2ZMHA 3U9QA 5AAUA 1XNXA 3AX8A 4N73A 2ATHA 4PPSA 1FCZA 5E1CA 5GIDA 4IA1A 5IAWA 1T73A 1XP6A 3B65A 3B0QA 1ZEOA 2AWHA 3SZ1A 1BSXA 1FM6D 2ZMIA 1N83A 5F9BA 2VV2A 5A86A 2OCFA 5IZ0A 2XHSA 4PP3A 5KRCA 4LNWA 5JI0D 1NQ0A 1RK3A 3PBAA 3PRGA 3VI8A 3GN8A 3VT4A 2ACLA 1PQ6A 5DVCA 3HC6A 1I37A 1XB7A 2JFAA 2YATA 3FURA 2HBHA 2QZOA 4WQPA 5FQRA 2J7XA 4RMCA 5E0XA 4DM6A 3JZBA 4O8FA 1T7MA 3E94A 3X36A 2E2RA 3GYUA 1U3QA 5G42A 5HJSA 4UDDA 3D6DA 2P7ZA 3ILZA 2EWPA 4MGCA 2H77A 1XJ7A 1SJ0A 2ZXZA 4XUHA 2AM9A 3B66A 5DXPA 3UP3A 1YMTA 3PCUA 1NQ2A 4G2HA 3T03A 3ET3A 3UUCA 1MV9A 2PIQA 1K4WA 3HO0A 5GIEA 1G50A 2Q7IA 3G8IA 2ZBSA 2LBDA 3P0UA 5HCVA 3P88A 4Q13A 2W8YA 2GP7A 5KRHA 2I4ZA 3CQVA 2GTKA 2B50A 1NQ7A 3N00A 4ZNHA 3LMPA 2HB8A 1ILHA 2P15A 3EYBA 1ZGYA 4JYHA 2PIOA 1PDUA 2PITA 1RDTD 4IUIA 3WWRA 1R20D 5DWLA 3ERTA 4XT9A 5DKGA 3GZ9A 1XDKB 5EC9A 3OSIA 3AURA 1S0ZA 3NSQA 5DZ0A 4PF3A 3WT7A 2YLQA 3BC5A 4BCRA 1SQNA 3Q95A 2VV0A 3OSAA 5M96A 1ZKYA 4LBDA 3KFCA 4P6WA 1GWQA 1X7BA 5ICKA 3FLIA 2AMBA 2HWQA 3O1DA 5AWKA 3W0HA 3WTQA 5DKEA 1IE9A 1T65A 4PLEA 3MNPA 2VV1A 4PP5A 5DTVA 3UU7A 3WGPA 2VV4B 2QE4A 1GWRA 3L0LA 2AO6A 2QPYA 5AAVA 1PQCA 4MG6A 2ZXMA 4LSJA 4FNEA 1KKQA 3KPZA 5KROA 4X1FA 2HC4A 2REWA 3DY6A 2ZLAA 3FC6A 3D24A 3K23A 2POBA 3VSOA 2I4JA 3A2HA 4RZGA 4MGAA 4XHDA 5E15A 1UOMA 1XPCA 2R40A 4R2UA 5DXGA 1X7JA 2QA8B 2IHQA 2YJAB 2PIXA 3OS9A 4OC7A 3KYTA 3DZYA 1PZLA 1R6GA 3FEJA 1OSHA 5FQTA 4QJRA 1GWXA 4G1YA 5KRAA 5KRIA 3IPSA 5DZ1A 1NRLA 4RUJA 4A4WA 4OKTA 3S9SA 3A9EB 5JJMB 5DLRA 3RUUA 4MG7A 4NIEA 1OVLA 5DXBA 5KYAA 3MNEA 4ZJRA 3FEIA 4ITFA 5SYZA 3JZCA 4WPFA 2GL8A 3OZJA 4IVWA 2Z4BA 4RMEA 2BJ4A 1FCYA 5AZTA 3DZUA 2ZLCA 1T7TA 3RY9A 3UUDA 3FUGA 4OGHA 3VJSA 2AMAA 3OMMA 4IW8A 4MG8B 4MG9B 5G46A 3D57A 3KBAA 2QA6A 1YY4A 2QMVA 4G1ZA 3SP9A 3G0WA 2QNVA 5EITA 5DIGA 2QSEA 5FQSA 2Q1VA 5DK9A 5DKSA 2AYRA 5APHA 1S0XA 3HLVA 1ZUCA 2QR9A 2VSTA 2FAIA 3VJHA 2OVMA 5FQVA 3RUTA 2NPAA 1UHLA 2Q6RA 3G9EA 4WHGA 5DRJA 5ETHA 1YA3A 4QE8A 1FCXA 3CS6A 3UVVB 1A52A 5HYKA 3P89A 5K13A 3PLZA 1ZDTA 4IS8A 2PIRA 5HZCA 2GPOA 3ADVA 3CS8A 2V0VA 4L96A 2G0HA 5DIDA 1FD0A 5DXKA 2P4YA 2HASA 2PINA 1NYXA 2ZK5A 2ZFXA 1XVPB 3H0AD 3IPUA 3O1EA 5DVVA 4MGBB 1UPVA 5HJPA 3ZRAA 4JYIA 4TUZB 4A2JA 4P6XA 3AUNA 1I7GA 2AA7A 3VT8A 3W5RA 3F5CB 4OKBA 3WT5A 2YHDA 1UPWA 2QH6A 4N5GA 4RUOX 1Q4XA 2HVCA 4APUA 4PLDA 3OS8A 4XAOA 1Y0XX 3CWDA 3VHUA 5DWGA 2R40D 3W5PA 1E3KA 4RZEA 4JGVA 3X31A 4DMAA 4DQMA 1PK5A 4OKWA 5EJVA 4FHIA 1EREA 3ADTA 3DZYD 3TY0A 1XNNA 3HM1A 2ZNPA 1YINA 1DKFA 4IW6A 1ZH7A 3B0TA 5DV3A 3ET2A 4E4QA 4ZNWA 2P1VA 3GBKA 3B68A 3V4AA 3VT5A 5DYBA 2B1ZA 3WJ5A 1M7WA 4OJ4A 5AK2A 4IU7A 4KZJA 2JFAB 4JL4A 3LBDA 2QZOB 2ZK0A 3IXPA 3A3ZX 4ZNUA 1X78A 1YYEA 2VV3A 3CTBA 4OH6A 4HEEX 3KMZA 1R1KA 3E7CA 3VJIA 1QKNA 4QL8A 1SR7A 5C4SA 4QM0A 4S15A 2QXSA 5B41A 2XYJA 2GWXA 3DT3A 3L1BA 1GS4A 1LV2A 4PXMA 4REFA 4WHFA 1NQ1A 4OKXA 4ZNVA 5AVIA 5DUGA 4R6SA 5C4TA 5HYRA 2AB2A 1G5YA 5KYJA 5DX3A 4F9MA 3IMYA 3PO9A 1U9EA 1T79A 3GYTA 1XV9A 1HG4A 4OH5A 5KRKA 4IWFA 1X7EA 2QW4A 4OZTU 4FHHA 1WM0X 3SP6A 5KCFA 4YNKA 2ZL9A 5I4VA 3GWXA 5KCUA 3OMKA 1XQCA 4WLBA 2Q6SA 3RLJA 2ZK3A 5JY3A 5KCWA 2Z4JA 2NW4A 1Y0SA 2OAXA 3L0JA 1XP9A 5L7HA 4LNXA 2QGWA 3VT3A 5IXKA 3OAPA 2G5OA 4QK4A 3OSWA 4ZNSA 5KR9A 3K22A 2GPVA 5H1EA 3RLLA 1NAVA 1FM9A 1U3RA 4UDAA 3Q95B 5DWEA 3OLFA 3B67A 4PWLA 2ABIA 2Q6JA 4ZN7A 2H79A 3W0JA 3KDUA 4OFUA 1K74A 2ZK2A 3GD2A 1XAPA 1YOKA 3UUAA 3WJ4A 4G1DA 3ET1A 4OZTE 5DY8A 2HB7A 2XYXA 3W5QA 4IV2A 4KZMA 5B5BA 3UU7B 4NY9A 3VJTA 3VN2A 3W0AA 4OZRU 1M2ZA 3R29A 5AAVB 3V3QA 2OZ7A 2ZKCA 5DU5A 2Q59A 1FM6A 4RZFA 4M8EA 1I38A 2ZXNA 3NOAA 4OEDA 3FC6B 4OIUA 1S9QA 2ZY0A 4IA7A 4RE8A 3VT7A 2AX9A 3A9EA 4MGAB 5JJMA 5DUHA 3NSPA 3OOFA 2FSZA 2QXMA 1E3GA 1MVCA 3OMPA 1G2NA 5ACCA 3V9VA 2HCDA 4Q50A 3V3EA 3R5MA 4J5WC 2O9IA 1VJBA 3KWYA 1XIUA 2ZNNA 3IA6A 2J14A 1N46A 1XOWA 4NUFA 3PEQA 3FALA 3HODA 4ZO1X 2GPUA 2IOGA 4S14A 4OZRE 4RMDA 4UDCA 3DCUA 4MGDA 1XQ3A 4MG7B 4CI4A 3MNOA 1OVLB 5DXBB 1XZXX 5LGAA 2B23A 4G21A 5KCEA 2P1TA 4UDBA 3ADWA 5AVLA 4E2JA 5G5WA 2AA5A 3HC5A 1DB1A 2PIPL 2NXXA 4MG5A 5KRFA 3UUDB 2GIUA 2Q70A 1XP1A 4J26A 5DSHA 4N8RA 5DZHA 3WFGA 5KCDA 5C4OA 1Z5XU 2QABA 4N1YA 4PPPA 3DCTA 1T74A 3W0GA 3ADUA 2JJ3A 4IVYA 5EGVA 2Q1HA 3B0RA 3UVVA 3X1IA 4ZNTA 4J5WA 5DKBA 3ADSA 5APKA 5G43A 1RDTA 5APJA 4OFRA 1NAXA 2ZASA 4IA2A 4NQAB 2HARA 1N4HA 2YLYA 5FQPA 4IQRA 5DXRA 3TKCA 3VTCA 3VHWA 4TV1B 1UHLB 2AA6A 2Q61A 3B1MA 3OZ0A 1EXAA 2P1UA 4XI3A 5EHJA 4X1GA 4ZI1A 2P54A 2ZK4A 3IPQA 1PQ9A 3QT0A 4CSJA 5LWPA 3UP0A 3K6PA 5DMFA 1FM9D 1Z5XE 3AUQA 1QKUA 3D5FA 3KMGA 4KZIA 2NXXE 4ONIA 1RKGA 4G2IA 3F7DA 4K4JA 1TXIA 1ILGA 4FGYA 2AX8A 4IA3A 5DV8A 2PIUA 3L3XA 3OKHA 1M13A 3HQ5A 3AZ1A 4A4VA 4CI5A 5HJPB 1OT7A 2ZK1A 3AN4A 4Q0AC 3L03A 2G44A 3H52A 3VT6A 4JYGA 5E14A 1ZAFA 3X1HA 2POGA 1A28A 1NDEA 4E4KA 4YMQA 5DI7A 1XLSA 5KRMA 4S0TA 1L2JA 2ACLB 3B0WA 3ZR7A 3A2JA 5DXMA 1NUOA 2OM9A 3AZ3A 3ZQTA 1YUCA 2PKLA 5E0WA 1ERRA 5KRJA 4DK7A 3E00A 3CDSA 2Q5SA 3DZUD 3D90A 3K8SA 4HLWA 4PRGA 4OIVA 1DKFB 5KD9A 5AYGA 2NV7A 3BQDA 2HAMA 2I0JA 1U3SA 4POHA 1YP0A 3L3ZA 4J24A 5AWJA 4XLDA 2R6WA 1S9PA 3KDTA 5DV6A 1KNUA 3CS4A 3A40X 2PRGA 1IE8A 5E7VA 1T63A 1T7FA 1Z95A 1SKXA 2IOKA 3AFRA 1I7IA 1XDKA 4OEYA 1XLSE 2BAWA 2R6YA 4OJ9A 4DORA 4YPQA 1X7RA 5DWIA 2ZNQA 2GPPA 4DM8A 1EXXA 5DP0A 2F4BA 5GICA 2OVHA 4K7AA 5DZ3A 2PJLA 4ZOMA 1RJKA 4J5XC 2YFEA 1G1UA 3M7RA 2PIWA 2I4PA 3AN3A 5DX3B 2B1VA 1YIMA 5L7EA 1X76A 2YJDA 1XV9B 2VV4A 2QTUA 2ZK6A 2Q7LA 4XUMA 4R06A 2ZMJA 3W0CA 3VTDA 2XYWA 2O4RA 1K7LA 3ZRBA 2HWRA 2XKWA 4LTWA 2QGTA 1TFCA 3WMHA 3G8OA 4NB6A 5C4UA 3VHVA 4S0SA 1RKHA 2QA8A 3OMOA 2J4AA 2VV1B 3ADXA 5G44A 4ZJWA 5DUEA 4REEA 3AZ2A 3H0AA 4Y29A 3BEJA 2Q8SA 4ITEA 2AX6A 2VSRA 4MDDA 2I0GA 4B7WA 2PIVA 1PRGA 4YT1A 2O4JA 3OLLA 3R5NA 2Q5PA 4J5XA 2AA2A 1LBDA 5L11A 1NHZA 5DXQA 2PNUA 2J7YA 3R8DA 1FBYA 2HFPA 4OILA 5DZIA 3UUAB 1PCGA 1OSVA 4JAZA 1QKMA 2P7AA 3IXPD 5CJ6A 3RVFA 5GT4A 2OUZA 3E00D 3FS1A 2V7CA 4OLMA 1R1KD 5DYDA 4WVDA 2Q59B 3L0EA 4MG8A 4MG9A 1QKTA 5E19A 3A78A 1YJEA 4RAKA 5DL4A 4RUPA 3W5TA 4EMAA 3CDPA 5KCCA 5L7GA 2P7GA 1R5KA 1T76A 2G0GA 3V49A 1T7RA 2Q5GA 3OMQA 4PP6A 4G20A 5AZVA 2BJ4B 3VRTA 4ZN9A 3OLSA 2AXAA 4M8HA 2A3IA 4K6IA 5G3JA 3FXVA 3P8XA 3R8AA 3V9YA 3WT6A 3VRVA 4RWVA 3W0IA 1Y9RA 2Q60A 3FALB 3ET0A 2FVJA
