3ZR7A

Structural basis for agonism and antagonism for a set of chemically related progesterone receptor modulators
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
250
structure length
250
Chain Sequence
LIPPLINLLMSIEPDVIYAGHDNTKPDTSSSLLTSLNQLGERQLLSVVKWSKSLPGFRNLHIDDQITLIQYSWMSLMVFGLGWRSYKHVSGQMLYFAPDLILNEQRMKESSFYSLCLTMWQIPQEFVKLQVSQEEFLCMKVLLLLNTIPLEGLRSQTQFEEMRSSYIRELIKAIGLRQKGVVSSSQRFYQLTKLLDNLHDLVKQLHLYCLNTFIQSRALSVEFPEMMSEVIAAQLPKILAGMVKPLLFHK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for agonism and antagonism for a set of chemically related progesterone receptor modulators.
pubmed doi rcsb
molecule keywords PROGESTERONE RECEPTOR
molecule tags Receptor
source organism Homo sapiens
total genus 106
structure length 250
sequence length 250
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 3zr7A00
4XHDA 1XP1A 2QGWA 1PRGA 3B0WA 4JYHA 5AZTA 3OLLA 4JAZA 4LNWA 1PDUA 4EMAA 4MG7B 4WVDA 4DM8A 2VV3A 2P15A 3P8XA 5HJPB 3PRGA 4POJA 4IA7A 4MGBB 1H9UA 2HARA 3IPQA 2PRGA 1XQ3A 4OZRE 5EI1A 2VV1A 4WQPA 5DYBA 1YY4A 3UVVB 5KCDA 1NHZA 4J5WA 5DP0A 1LBDA 2I4JA 1GWXA 1NAXA 2YLOA 2ZK1A 3V9YA 2POBA 3DZYA 3OLFA 1GWQA 2JFAA 4ZJWA 1R1KD 4A2JA 3G9EA 5F9BA 4ITEA 5DV6A 3F5CA 3L1BA 1XLSE 5KRAA 2ZK4A 1YYEA 2Q5SA 2ZNPA 3MNOA 3VTCA 5DWJA 3VHVA 5DVSA 1XV9A 2HC4A 4PPPA 4FHHA 5DWGA 3VTBA 5HJSA 4XI3A 4OEAA 3V9TA 2H79A 4OKBA 3W5RA 1QKNA 3UU7A 4OZTU 2AMBA 1X76A 5E1CA 2QZOA 4LTWA 1Z95A 3VHWA 1NUOA 4DMAA 5KRKA 3ZR7A 4PPSA 5DWEA 3B68A 1G1UA 4R2UA 1PK5A 1I7GA 5DIEA 1Y9RA 5DZHA 5DL4A 4LBDA 4TUZA 3EYBA 4KZMA 3VJHA 2XKWA 3PO9A 1ZUCA 2YLPA 5DXRA 1Q4XA 4REFA 1T65A 2G5OA 3MNPA 4OKTA 3ET2A 5IZ0A 5C4SA 5DUGA 3JZBA 4NQAB 5KRJA 5DVVA 3A9EB 1I38A 3VT4A 2Q7KA 4F9MA 3VRTA 2V7CA 1XDKA 3L0EA 1P93A 3VT7A 1A28A 1S0XA 2HWQA 3A3ZX 3B0QA 3OAPA 4S14A 3ET0A 4J26A 5DK9A 5E0WA 4WPFA 3GZ9A 4PVUA 2PINA 2A3IA 3RUUA 1NQ2A 4IVWA 5SYZA 4O8FA 1FM6D 1N4HA 1UPVA 3BEJA 1FCXA 2ZNOA 3M7RA 1S0ZA 5DUEA 3UUDB 1WM0X 4G1ZA 4IQRA 3KMRA 3VT5A 5KRIA 4IV4A 3RLLA 2AWHA 2P7ZA 4PP6A 5EHJA 4APUA 3E7CA 3VHUA 2GPVA 5G3JA 4ZNVA 1PCGA 2NXXE 3DY6A 5H1EA 4XUMA 2Q1VA 5EGVA 4S0TA 5G5WA 3K