chains in the Genus database with same CATH topology
4MGDB 1L2IA 2ZNOA 3OOKA 2AX7A 4IWCA 4IV4A 4OEAA 1P8DA 1YOWA 2Q7KA 2ZVTA 3B5RA 1H9UA 4OK1A 3TKMA 5DRMA 4POJA 3DR1A 4OEZA 3A2IA 1R20A 1T5ZA 4RFWA 2AAXA 5DIEA 5EI1A 1HJ1A 5G45A 3R8IA 3VRWA 2JF9A 5DMCA 3HVLA 4FN9A 5DVSA 4DOSA 1MZNA 1XVPA 1S19A 3B3KA 3ERDA 4OARA 3VTBA 3OS8C 4MGBA 4DK8A 2YLOA 3VRUA 4TUZA 3CJWA 1ZDUA 4OHAA 5KRLA 4TV1A 4EM9A 3OGTA 5DWJA 3F5CA 4OJBA 4PVUA 2YLPA 4QE6A 3V9TA 3CLDA 3R2AA 4XTAA 3TX7B 3GWSX 3VT9A 4ZO1B 2Q7JA 3OKIA 4L98A 3VSPA 3W0YA 1K74D 3KMRA 5KCTA 5DXEA 2Q3YA 3WFFA 1KV6A 1P93A 3HZFA 2ZMHA 3U9QA 5AAUA 1XNXA 3AX8A 4N73A 2ATHA 4PPSA 1FCZA 5E1CA 5GIDA 4IA1A 5IAWA 1T73A 1XP6A 3B65A 3B0QA 1ZEOA 2AWHA 3SZ1A 1BSXA 1FM6D 2ZMIA 1N83A 5F9BA 2VV2A 5A86A 2OCFA 5IZ0A 2XHSA 4PP3A 5KRCA 4LNWA 5JI0D 1NQ0A 1RK3A 3PBAA 3PRGA 3VI8A 3GN8A 3VT4A 2ACLA 1PQ6A 5DVCA 3HC6A 1I37A 1XB7A 2JFAA 2YATA 3FURA 2HBHA 2QZOA 4WQPA 5FQRA 2J7XA 4RMCA 5E0XA 4DM6A 3JZBA 4O8FA 1T7MA 3E94A 3X36A 2E2RA 3GYUA 1U3QA 5G42A 5HJSA 4UDDA 3D6DA 2P7ZA 3ILZA 2EWPA 4MGCA 2H77A 1XJ7A 1SJ0A 2ZXZA 4XUHA 2AM9A 3B66A 5DXPA 3UP3A 1YMTA 3PCUA 1NQ2A 4G2HA 3T03A 3ET3A 3UUCA 1MV9A 2PIQA 1K4WA 3HO0A 5GIEA 1G50A 2Q7IA 3G8IA 2ZBSA 2LBDA 3P0UA 5HCVA 3P88A 4Q13A 2W8YA 2GP7A 5KRHA 2I4ZA 3CQVA 2GTKA 2B50A 1NQ7A 3N00A 4ZNHA 3LMPA 2HB8A 1ILHA 2P15A 3EYBA 1ZGYA 4JYHA 2PIOA 1PDUA 2PITA 1RDTD 4IUIA 3WWRA 1R20D 5DWLA 3ERTA 4XT9A 5DKGA 3GZ9A 1XDKB 5EC9A 3OSIA 3AURA 1S0ZA 3NSQA 5DZ0A 4PF3A 3WT7A 2YLQA 3BC5A 4BCRA 1SQNA 3Q95A 2VV0A 3OSAA 5M96A 1ZKYA 4LBDA 3KFCA 4P6WA 1GWQA 1X7BA 5ICKA 3FLIA 2AMBA 2HWQA 3O1DA 5AWKA 3W0HA 3WTQA 5DKEA 1IE9A 1T65A 4PLEA 3MNPA 2VV1A 4PP5A 5DTVA 3UU7A 3WGPA 2VV4B 2QE4A 1GWRA 3L0LA 2AO6A 2QPYA 5AAVA 1PQCA 4MG6A 2ZXMA 4LSJA 4FNEA 1KKQA 3KPZA 5KROA 4X1FA 2HC4A 2REWA 3DY6A 2ZLAA 3FC6A 3D24A 3K23A 2POBA 3VSOA 2I4JA 3A2HA 4RZGA 4MGAA 4XHDA 5E15A 1UOMA 1XPCA 2R40A 4R2UA 5DXGA 1X7JA 2QA8B 2IHQA 2YJAB 2PIXA 3OS9A 4OC7A 3KYTA 3DZYA 1PZLA 1R6GA 3FEJA 1OSHA 5FQTA 4QJRA 1GWXA 4G1YA 5KRAA 5KRIA 3IPSA 5DZ1A 1NRLA 4RUJA 4A4WA 4OKTA 3S9SA 3A9EB 5JJMB 5DLRA 3RUUA 4MG7A 4NIEA 1OVLA 5DXBA 5KYAA 3MNEA 4ZJRA 3FEIA 4ITFA 5SYZA 3JZCA 4WPFA 2GL8A 3OZJA 4IVWA 2Z4BA 4RMEA 2BJ4A 1FCYA 5AZTA 3DZUA 2ZLCA 1T7TA 3RY9A 3UUDA 3FUGA 4OGHA 3VJSA 2AMAA 3OMMA 4IW8A 4MG8B 4MG9B 5G46A 3D57A 3KBAA 2QA6A 1YY4A 2QMVA 4G1ZA 3SP9A 3G0WA 2QNVA 5EITA 5DIGA 2QSEA 5FQSA 2Q1VA 5DK9A 5DKSA 2AYRA 5APHA 1S0XA 3HLVA 1ZUCA 2QR9A 2VSTA 2FAIA 3VJHA 2OVMA 5FQVA 3RUTA 2NPAA 1UHLA 2Q6RA 3G9EA 4WHGA 5DRJA 5ETHA 1YA3A 4QE8A 1FCXA 3CS6A 3UVVB 1A52A 5HYKA 3P89A 5K13A 3PLZA 1ZDTA 4IS8A 2PIRA 5HZCA 2GPOA 3ADVA 3CS8A 2V0VA 4L96A 2G0HA 5DIDA 1FD0A 5DXKA 2P4YA 2HASA 2PINA 1NYXA 2ZK5A 2ZFXA 1XVPB 3H0AD 3IPUA 3O1EA 5DVVA 4MGBB 1UPVA 5HJPA 3ZRAA 4JYIA 4TUZB 4A2JA 4P6XA 3AUNA 1I7GA 2AA7A 3VT8A 3W5RA 3F5CB 4OKBA 3WT5A 2YHDA 1UPWA 2QH6A 4N5GA 4RUOX 1Q4XA 2HVCA 4APUA 4PLDA 3OS8A 4XAOA 1Y0XX 3CWDA 3VHUA 5DWGA 2R40D 3W5PA 1E3KA 4RZEA 4JGVA 3X31A 4DMAA 4DQMA 1PK5A 4OKWA 5EJVA 4FHIA 1EREA 3ADTA 3DZYD 3TY0A 1XNNA 3HM1A 2ZNPA 1YINA 1DKFA 4IW6A 1ZH7A 3B0TA 5DV3A 3ET2A 4E4QA 4ZNWA 2P1VA 3GBKA 3B68A 3V4AA 3VT5A 5DYBA 2B1ZA 3WJ5A 1M7WA 4OJ4A 5AK2A 4IU7A 4KZJA 2JFAB 4JL4A 3LBDA 2QZOB 2ZK0A 3IXPA 3A3ZX 4ZNUA 1X78A 1YYEA 2VV3A 3CTBA 4OH6A 4HEEX 3KMZA 1R1KA 3E7CA 3VJIA 1QKNA 4QL8A 1SR7A 5C4SA 4QM0A 4S15A 2QXSA 5B41A 2XYJA 2GWXA 3DT3A 3L1BA 1GS4A 1LV2A 4PXMA 4REFA 4WHFA 1NQ1A 4OKXA 4ZNVA 5AVIA 5DUGA 4R6SA 5C4TA 5HYRA 2AB2A 1G5YA 5KYJA 5DX3A 4F9MA 3IMYA 3PO9A 1U9EA 1T79A 3GYTA 1XV9A 1HG4A 4OH5A 5KRKA 4IWFA 1X7EA 2QW4A 4OZTU 4FHHA 1WM0X 3SP6A 5KCFA 4YNKA 2ZL9A 5I4VA 3GWXA 5KCUA 3OMKA 1XQCA 4WLBA 2Q6SA 3RLJA 2ZK3A 5JY3A 5KCWA 2Z4JA 2NW4A 1Y0SA 2OAXA 3L0JA 1XP9A 5L7HA 4LNXA 2QGWA 3VT3A 5IXKA 3OAPA 2G5OA 4QK4A 3OSWA 4ZNSA 5KR9A 3K22A 2GPVA 5H1EA 3RLLA 1NAVA 1FM9A 1U3RA 4UDAA 3Q95B 5DWEA 3OLFA 3B67A 4PWLA 2ABIA 2Q6JA 4ZN7A 2H79A 3W0JA 3KDUA 4OFUA 1K74A 2ZK2A 3GD2A 1XAPA 1YOKA 3UUAA 3WJ4A 4G1DA 3ET1A 4OZTE 5DY8A 2HB7A 2XYXA 3W5QA 4IV2A 4KZMA 5B5BA 3UU7B 4NY9A 3VJTA 3VN2A 3W0AA 4OZRU 1M2ZA 3R29A 5AAVB 3V3QA 2OZ7A 2ZKCA 5DU5A 2Q59A 1FM6A 4RZFA 4M8EA 1I38A 2ZXNA 3NOAA 4OEDA 3FC6B 4OIUA 1S9QA 2ZY0A 4IA7A 4RE8A 3VT7A 2AX9A 3A9EA 4MGAB 5JJMA 5DUHA 3NSPA 3OOFA 2FSZA 2QXMA 1E3GA 1MVCA 3OMPA 1G2NA 5ACCA 3V9VA 2HCDA 4Q50A 3V3EA 3R5MA 4J5WC 2O9IA 1VJBA 3KWYA 1XIUA 2ZNNA 3IA6A 2J14A 1N46A 1XOWA 4NUFA 3PEQA 3FALA 3HODA 4ZO1X 2GPUA 2IOGA 4S14A 4OZRE 4RMDA 4UDCA 3DCUA 4MGDA 1XQ3A 4MG7B 4CI4A 3MNOA 1OVLB 5DXBB 1XZXX 5LGAA 2B23A 4G21A 5KCEA 2P1TA 4UDBA 3ADWA 5AVLA 4E2JA 5G5WA 2AA5A 3HC5A 1DB1A 2PIPL 2NXXA 4MG5A 5KRFA 3UUDB 2GIUA 2Q70A 1XP1A 4J26A 5DSHA 4N8RA 5DZHA 3WFGA 5KCDA 5C4OA 1Z5XU 2QABA 4N1YA 4PPPA 3DCTA 1T74A 3W0GA 3ADUA 2JJ3A 4IVYA 5EGVA 2Q1HA 3B0RA 3UVVA 3X1IA 4ZNTA 4J5WA 5DKBA 3ADSA 5APKA 5G43A 1RDTA 5APJA 4OFRA 1NAXA 2ZASA 4IA2A 4NQAB 2HARA 1N4HA 2YLYA 5FQPA 4IQRA 5DXRA 3TKCA 3VTCA 3VHWA 4TV1B 1UHLB 2AA6A 2Q61A 3B1MA 3OZ0A 1EXAA 2P1UA 4XI3A 5EHJA 4X1GA 4ZI1A 2P54A 2ZK4A 3IPQA 1PQ9A 3QT0A 4CSJA 5LWPA 3UP0A 3K6PA 5DMFA 1FM9D 1Z5XE 3AUQA 1QKUA 3D5FA 3KMGA 4KZIA 2NXXE 4ONIA 1RKGA 4G2IA 3F7DA 4K4JA 1TXIA 1ILGA 4FGYA 2AX8A 4IA3A 5DV8A 2PIUA 3L3XA 3OKHA 1M13A 3HQ5A 3AZ1A 4A4VA 4CI5A 5HJPB 1OT7A 2ZK1A 3AN4A 4Q0AC 3L03A 2G44A 3H52A 3VT6A 4JYGA 5E14A 1ZAFA 3X1HA 2POGA 1A28A 1NDEA 4E4KA 4YMQA 5DI7A 1XLSA 5KRMA 4S0TA 1L2JA 2ACLB 3B0WA 3ZR7A 3A2JA 5DXMA 1NUOA 2OM9A 3AZ3A 3ZQTA 1YUCA 2PKLA 5E0WA 1ERRA 5KRJA 4DK7A 3E00A 3CDSA 2Q5SA 3DZUD 3D90A 3K8SA 4HLWA 4PRGA 4OIVA 1DKFB 5KD9A 5AYGA 2NV7A 3BQDA 2HAMA 2I0JA 1U3SA 4POHA 1YP0A 3L3ZA 4J24A 5AWJA 4XLDA 2R6WA 1S9PA 3KDTA 5DV6A 1KNUA 3CS4A 3A40X 2PRGA 1IE8A 5E7VA 1T63A 1T7FA 1Z95A 1SKXA 2IOKA 3AFRA 1I7IA 1XDKA 4OEYA 1XLSE 2BAWA 2R6YA 4OJ9A 4DORA 4YPQA 1X7RA 5DWIA 2ZNQA 2GPPA 4DM8A 1EXXA 5DP0A 2F4BA 5GICA 2OVHA 4K7AA 5DZ3A 2PJLA 4ZOMA 1RJKA 4J5XC 2YFEA 1G1UA 3M7RA 2PIWA 2I4PA 3AN3A 5DX3B 2B1VA 1YIMA 5L7EA 1X76A 2YJDA 1XV9B 2VV4A 2QTUA 2ZK6A 2Q7LA 4XUMA 4R06A 2ZMJA 3W0CA 3VTDA 2XYWA 2O4RA 1K7LA 3ZRBA 2HWRA 2XKWA 4LTWA 2QGTA 1TFCA 3WMHA 3G8OA 4NB6A 5C4UA 3VHVA 4S0SA 1RKHA 2QA8A 3OMOA 2J4AA 2VV1B 3ADXA 5G44A 4ZJWA 5DUEA 4REEA 3AZ2A 3H0AA 4Y29A 3BEJA 2Q8SA 4ITEA 2AX6A 2VSRA 4MDDA 2I0GA 4B7WA 2PIVA 1PRGA 4YT1A 2O4JA 3OLLA 3R5NA 2Q5PA 4J5XA 2AA2A 1LBDA 5L11A 1NHZA 5DXQA 2PNUA 2J7YA 3R8DA 1FBYA 2HFPA 4OILA 5DZIA 3UUAB 1PCGA 1OSVA 4JAZA 1QKMA 2P7AA 3IXPD 5CJ6A 3RVFA 5GT4A 2OUZA 3E00D 3FS1A 2V7CA 4OLMA 1R1KD 5DYDA 4WVDA 2Q59B 3L0EA 4MG8A 4MG9A 1QKTA 5E19A 3A78A 1YJEA 4RAKA 5DL4A 4RUPA 3W5TA 4EMAA 3CDPA 5KCCA 5L7GA 2P7GA 1R5KA 1T76A 2G0GA 3V49A 1T7RA 2Q5GA 3OMQA 4PP6A 4G20A 5AZVA 2BJ4B 3VRTA 4ZN9A 3OLSA 2AXAA 4M8HA 2A3IA 4K6IA 5G3JA 3FXVA 3P8XA 3R8AA 3V9YA 3WT6A 3VRVA 4RWVA 3W0IA 1Y9RA 2Q60A 3FALB 3ET0A 2FVJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MGD B;  1L2I A;  2ZNO A;  3OOK A;  2AX7 A;  4IWC A;  4IV4 A;  4OEA A;  1P8D A;  1YOW A;  2Q7K A;  2ZVT A;  3B5R A;  1H9U A;  4OK1 A;  3TKM A;  5DRM A;  4POJ A;  3DR1 A;  4OEZ A;  3A2I A;  1R20 A;  1T5Z A;  4RFW A;  2AAX A;  5DIE A;  5EI1 A;  1HJ1 A;  5G45 A;  3R8I A;  3VRW A;  2JF9 A;  5DMC A;  3HVL A;  4FN9 A;  5DVS A;  4DOS A;  1MZN A;  1XVP A;  1S19 A;  3B3K A;  3ERD A;  4OAR A;  3VTB A;  3OS8 C;  4MGB A;  4DK8 A;  2YLO A;  3VRU A;  4TUZ A;  3CJW A;  1ZDU A;  4OHA A;  5KRL A;  4TV1 A;  4EM9 A;  3OGT A;  5DWJ A;  3F5C A;  4OJB A;  4PVU A;  2YLP A;  4QE6 A;  3V9T A;  3CLD A;  3R2A A;  4XTA A;  3TX7 B;  3GWS X;  3VT9 A;  4ZO1 B;  2Q7J A;  3OKI A;  4L98 A;  3VSP A;  3W0Y A;  1K74 D;  3KMR A;  5KCT A;  5DXE A;  2Q3Y A;  3WFF A;  1KV6 A;  1P93 A;  3HZF A;  2ZMH A;  3U9Q A;  5AAU A;  1XNX A;  3AX8 A;  4N73 A;  2ATH A;  4PPS A;  1FCZ A;  5E1C A;  5GID A;  4IA1 A;  5IAW A;  1T73 A;  1XP6 A;  3B65 A;  3B0Q A;  1ZEO A;  2AWH A;  3SZ1 A;  1BSX A;  1FM6 D;  2ZMI A;  1N83 A;  5F9B A;  2VV2 A;  5A86 A;  2OCF A;  5IZ0 A;  2XHS A;  4PP3 A;  5KRC A;  4LNW A;  5JI0 D;  1NQ0 A;  1RK3 A;  3PBA A;  3PRG A;  3VI8 A;  3GN8 A;  3VT4 A;  2ACL A;  1PQ6 A;  5DVC A;  3HC6 A;  1I37 A;  1XB7 A;  2JFA A;  2YAT A;  3FUR A;  2HBH A;  2QZO A;  4WQP A;  5FQR A;  2J7X A;  4RMC A;  5E0X A;  4DM6 A;  3JZB A;  4O8F A;  1T7M A;  3E94 A;  3X36 A;  2E2R A;  3GYU A;  1U3Q A;  5G42 A;  5HJS A;  4UDD A;  3D6D A;  2P7Z A;  3ILZ A;  2EWP A;  4MGC A;  2H77 A;  1XJ7 A;  1SJ0 A;  2ZXZ A;  4XUH A;  2AM9 A;  3B66 A;  5DXP A;  3UP3 A;  1YMT A;  3PCU A;  1NQ2 A;  4G2H A;  3T03 A;  3ET3 A;  3UUC A;  1MV9 A;  2PIQ A;  1K4W A;  3HO0 A;  5GIE A;  1G50 A;  2Q7I A;  3G8I A;  2ZBS A;  2LBD A;  3P0U A;  5HCV A;  3P88 A;  4Q13 A;  2W8Y A;  2GP7 A;  5KRH A;  2I4Z A;  3CQV A;  2GTK A;  2B50 A;  1NQ7 A;  3N00 A;  4ZNH A;  3LMP A;  2HB8 A;  1ILH A;  2P15 A;  3EYB A;  1ZGY A;  4JYH A;  2PIO A;  1PDU A;  2PIT A;  1RDT D;  4IUI A;  3WWR A;  1R20 D;  5DWL A;  3ERT A;  4XT9 A;  5DKG A;  3GZ9 A;  1XDK B;  5EC9 A;  3OSI A;  3AUR A;  1S0Z A;  3NSQ A;  5DZ0 A;  4PF3 A;  3WT7 A;  2YLQ A;  3BC5 A;  4BCR A;  1SQN A;  3Q95 A;  2VV0 A;  3OSA A;  5M96 A;  1ZKY A;  4LBD A;  3KFC A;  4P6W A;  1GWQ A;  1X7B A;  5ICK A;  3FLI A;  2AMB A;  2HWQ A;  3O1D A;  5AWK A;  3W0H A;  3WTQ A;  5DKE A;  1IE9 A;  1T65 A;  4PLE A;  3MNP A;  2VV1 A;  4PP5 A;  5DTV A;  3UU7 A;  3WGP A;  2VV4 B;  2QE4 A;  1GWR A;  3L0L A;  2AO6 A;  2QPY A;  5AAV A;  1PQC A;  4MG6 A;  2ZXM A;  4LSJ A;  4FNE A;  1KKQ A;  3KPZ A;  5KRO A;  4X1F A;  2HC4 A;  2REW A;  3DY6 A;  2ZLA A;  3FC6 A;  3D24 A;  3K23 A;  2POB A;  3VSO A;  2I4J A;  3A2H A;  4RZG A;  4MGA A;  4XHD A;  5E15 A;  1UOM A;  1XPC A;  2R40 A;  4R2U A;  5DXG A;  1X7J A;  2QA8 B;  2IHQ A;  2YJA B;  2PIX A;  3OS9 A;  4OC7 A;  3KYT A;  3DZY A;  1PZL A;  1R6G A;  3FEJ A;  1OSH A;  5FQT A;  4QJR A;  1GWX A;  4G1Y A;  5KRA A;  5KRI A;  3IPS A;  5DZ1 A;  1NRL A;  4RUJ A;  4A4W A;  4OKT A;  3S9S A;  3A9E B;  5JJM B;  5DLR A;  3RUU A;  4MG7 A;  4NIE A;  1OVL A;  5DXB A;  5KYA A;  3MNE A;  4ZJR A;  3FEI A;  4ITF A;  5SYZ A;  3JZC A;  4WPF A;  2GL8 A;  3OZJ A;  4IVW A;  2Z4B A;  4RME A;  2BJ4 A;  1FCY A;  5AZT A;  3DZU A;  2ZLC A;  1T7T A;  3RY9 A;  3UUD A;  3FUG A;  4OGH A;  3VJS A;  2AMA A;  3OMM A;  4IW8 A;  4MG8 B;  4MG9 B;  5G46 A;  3D57 A;  3KBA A;  2QA6 A;  1YY4 A;  2QMV A;  4G1Z A;  3SP9 A;  3G0W A;  2QNV A;  5EIT A;  5DIG A;  2QSE A;  5FQS A;  2Q1V A;  5DK9 A;  5DKS A;  2AYR A;  5APH A;  1S0X A;  3HLV A;  1ZUC A;  2QR9 A;  2VST A;  2FAI A;  3VJH A;  2OVM A;  5FQV A;  3RUT A;  2NPA A;  1UHL A;  2Q6R A;  3G9E A;  4WHG A;  5DRJ A;  5ETH A;  1YA3 A;  4QE8 A;  1FCX A;  3CS6 A;  3UVV B;  1A52 A;  5HYK A;  3P89 A;  5K13 A;  3PLZ A;  1ZDT A;  4IS8 A;  2PIR A;  5HZC A;  2GPO A;  3ADV A;  3CS8 A;  2V0V A;  4L96 A;  2G0H A;  5DID A;  1FD0 A;  5DXK A;  2P4Y A;  2HAS A;  2PIN A;  1NYX A;  2ZK5 A;  2ZFX A;  1XVP B;  3H0A D;  3IPU A;  3O1E A;  5DVV A;  4MGB B;  1UPV A;  5HJP A;  3ZRA A;  4JYI A;  4TUZ B;  4A2J A;  4P6X A;  3AUN A;  1I7G A;  2AA7 A;  3VT8 A;  3W5R A;  3F5C B;  4OKB A;  3WT5 A;  2YHD A;  1UPW A;  2QH6 A;  4N5G A;  4RUO X;  1Q4X A;  2HVC A;  4APU A;  4PLD A;  3OS8 A;  4XAO A;  1Y0X X;  3CWD A;  3VHU A;  5DWG A;  2R40 D;  3W5P A;  1E3K A;  4RZE A;  4JGV A;  3X31 A;  4DMA A;  4DQM A;  1PK5 A;  4OKW A;  5EJV A;  4FHI A;  1ERE A;  3ADT A;  3DZY D;  3TY0 A;  1XNN A;  3HM1 A;  2ZNP A;  1YIN A;  1DKF A;  4IW6 A;  1ZH7 A;  3B0T A;  5DV3 A;  3ET2 A;  4E4Q A;  4ZNW A;  2P1V A;  3GBK A;  3B68 A;  3V4A A;  3VT5 A;  5DYB A;  2B1Z A;  3WJ5 A;  1M7W A;  4OJ4 A;  5AK2 A;  4IU7 A;  4KZJ A;  2JFA B;  4JL4 A;  3LBD A;  2QZO B;  2ZK0 A;  3IXP A;  3A3Z X;  4ZNU A;  1X78 A;  1YYE A;  2VV3 A;  3CTB A;  4OH6 A;  4HEE X;  3KMZ A;  1R1K A;  3E7C A;  3VJI A;  1QKN A;  4QL8 A;  1SR7 A;  5C4S A;  4QM0 A;  4S15 A;  2QXS A;  5B41 A;  2XYJ A;  2GWX A;  3DT3 A;  3L1B A;  1GS4 A;  1LV2 A;  4PXM A;  4REF A;  4WHF A;  1NQ1 A;  4OKX A;  4ZNV A;  5AVI A;  5DUG A;  4R6S A;  5C4T A;  5HYR A;  2AB2 A;  1G5Y A;  5KYJ A;  5DX3 A;  4F9M A;  3IMY A;  3PO9 A;  1U9E A;  1T79 A;  3GYT A;  1XV9 A;  1HG4 A;  4OH5 A;  5KRK A;  4IWF A;  1X7E A;  2QW4 A;  4OZT U;  4FHH A;  1WM0 X;  3SP6 A;  5KCF A;  4YNK A;  2ZL9 A;  5I4V A;  3GWX A;  5KCU A;  3OMK A;  1XQC A;  4WLB A;  2Q6S A;  3RLJ A;  2ZK3 A;  5JY3 A;  5KCW A;  2Z4J A;  2NW4 A;  1Y0S A;  2OAX A;  3L0J A;  1XP9 A;  5L7H A;  4LNX A;  2QGW A;  3VT3 A;  5IXK A;  3OAP A;  2G5O A;  4QK4 A;  3OSW A;  4ZNS A;  5KR9 A;  3K22 A;  2GPV A;  5H1E A;  3RLL A;  1NAV A;  1FM9 A;  1U3R A;  4UDA A;  3Q95 B;  5DWE A;  3OLF A;  3B67 A;  4PWL A;  2ABI A;  2Q6J A;  4ZN7 A;  2H79 A;  3W0J A;  3KDU A;  4OFU A;  1K74 A;  2ZK2 A;  3GD2 A;  1XAP A;  1YOK A;  3UUA A;  3WJ4 A;  4G1D A;  3ET1 A;  4OZT E;  5DY8 A;  2HB7 A;  2XYX A;  3W5Q A;  4IV2 A;  4KZM A;  5B5B A;  3UU7 B;  4NY9 A;  3VJT A;  3VN2 A;  3W0A A;  4OZR U;  1M2Z A;  3R29 A;  5AAV B;  3V3Q A;  2OZ7 A;  2ZKC A;  5DU5 A;  2Q59 A;  1FM6 A;  4RZF A;  4M8E A;  1I38 A;  2ZXN A;  3NOA A;  4OED A;  3FC6 B;  4OIU A;  1S9Q A;  2ZY0 A;  4IA7 A;  4RE8 A;  3VT7 A;  2AX9 A;  3A9E A;  4MGA B;  5JJM A;  5DUH A;  3NSP A;  3OOF A;  2FSZ A;  2QXM A;  1E3G A;  1MVC A;  3OMP A;  1G2N A;  5ACC A;  3V9V A;  2HCD A;  4Q50 A;  3V3E A;  3R5M A;  4J5W C;  2O9I A;  1VJB A;  3KWY A;  1XIU A;  2ZNN A;  3IA6 A;  2J14 A;  1N46 A;  1XOW A;  4NUF A;  3PEQ A;  3FAL A;  3HOD A;  4ZO1 X;  2GPU A;  2IOG A;  4S14 A;  4OZR E;  4RMD A;  4UDC A;  3DCU A;  4MGD A;  1XQ3 A;  4MG7 B;  4CI4 A;  3MNO A;  1OVL B;  5DXB B;  1XZX X;  5LGA A;  2B23 A;  4G21 A;  5KCE A;  2P1T A;  4UDB A;  3ADW A;  5AVL A;  4E2J A;  5G5W A;  2AA5 A;  3HC5 A;  1DB1 A;  2PIP L;  2NXX A;  4MG5 A;  5KRF A;  3UUD B;  2GIU A;  2Q70 A;  1XP1 A;  4J26 A;  5DSH A;  4N8R A;  5DZH A;  3WFG A;  5KCD A;  5C4O A;  1Z5X U;  2QAB A;  4N1Y A;  4PPP A;  3DCT A;  1T74 A;  3W0G A;  3ADU A;  2JJ3 A;  4IVY A;  5EGV A;  2Q1H A;  3B0R A;  3UVV A;  3X1I A;  4ZNT A;  4J5W A;  5DKB A;  3ADS A;  5APK A;  5G43 A;  1RDT A;  5APJ A;  4OFR A;  1NAX A;  2ZAS A;  4IA2 A;  4NQA B;  2HAR A;  1N4H A;  2YLY A;  5FQP A;  4IQR A;  5DXR A;  3TKC A;  3VTC A;  3VHW A;  4TV1 B;  1UHL B;  2AA6 A;  2Q61 A;  3B1M A;  3OZ0 A;  1EXA A;  2P1U A;  4XI3 A;  5EHJ A;  4X1G A;  4ZI1 A;  2P54 A;  2ZK4 A;  3IPQ A;  1PQ9 A;  3QT0 A;  4CSJ A;  5LWP A;  3UP0 A;  3K6P A;  5DMF A;  1FM9 D;  1Z5X E;  3AUQ A;  1QKU A;  3D5F A;  3KMG A;  4KZI A;  2NXX E;  4ONI A;  1RKG A;  4G2I A;  3F7D A;  4K4J A;  1TXI A;  1ILG A;  4FGY A;  2AX8 A;  4IA3 A;  5DV8 A;  2PIU A;  3L3X A;  3OKH A;  1M13 A;  3HQ5 A;  3AZ1 A;  4A4V A;  4CI5 A;  5HJP B;  1OT7 A;  2ZK1 A;  3AN4 A;  4Q0A C;  3L03 A;  2G44 A;  3H52 A;  3VT6 A;  4JYG A;  5E14 A;  1ZAF A;  3X1H A;  2POG A;  1A28 A;  1NDE A;  4E4K A;  4YMQ A;  5DI7 A;  1XLS A;  5KRM A;  4S0T A;  1L2J A;  2ACL B;  3B0W A;  3ZR7 A;  3A2J A;  5DXM A;  1NUO A;  2OM9 A;  3AZ3 A;  3ZQT A;  1YUC A;  2PKL A;  5E0W A;  1ERR A;  5KRJ A;  4DK7 A;  3E00 A;  3CDS A;  2Q5S A;  3DZU D;  3D90 A;  3K8S A;  4HLW A;  4PRG A;  4OIV A;  1DKF B;  5KD9 A;  5AYG A;  2NV7 A;  3BQD A;  2HAM A;  2I0J A;  1U3S A;  4POH A;  1YP0 A;  3L3Z A;  4J24 A;  5AWJ A;  4XLD A;  2R6W A;  1S9P A;  3KDT A;  5DV6 A;  1KNU A;  3CS4 A;  3A40 X;  2PRG A;  1IE8 A;  5E7V A;  1T63 A;  1T7F A;  1Z95 A;  1SKX A;  2IOK A;  3AFR A;  1I7I A;  1XDK A;  4OEY A;  1XLS E;  2BAW A;  2R6Y A;  4OJ9 A;  4DOR A;  4YPQ A;  1X7R A;  5DWI A;  2ZNQ A;  2GPP A;  4DM8 A;  1EXX A;  5DP0 A;  2F4B A;  5GIC A;  2OVH A;  4K7A A;  5DZ3 A;  2PJL A;  4ZOM A;  1RJK A;  4J5X C;  2YFE A;  1G1U A;  3M7R A;  2PIW A;  2I4P A;  3AN3 A;  5DX3 B;  2B1V A;  1YIM A;  5L7E A;  1X76 A;  2YJD A;  1XV9 B;  2VV4 A;  2QTU A;  2ZK6 A;  2Q7L A;  4XUM A;  4R06 A;  2ZMJ A;  3W0C A;  3VTD A;  2XYW A;  2O4R A;  1K7L A;  3ZRB A;  2HWR A;  2XKW A;  4LTW A;  2QGT A;  1TFC A;  3WMH A;  3G8O A;  4NB6 A;  5C4U A;  3VHV A;  4S0S A;  1RKH A;  2QA8 A;  3OMO A;  2J4A A;  2VV1 B;  3ADX A;  5G44 A;  4ZJW A;  5DUE A;  4REE A;  3AZ2 A;  3H0A A;  4Y29 A;  3BEJ A;  2Q8S A;  4ITE A;  2AX6 A;  2VSR A;  4MDD A;  2I0G A;  4B7W A;  2PIV A;  1PRG A;  4YT1 A;  2O4J A;  3OLL A;  3R5N A;  2Q5P A;  4J5X A;  2AA2 A;  1LBD A;  5L11 A;  1NHZ A;  5DXQ A;  2PNU A;  2J7Y A;  3R8D A;  1FBY A;  2HFP A;  4OIL A;  5DZI A;  3UUA B;  1PCG A;  1OSV A;  4JAZ A;  1QKM A;  2P7A A;  3IXP D;  5CJ6 A;  3RVF A;  5GT4 A;  2OUZ A;  3E00 D;  3FS1 A;  2V7C A;  4OLM A;  1R1K D;  5DYD A;  4WVD A;  2Q59 B;  3L0E A;  4MG8 A;  4MG9 A;  1QKT A;  5E19 A;  3A78 A;  1YJE A;  4RAK A;  5DL4 A;  4RUP A;  3W5T A;  4EMA A;  3CDP A;  5KCC A;  5L7G A;  2P7G A;  1R5K A;  1T76 A;  2G0G A;  3V49 A;  1T7R A;  2Q5G A;  3OMQ A;  4PP6 A;  4G20 A;  5AZV A;  2BJ4 B;  3VRT A;  4ZN9 A;  3OLS A;  2AXA A;  4M8H A;  2A3I A;  4K6I A;  5G3J A;  3FXV A;  3P8X A;  3R8A A;  3V9Y A;  3WT6 A;  3VRV A;  4RWV A;  3W0I A;  1Y9R A;  2Q60 A;  3FAL B;  3ET0 A;  2FVJ A; 
#chains in the Genus database with same CATH topology
 4MGD B;  1L2I A;  2ZNO A;  3OOK A;  2AX7 A;  4IWC A;  4IV4 A;  4OEA A;  1P8D A;  1YOW A;  2Q7K A;  2ZVT A;  3B5R A;  1H9U A;  4OK1 A;  3TKM A;  5DRM A;  4POJ A;  3DR1 A;  4OEZ A;  3A2I A;  1R20 A;  1T5Z A;  4RFW A;  2AAX A;  5DIE A;  5EI1 A;  1HJ1 A;  5G45 A;  3R8I A;  3VRW A;  2JF9 A;  5DMC A;  3HVL A;  4FN9 A;  5DVS A;  4DOS A;  1MZN A;  1XVP A;  1S19 A;  3B3K A;  3ERD A;  4OAR A;  3VTB A;  3OS8 C;  4MGB A;  4DK8 A;  2YLO A;  3VRU A;  4TUZ A;  3CJW A;  1ZDU A;  4OHA A;  5KRL A;  4TV1 A;  4EM9 A;  3OGT A;  5DWJ A;  3F5C A;  4OJB A;  4PVU A;  2YLP A;  4QE6 A;  3V9T A;  3CLD A;  3R2A A;  4XTA A;  3TX7 B;  3GWS X;  3VT9 A;  4ZO1 B;  2Q7J A;  3OKI A;  4L98 A;  3VSP A;  3W0Y A;  1K74 D;  3KMR A;  5KCT A;  5DXE A;  2Q3Y A;  3WFF A;  1KV6 A;  1P93 A;  3HZF A;  2ZMH A;  3U9Q A;  5AAU A;  1XNX A;  3AX8 A;  4N73 A;  2ATH A;  4PPS A;  1FCZ A;  5E1C A;  5GID A;  4IA1 A;  5IAW A;  1T73 A;  1XP6 A;  3B65 A;  3B0Q A;  1ZEO A;  2AWH A;  3SZ1 A;  1BSX A;  1FM6 D;  2ZMI A;  1N83 A;  5F9B A;  2VV2 A;  5A86 A;  2OCF A;  5IZ0 A;  2XHS A;  4PP3 A;  5KRC A;  4LNW A;  5JI0 D;  1NQ0 A;  1RK3 A;  3PBA A;  3PRG A;  3VI8 A;  3GN8 A;  3VT4 A;  2ACL A;  1PQ6 A;  5DVC A;  3HC6 A;  1I37 A;  1XB7 A;  2JFA A;  2YAT A;  3FUR A;  2HBH A;  2QZO A;  4WQP A;  5FQR A;  2J7X A;  4RMC A;  5E0X A;  4DM6 A;  3JZB A;  4O8F A;  1T7M A;  3E94 A;  3X36 A;  2E2R A;  3GYU A;  1U3Q A;  5G42 A;  5HJS A;  4UDD A;  3D6D A;  2P7Z A;  3ILZ A;  2EWP A;  4MGC A;  2H77 A;  1XJ7 A;  1SJ0 A;  2ZXZ A;  4XUH A;  2AM9 A;  3B66 A;  5DXP A;  3UP3 A;  1YMT A;  3PCU A;  1NQ2 A;  4G2H A;  3T03 A;  3ET3 A;  3UUC A;  1MV9 A;  2PIQ A;  1K4W A;  3HO0 A;  5GIE A;  1G50 A;  2Q7I A;  3G8I A;  2ZBS A;  2LBD A;  3P0U A;  5HCV A;  3P88 A;  4Q13 A;  2W8Y A;  2GP7 A;  5KRH A;  2I4Z A;  3CQV A;  2GTK A;  2B50 A;  1NQ7 A;  3N00 A;  4ZNH A;  3LMP A;  2HB8 A;  1ILH A;  2P15 A;  3EYB A;  1ZGY A;  4JYH A;  2PIO A;  1PDU A;  2PIT A;  1RDT D;  4IUI A;  3WWR A;  1R20 D;  5DWL A;  3ERT A;  4XT9 A;  5DKG A;  3GZ9 A;  1XDK B;  5EC9 A;  3OSI A;  3AUR A;  1S0Z A;  3NSQ A;  5DZ0 A;  4PF3 A;  3WT7 A;  2YLQ A;  3BC5 A;  4BCR A;  1SQN A;  3Q95 A;  2VV0 A;  3OSA A;  5M96 A;  1ZKY A;  4LBD A;  3KFC A;  4P6W A;  1GWQ A;  1X7B A;  5ICK A;  3FLI A;  2AMB A;  2HWQ A;  3O1D A;  5AWK A;  3W0H A;  3WTQ A;  5DKE A;  1IE9 A;  1T65 A;  4PLE A;  3MNP A;  2VV1 A;  4PP5 A;  5DTV A;  3UU7 A;  3WGP A;  2VV4 B;  2QE4 A;  1GWR A;  3L0L A;  2AO6 A;  2QPY A;  5AAV A;  1PQC A;  4MG6 A;  2ZXM A;  4LSJ A;  4FNE A;  1KKQ A;  3KPZ A;  5KRO A;  4X1F A;  2HC4 A;  2REW A;  3DY6 A;  2ZLA A;  3FC6 A;  3D24 A;  3K23 A;  2POB A;  3VSO A;  2I4J A;  3A2H A;  4RZG A;  4MGA A;  4XHD A;  5E15 A;  1UOM A;  1XPC A;  2R40 A;  4R2U A;  5DXG A;  1X7J A;  2QA8 B;  2IHQ A;  2YJA B;  2PIX A;  3OS9 A;  4OC7 A;  3KYT A;  3DZY A;  1PZL A;  1R6G A;  3FEJ A;  1OSH A;  5FQT A;  4QJR A;  1GWX A;  4G1Y A;  5KRA A;  5KRI A;  3IPS A;  5DZ1 A;  1NRL A;  4RUJ A;  4A4W A;  4OKT A;  3S9S A;  3A9E B;  5JJM B;  5DLR A;  3RUU A;  4MG7 A;  4NIE A;  1OVL A;  5DXB A;  5KYA A;  3MNE A;  4ZJR A;  3FEI A;  4ITF A;  5SYZ A;  3JZC A;  4WPF A;  2GL8 A;  3OZJ A;  4IVW A;  2Z4B A;  4RME A;  2BJ4 A;  1FCY A;  5AZT A;  3DZU A;  2ZLC A;  1T7T A;  3RY9 A;  3UUD A;  3FUG A;  4OGH A;  3VJS A;  2AMA A;  3OMM A;  4IW8 A;  4MG8 B;  4MG9 B;  5G46 A;  3D57 A;  3KBA A;  2QA6 A;  1YY4 A;  2QMV A;  4G1Z A;  3SP9 A;  3G0W A;  2QNV A;  5EIT A;  5DIG A;  2QSE A;  5FQS A;  2Q1V A;  5DK9 A;  5DKS A;  2AYR A;  5APH A;  1S0X A;  3HLV A;  1ZUC A;  2QR9 A;  2VST A;  2FAI A;  3VJH A;  2OVM A;  5FQV A;  3RUT A;  2NPA A;  1UHL A;  2Q6R A;  3G9E A;  4WHG A;  5DRJ A;  5ETH A;  1YA3 A;  4QE8 A;  1FCX A;  3CS6 A;  3UVV B;  1A52 A;  5HYK A;  3P89 A;  5K13 A;  3PLZ A;  1ZDT A;  4IS8 A;  2PIR A;  5HZC A;  2GPO A;  3ADV A;  3CS8 A;  2V0V A;  4L96 A;  2G0H A;  5DID A;  1FD0 A;  5DXK A;  2P4Y A;  2HAS A;  2PIN A;  1NYX A;  2ZK5 A;  2ZFX A;  1XVP B;  3H0A D;  3IPU A;  3O1E A;  5DVV A;  4MGB B;  1UPV A;  5HJP A;  3ZRA A;  4JYI A;  4TUZ B;  4A2J A;  4P6X A;  3AUN A;  1I7G A;  2AA7 A;  3VT8 A;  3W5R A;  3F5C B;  4OKB A;  3WT5 A;  2YHD A;  1UPW A;  2QH6 A;  4N5G A;  4RUO X;  1Q4X A;  2HVC A;  4APU A;  4PLD A;  3OS8 A;  4XAO A;  1Y0X X;  3CWD A;  3VHU A;  5DWG A;  2R40 D;  3W5P A;  1E3K A;  4RZE A;  4JGV A;  3X31 A;  4DMA A;  4DQM A;  1PK5 A;  4OKW A;  5EJV A;  4FHI A;  1ERE A;  3ADT A;  3DZY D;  3TY0 A;  1XNN A;  3HM1 A;  2ZNP A;  1YIN A;  1DKF A;  4IW6 A;  1ZH7 A;  3B0T A;  5DV3 A;  3ET2 A;  4E4Q A;  4ZNW A;  2P1V A;  3GBK A;  3B68 A;  3V4A A;  3VT5 A;  5DYB A;  2B1Z A;  3WJ5 A;  1M7W A;  4OJ4 A;  5AK2 A;  4IU7 A;  4KZJ A;  2JFA B;  4JL4 A;  3LBD A;  2QZO B;  2ZK0 A;  3IXP A;  3A3Z X;  4ZNU A;  1X78 A;  1YYE A;  2VV3 A;  3CTB A;  4OH6 A;  4HEE X;  3KMZ A;  1R1K A;  3E7C A;  3VJI A;  1QKN A;  4QL8 A;  1SR7 A;  5C4S A;  4QM0 A;  4S15 A;  2QXS A;  5B41 A;  2XYJ A;  2GWX A;  3DT3 A;  3L1B A;  1GS4 A;  1LV2 A;  4PXM A;  4REF A;  4WHF A;  1NQ1 A;  4OKX A;  4ZNV A;  5AVI A;  5DUG A;  4R6S A;  5C4T A;  5HYR A;  2AB2 A;  1G5Y A;  5KYJ A;  5DX3 A;  4F9M A;  3IMY A;  3PO9 A;  1U9E A;  1T79 A;  3GYT A;  1XV9 A;  1HG4 A;  4OH5 A;  5KRK A;  4IWF A;  1X7E A;  2QW4 A;  4OZT U;  4FHH A;  1WM0 X;  3SP6 A;  5KCF A;  4YNK A;  2ZL9 A;  5I4V A;  3GWX A;  5KCU A;  3OMK A;  1XQC A;  4WLB A;  2Q6S A;  3RLJ A;  2ZK3 A;  5JY3 A;  5KCW A;  2Z4J A;  2NW4 A;  1Y0S A;  2OAX A;  3L0J A;  1XP9 A;  5L7H A;  4LNX A;  2QGW A;  3VT3 A;  5IXK A;  3OAP A;  2G5O A;  4QK4 A;  3OSW A;  4ZNS A;  5KR9 A;  3K22 A;  2GPV A;  5H1E A;  3RLL A;  1NAV A;  1FM9 A;  1U3R A;  4UDA A;  3Q95 B;  5DWE A;  3OLF A;  3B67 A;  4PWL A;  2ABI A;  2Q6J A;  4ZN7 A;  2H79 A;  3W0J A;  3KDU A;  4OFU A;  1K74 A;  2ZK2 A;  3GD2 A;  1XAP A;  1YOK A;  3UUA A;  3WJ4 A;  4G1D A;  3ET1 A;  4OZT E;  5DY8 A;  2HB7 A;  2XYX A;  3W5Q A;  4IV2 A;  4KZM A;  5B5B A;  3UU7 B;  4NY9 A;  3VJT A;  3VN2 A;  3W0A A;  4OZR U;  1M2Z A;  3R29 A;  5AAV B;  3V3Q A;  2OZ7 A;  2ZKC A;  5DU5 A;  2Q59 A;  1FM6 A;  4RZF A;  4M8E A;  1I38 A;  2ZXN A;  3NOA A;  4OED A;  3FC6 B;  4OIU A;  1S9Q A;  2ZY0 A;  4IA7 A;  4RE8 A;  3VT7 A;  2AX9 A;  3A9E A;  4MGA B;  5JJM A;  5DUH A;  3NSP A;  3OOF A;  2FSZ A;  2QXM A;  1E3G A;  1MVC A;  3OMP A;  1G2N A;  5ACC A;  3V9V A;  2HCD A;  4Q50 A;  3V3E A;  3R5M A;  4J5W C;  2O9I A;  1VJB A;  3KWY A;  1XIU A;  2ZNN A;  3IA6 A;  2J14 A;  1N46 A;  1XOW A;  4NUF A;  3PEQ A;  3FAL A;  3HOD A;  4ZO1 X;  2GPU A;  2IOG A;  4S14 A;  4OZR E;  4RMD A;  4UDC A;  3DCU A;  4MGD A;  1XQ3 A;  4MG7 B;  4CI4 A;  3MNO A;  1OVL B;  5DXB B;  1XZX X;  5LGA A;  2B23 A;  4G21 A;  5KCE A;  2P1T A;  4UDB A;  3ADW A;  5AVL A;  4E2J A;  5G5W A;  2AA5 A;  3HC5 A;  1DB1 A;  2PIP L;  2NXX A;  4MG5 A;  5KRF A;  3UUD B;  2GIU A;  2Q70 A;  1XP1 A;  4J26 A;  5DSH A;  4N8R A;  5DZH A;  3WFG A;  5KCD A;  5C4O A;  1Z5X U;  2QAB A;  4N1Y A;  4PPP A;  3DCT A;  1T74 A;  3W0G A;  3ADU A;  2JJ3 A;  4IVY A;  5EGV A;  2Q1H A;  3B0R A;  3UVV A;  3X1I A;  4ZNT A;  4J5W A;  5DKB A;  3ADS A;  5APK A;  5G43 A;  1RDT A;  5APJ A;  4OFR A;  1NAX A;  2ZAS A;  4IA2 A;  4NQA B;  2HAR A;  1N4H A;  2YLY A;  5FQP A;  4IQR A;  5DXR A;  3TKC A;  3VTC A;  3VHW A;  4TV1 B;  1UHL B;  2AA6 A;  2Q61 A;  3B1M A;  3OZ0 A;  1EXA A;  2P1U A;  4XI3 A;  5EHJ A;  4X1G A;  4ZI1 A;  2P54 A;  2ZK4 A;  3IPQ A;  1PQ9 A;  3QT0 A;  4CSJ A;  5LWP A;  3UP0 A;  3K6P A;  5DMF A;  1FM9 D;  1Z5X E;  3AUQ A;  1QKU A;  3D5F A;  3KMG A;  4KZI A;  2NXX E;  4ONI A;  1RKG A;  4G2I A;  3F7D A;  4K4J A;  1TXI A;  1ILG A;  4FGY A;  2AX8 A;  4IA3 A;  5DV8 A;  2PIU A;  3L3X A;  3OKH A;  1M13 A;  3HQ5 A;  3AZ1 A;  4A4V A;  4CI5 A;  5HJP B;  1OT7 A;  2ZK1 A;  3AN4 A;  4Q0A C;  3L03 A;  2G44 A;  3H52 A;  3VT6 A;  4JYG A;  5E14 A;  1ZAF A;  3X1H A;  2POG A;  1A28 A;  1NDE A;  4E4K A;  4YMQ A;  5DI7 A;  1XLS A;  5KRM A;  4S0T A;  1L2J A;  2ACL B;  3B0W A;  3ZR7 A;  3A2J A;  5DXM A;  1NUO A;  2OM9 A;  3AZ3 A;  3ZQT A;  1YUC A;  2PKL A;  5E0W A;  1ERR A;  5KRJ A;  4DK7 A;  3E00 A;  3CDS A;  2Q5S A;  3DZU D;  3D90 A;  3K8S A;  4HLW A;  4PRG A;  4OIV A;  1DKF B;  5KD9 A;  5AYG A;  2NV7 A;  3BQD A;  2HAM A;  2I0J A;  1U3S A;  4POH A;  1YP0 A;  3L3Z A;  4J24 A;  5AWJ A;  4XLD A;  2R6W A;  1S9P A;  3KDT A;  5DV6 A;  1KNU A;  3CS4 A;  3A40 X;  2PRG A;  1IE8 A;  5E7V A;  1T63 A;  1T7F A;  1Z95 A;  1SKX A;  2IOK A;  3AFR A;  1I7I A;  1XDK A;  4OEY A;  1XLS E;  2BAW A;  2R6Y A;  4OJ9 A;  4DOR A;  4YPQ A;  1X7R A;  5DWI A;  2ZNQ A;  2GPP A;  4DM8 A;  1EXX A;  5DP0 A;  2F4B A;  5GIC A;  2OVH A;  4K7A A;  5DZ3 A;  2PJL A;  4ZOM A;  1RJK A;  4J5X C;  2YFE A;  1G1U A;  3M7R A;  2PIW A;  2I4P A;  3AN3 A;  5DX3 B;  2B1V A;  1YIM A;  5L7E A;  1X76 A;  2YJD A;  1XV9 B;  2VV4 A;  2QTU A;  2ZK6 A;  2Q7L A;  4XUM A;  4R06 A;  2ZMJ A;  3W0C A;  3VTD A;  2XYW A;  2O4R A;  1K7L A;  3ZRB A;  2HWR A;  2XKW A;  4LTW A;  2QGT A;  1TFC A;  3WMH A;  3G8O A;  4NB6 A;  5C4U A;  3VHV A;  4S0S A;  1RKH A;  2QA8 A;  3OMO A;  2J4A A;  2VV1 B;  3ADX A;  5G44 A;  4ZJW A;  5DUE A;  4REE A;  3AZ2 A;  3H0A A;  4Y29 A;  3BEJ A;  2Q8S A;  4ITE A;  2AX6 A;  2VSR A;  4MDD A;  2I0G A;  4B7W A;  2PIV A;  1PRG A;  4YT1 A;  2O4J A;  3OLL A;  3R5N A;  2Q5P A;  4J5X A;  2AA2 A;  1LBD A;  5L11 A;  1NHZ A;  5DXQ A;  2PNU A;  2J7Y A;  3R8D A;  1FBY A;  2HFP A;  4OIL A;  5DZI A;  3UUA B;  1PCG A;  1OSV A;  4JAZ A;  1QKM A;  2P7A A;  3IXP D;  5CJ6 A;  3RVF A;  5GT4 A;  2OUZ A;  3E00 D;  3FS1 A;  2V7C A;  4OLM A;  1R1K D;  5DYD A;  4WVD A;  2Q59 B;  3L0E A;  4MG8 A;  4MG9 A;  1QKT A;  5E19 A;  3A78 A;  1YJE A;  4RAK A;  5DL4 A;  4RUP A;  3W5T A;  4EMA A;  3CDP A;  5KCC A;  5L7G A;  2P7G A;  1R5K A;  1T76 A;  2G0G A;  3V49 A;  1T7R A;  2Q5G A;  3OMQ A;  4PP6 A;  4G20 A;  5AZV A;  2BJ4 B;  3VRT A;  4ZN9 A;  3OLS A;  2AXA A;  4M8H A;  2A3I A;  4K6I A;  5G3J A;  3FXV A;  3P8X A;  3R8A A;  3V9Y A;  3WT6 A;  3VRV A;  4RWV A;  3W0I A;  1Y9R A;  2Q60 A;  3FAL B;  3ET0 A;  2FVJ A; 
#chains in the Genus database with same CATH homology
 4MGD B;  1L2I A;  2ZNO A;  3OOK A;  2AX7 A;  4IWC A;  4IV4 A;  4OEA A;  1P8D A;  1YOW A;  2Q7K A;  2ZVT A;  3B5R A;  1H9U A;  4OK1 A;  3TKM A;  5DRM A;  4POJ A;  3DR1 A;  4OEZ A;  3A2I A;  1R20 A;  1T5Z A;  4RFW A;  2AAX A;  5DIE A;  5EI1 A;  1HJ1 A;  5G45 A;  3R8I A;  3VRW A;  2JF9 A;  5DMC A;  3HVL A;  4FN9 A;  5DVS A;  4DOS A;  1MZN A;  1XVP A;  1S19 A;  3B3K A;  3ERD A;  4OAR A;  3VTB A;  3OS8 C;  4MGB A;  4DK8 A;  2YLO A;  3VRU A;  4TUZ A;  3CJW A;  1ZDU A;  4OHA A;  5KRL A;  4TV1 A;  4EM9 A;  3OGT A;  5DWJ A;  3F5C A;  4OJB A;  4PVU A;  2YLP A;  4QE6 A;  3V9T A;  3CLD A;  3R2A A;  4XTA A;  3TX7 B;  3GWS X;  3VT9 A;  4ZO1 B;  2Q7J A;  3OKI A;  4L98 A;  3VSP A;  3W0Y A;  1K74 D;  3KMR A;  5KCT A;  5DXE A;  2Q3Y A;  3WFF A;  1KV6 A;  1P93 A;  3HZF A;  2ZMH A;  3U9Q A;  5AAU A;  1XNX A;  3AX8 A;  4N73 A;  2ATH A;  4PPS A;  1FCZ A;  5E1C A;  5GID A;  4IA1 A;  5IAW A;  1T73 A;  1XP6 A;  3B65 A;  3B0Q A;  1ZEO A;  2AWH A;  3SZ1 A;  1BSX A;  1FM6 D;  2ZMI A;  1N83 A;  5F9B A;  2VV2 A;  5A86 A;  2OCF A;  5IZ0 A;  2XHS A;  4PP3 A;  5KRC A;  4LNW A;  5JI0 D;  1NQ0 A;  1RK3 A;  3PBA A;  3PRG A;  3VI8 A;  3GN8 A;  3VT4 A;  2ACL A;  1PQ6 A;  5DVC A;  3HC6 A;  1I37 A;  1XB7 A;  2JFA A;  2YAT A;  3FUR A;  2HBH A;  2QZO A;  4WQP A;  5FQR A;  2J7X A;  4RMC A;  5E0X A;  4DM6 A;  3JZB A;  4O8F A;  1T7M A;  3E94 A;  3X36 A;  2E2R A;  3GYU A;  1U3Q A;  5G42 A;  5HJS A;  4UDD A;  3D6D A;  2P7Z A;  3ILZ A;  2EWP A;  4MGC A;  2H77 A;  1XJ7 A;  1SJ0 A;  2ZXZ A;  4XUH A;  2AM9 A;  3B66 A;  5DXP A;  3UP3 A;  1YMT A;  3PCU A;  1NQ2 A;  4G2H A;  3T03 A;  3ET3 A;  3UUC A;  1MV9 A;  2PIQ A;  1K4W A;  3HO0 A;  5GIE A;  1G50 A;  2Q7I A;  3G8I A;  2ZBS A;  2LBD A;  3P0U A;  5HCV A;  3P88 A;  4Q13 A;  2W8Y A;  2GP7 A;  5KRH A;  2I4Z A;  3CQV A;  2GTK A;  2B50 A;  1NQ7 A;  3N00 A;  4ZNH A;  3LMP A;  2HB8 A;  1ILH A;  2P15 A;  3EYB A;  1ZGY A;  4JYH A;  2PIO A;  1PDU A;  2PIT A;  1RDT D;  4IUI A;  3WWR A;  1R20 D;  5DWL A;  3ERT A;  4XT9 A;  5DKG A;  3GZ9 A;  1XDK B;  5EC9 A;  3OSI A;  3AUR A;  1S0Z A;  3NSQ A;  5DZ0 A;  4PF3 A;  3WT7 A;  2YLQ A;  3BC5 A;  4BCR A;  1SQN A;  3Q95 A;  2VV0 A;  3OSA A;  5M96 A;  1ZKY A;  4LBD A;  3KFC A;  4P6W A;  1GWQ A;  1X7B A;  5ICK A;  3FLI A;  2AMB A;  2HWQ A;  3O1D A;  5AWK A;  3W0H A;  3WTQ A;  5DKE A;  1IE9 A;  1T65 A;  4PLE A;  3MNP A;  2VV1 A;  4PP5 A;  5DTV A;  3UU7 A;  3WGP A;  2VV4 B;  2QE4 A;  1GWR A;  3L0L A;  2AO6 A;  2QPY A;  5AAV A;  1PQC A;  4MG6 A;  2ZXM A;  4LSJ A;  4FNE A;  1KKQ A;  3KPZ A;  5KRO A;  4X1F A;  2HC4 A;  2REW A;  3DY6 A;  2ZLA A;  3FC6 A;  3D24 A;  3K23 A;  2POB A;  3VSO A;  2I4J A;  3A2H A;  4RZG A;  4MGA A;  4XHD A;  5E15 A;  1UOM A;  1XPC A;  2R40 A;  4R2U A;  5DXG A;  1X7J A;  2QA8 B;  2IHQ A;  2YJA B;  2PIX A;  3OS9 A;  4OC7 A;  3KYT A;  3DZY A;  1PZL A;  1R6G A;  3FEJ A;  1OSH A;  5FQT A;  4QJR A;  1GWX A;  4G1Y A;  5KRA A;  5KRI A;  3IPS A;  5DZ1 A;  1NRL A;  4RUJ A;  4A4W A;  4OKT A;  3S9S A;  3A9E B;  5JJM B;  5DLR A;  3RUU A;  4MG7 A;  4NIE A;  1OVL A;  5DXB A;  5KYA A;  3MNE A;  4ZJR A;  3FEI A;  4ITF A;  5SYZ A;  3JZC A;  4WPF A;  2GL8 A;  3OZJ A;  4IVW A;  2Z4B A;  4RME A;  2BJ4 A;  1FCY A;  5AZT A;  3DZU A;  2ZLC A;  1T7T A;  3RY9 A;  3UUD A;  3FUG A;  4OGH A;  3VJS A;  2AMA A;  3OMM A;  4IW8 A;  4MG8 B;  4MG9 B;  5G46 A;  3D57 A;  3KBA A;  2QA6 A;  1YY4 A;  2QMV A;  4G1Z A;  3SP9 A;  3G0W A;  2QNV A;  5EIT A;  5DIG A;  2QSE A;  5FQS A;  2Q1V A;  5DK9 A;  5DKS A;  2AYR A;  5APH A;  1S0X A;  3HLV A;  1ZUC A;  2QR9 A;  2VST A;  2FAI A;  3VJH A;  2OVM A;  5FQV A;  3RUT A;  2NPA A;  1UHL A;  2Q6R A;  3G9E A;  4WHG A;  5DRJ A;  5ETH A;  1YA3 A;  4QE8 A;  1FCX A;  3CS6 A;  3UVV B;  1A52 A;  5HYK A;  3P89 A;  5K13 A;  3PLZ A;  1ZDT A;  4IS8 A;  2PIR A;  5HZC A;  2GPO A;  3ADV A;  3CS8 A;  2V0V A;  4L96 A;  2G0H A;  5DID A;  1FD0 A;  5DXK A;  2P4Y A;  2HAS A;  2PIN A;  1NYX A;  2ZK5 A;  2ZFX A;  1XVP B;  3H0A D;  3IPU A;  3O1E A;  5DVV A;  4MGB B;  1UPV A;  5HJP A;  3ZRA A;  4JYI A;  4TUZ B;  4A2J A;  4P6X A;  3AUN A;  1I7G A;  2AA7 A;  3VT8 A;  3W5R A;  3F5C B;  4OKB A;  3WT5 A;  2YHD A;  1UPW A;  2QH6 A;  4N5G A;  4RUO X;  1Q4X A;  2HVC A;  4APU A;  4PLD A;  3OS8 A;  4XAO A;  1Y0X X;  3CWD A;  3VHU A;  5DWG A;  2R40 D;  3W5P A;  1E3K A;  4RZE A;  4JGV A;  3X31 A;  4DMA A;  4DQM A;  1PK5 A;  4OKW A;  5EJV A;  4FHI A;  1ERE A;  3ADT A;  3DZY D;  3TY0 A;  1XNN A;  3HM1 A;  2ZNP A;  1YIN A;  1DKF A;  4IW6 A;  1ZH7 A;  3B0T A;  5DV3 A;  3ET2 A;  4E4Q A;  4ZNW A;  2P1V A;  3GBK A;  3B68 A;  3V4A A;  3VT5 A;  5DYB A;  2B1Z A;  3WJ5 A;  1M7W A;  4OJ4 A;  5AK2 A;  4IU7 A;  4KZJ A;  2JFA B;  4JL4 A;  3LBD A;  2QZO B;  2ZK0 A;  3IXP A;  3A3Z X;  4ZNU A;  1X78 A;  1YYE A;  2VV3 A;  3CTB A;  4OH6 A;  4HEE X;  3KMZ A;  1R1K A;  3E7C A;  3VJI A;  1QKN A;  4QL8 A;  1SR7 A;  5C4S A;  4QM0 A;  4S15 A;  2QXS A;  5B41 A;  2XYJ A;  2GWX A;  3DT3 A;  3L1B A;  1GS4 A;  1LV2 A;  4PXM A;  4REF A;  4WHF A;  1NQ1 A;  4OKX A;  4ZNV A;  5AVI A;  5DUG A;  4R6S A;  5C4T A;  5HYR A;  2AB2 A;  1G5Y A;  5KYJ A;  5DX3 A;  4F9M A;  3IMY A;  3PO9 A;  1U9E A;  1T79 A;  3GYT A;  1XV9 A;  1HG4 A;  4OH5 A;  5KRK A;  4IWF A;  1X7E A;  2QW4 A;  4OZT U;  4FHH A;  1WM0 X;  3SP6 A;  5KCF A;  4YNK A;  2ZL9 A;  5I4V A;  3GWX A;  5KCU A;  3OMK A;  1XQC A;  4WLB A;  2Q6S A;  3RLJ A;  2ZK3 A;  5JY3 A;  5KCW A;  2Z4J A;  2NW4 A;  1Y0S A;  2OAX A;  3L0J A;  1XP9 A;  5L7H A;  4LNX A;  2QGW A;  3VT3 A;  5IXK A;  3OAP A;  2G5O A;  4QK4 A;  3OSW A;  4ZNS A;  5KR9 A;  3K22 A;  2GPV A;  5H1E A;  3RLL A;  1NAV A;  1FM9 A;  1U3R A;  4UDA A;  3Q95 B;  5DWE A;  3OLF A;  3B67 A;  4PWL A;  2ABI A;  2Q6J A;  4ZN7 A;  2H79 A;  3W0J A;  3KDU A;  4OFU A;  1K74 A;  2ZK2 A;  3GD2 A;  1XAP A;  1YOK A;  3UUA A;  3WJ4 A;  4G1D A;  3ET1 A;  4OZT E;  5DY8 A;  2HB7 A;  2XYX A;  3W5Q A;  4IV2 A;  4KZM A;  5B5B A;  3UU7 B;  4NY9 A;  3VJT A;  3VN2 A;  3W0A A;  4OZR U;  1M2Z A;  3R29 A;  5AAV B;  3V3Q A;  2OZ7 A;  2ZKC A;  5DU5 A;  2Q59 A;  1FM6 A;  4RZF A;  4M8E A;  1I38 A;  2ZXN A;  3NOA A;  4OED A;  3FC6 B;  4OIU A;  1S9Q A;  2ZY0 A;  4IA7 A;  4RE8 A;  3VT7 A;  2AX9 A;  3A9E A;  4MGA B;  5JJM A;  5DUH A;  3NSP A;  3OOF A;  2FSZ A;  2QXM A;  1E3G A;  1MVC A;  3OMP A;  1G2N A;  5ACC A;  3V9V A;  2HCD A;  4Q50 A;  3V3E A;  3R5M A;  4J5W C;  2O9I A;  1VJB A;  3KWY A;  1XIU A;  2ZNN A;  3IA6 A;  2J14 A;  1N46 A;  1XOW A;  4NUF A;  3PEQ A;  3FAL A;  3HOD A;  4ZO1 X;  2GPU A;  2IOG A;  4S14 A;  4OZR E;  4RMD A;  4UDC A;  3DCU A;  4MGD A;  1XQ3 A;  4MG7 B;  4CI4 A;  3MNO A;  1OVL B;  5DXB B;  1XZX X;  5LGA A;  2B23 A;  4G21 A;  5KCE A;  2P1T A;  4UDB A;  3ADW A;  5AVL A;  4E2J A;  5G5W A;  2AA5 A;  3HC5 A;  1DB1 A;  2PIP L;  2NXX A;  4MG5 A;  5KRF A;  3UUD B;  2GIU A;  2Q70 A;  1XP1 A;  4J26 A;  5DSH A;  4N8R A;  5DZH A;  3WFG A;  5KCD A;  5C4O A;  1Z5X U;  2QAB A;  4N1Y A;  4PPP A;  3DCT A;  1T74 A;  3W0G A;  3ADU A;  2JJ3 A;  4IVY A;  5EGV A;  2Q1H A;  3B0R A;  3UVV A;  3X1I A;  4ZNT A;  4J5W A;  5DKB A;  3ADS A;  5APK A;  5G43 A;  1RDT A;  5APJ A;  4OFR A;  1NAX A;  2ZAS A;  4IA2 A;  4NQA B;  2HAR A;  1N4H A;  2YLY A;  5FQP A;  4IQR A;  5DXR A;  3TKC A;  3VTC A;  3VHW A;  4TV1 B;  1UHL B;  2AA6 A;  2Q61 A;  3B1M A;  3OZ0 A;  1EXA A;  2P1U A;  4XI3 A;  5EHJ A;  4X1G A;  4ZI1 A;  2P54 A;  2ZK4 A;  3IPQ A;  1PQ9 A;  3QT0 A;  4CSJ A;  5LWP A;  3UP0 A;  3K6P A;  5DMF A;  1FM9 D;  1Z5X E;  3AUQ A;  1QKU A;  3D5F A;  3KMG A;  4KZI A;  2NXX E;  4ONI A;  1RKG A;  4G2I A;  3F7D A;  4K4J A;  1TXI A;  1ILG A;  4FGY A;  2AX8 A;  4IA3 A;  5DV8 A;  2PIU A;  3L3X A;  3OKH A;  1M13 A;  3HQ5 A;  3AZ1 A;  4A4V A;  4CI5 A;  5HJP B;  1OT7 A;  2ZK1 A;  3AN4 A;  4Q0A C;  3L03 A;  2G44 A;  3H52 A;  3VT6 A;  4JYG A;  5E14 A;  1ZAF A;  3X1H A;  2POG A;  1A28 A;  1NDE A;  4E4K A;  4YMQ A;  5DI7 A;  1XLS A;  5KRM A;  4S0T A;  1L2J A;  2ACL B;  3B0W A;  3ZR7 A;  3A2J A;  5DXM A;  1NUO A;  2OM9 A;  3AZ3 A;  3ZQT A;  1YUC A;  2PKL A;  5E0W A;  1ERR A;  5KRJ A;  4DK7 A;  3E00 A;  3CDS A;  2Q5S A;  3DZU D;  3D90 A;  3K8S A;  4HLW A;  4PRG A;  4OIV A;  1DKF B;  5KD9 A;  5AYG A;  2NV7 A;  3BQD A;  2HAM A;  2I0J A;  1U3S A;  4POH A;  1YP0 A;  3L3Z A;  4J24 A;  5AWJ A;  4XLD A;  2R6W A;  1S9P A;  3KDT A;  5DV6 A;  1KNU A;  3CS4 A;  3A40 X;  2PRG A;  1IE8 A;  5E7V A;  1T63 A;  1T7F A;  1Z95 A;  1SKX A;  2IOK A;  3AFR A;  1I7I A;  1XDK A;  4OEY A;  1XLS E;  2BAW A;  2R6Y A;  4OJ9 A;  4DOR A;  4YPQ A;  1X7R A;  5DWI A;  2ZNQ A;  2GPP A;  4DM8 A;  1EXX A;  5DP0 A;  2F4B A;  5GIC A;  2OVH A;  4K7A A;  5DZ3 A;  2PJL A;  4ZOM A;  1RJK A;  4J5X C;  2YFE A;  1G1U A;  3M7R A;  2PIW A;  2I4P A;  3AN3 A;  5DX3 B;  2B1V A;  1YIM A;  5L7E A;  1X76 A;  2YJD A;  1XV9 B;  2VV4 A;  2QTU A;  2ZK6 A;  2Q7L A;  4XUM A;  4R06 A;  2ZMJ A;  3W0C A;  3VTD A;  2XYW A;  2O4R A;  1K7L A;  3ZRB A;  2HWR A;  2XKW A;  4LTW A;  2QGT A;  1TFC A;  3WMH A;  3G8O A;  4NB6 A;  5C4U A;  3VHV A;  4S0S A;  1RKH A;  2QA8 A;  3OMO A;  2J4A A;  2VV1 B;  3ADX A;  5G44 A;  4ZJW A;  5DUE A;  4REE A;  3AZ2 A;  3H0A A;  4Y29 A;  3BEJ A;  2Q8S A;  4ITE A;  2AX6 A;  2VSR A;  4MDD A;  2I0G A;  4B7W A;  2PIV A;  1PRG A;  4YT1 A;  2O4J A;  3OLL A;  3R5N A;  2Q5P A;  4J5X A;  2AA2 A;  1LBD A;  5L11 A;  1NHZ A;  5DXQ A;  2PNU A;  2J7Y A;  3R8D A;  1FBY A;  2HFP A;  4OIL A;  5DZI A;  3UUA B;  1PCG A;  1OSV A;  4JAZ A;  1QKM A;  2P7A A;  3IXP D;  5CJ6 A;  3RVF A;  5GT4 A;  2OUZ A;  3E00 D;  3FS1 A;  2V7C A;  4OLM A;  1R1K D;  5DYD A;  4WVD A;  2Q59 B;  3L0E A;  4MG8 A;  4MG9 A;  1QKT A;  5E19 A;  3A78 A;  1YJE A;  4RAK A;  5DL4 A;  4RUP A;  3W5T A;  4EMA A;  3CDP A;  5KCC A;  5L7G A;  2P7G A;  1R5K A;  1T76 A;  2G0G A;  3V49 A;  1T7R A;  2Q5G A;  3OMQ A;  4PP6 A;  4G20 A;  5AZV A;  2BJ4 B;  3VRT A;  4ZN9 A;  3OLS A;  2AXA A;  4M8H A;  2A3I A;  4K6I A;  5G3J A;  3FXV A;  3P8X A;  3R8A A;  3V9Y A;  3WT6 A;  3VRV A;  4RWV A;  3W0I A;  1Y9R A;  2Q60 A;  3FAL B;  3ET0 A;  2FVJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...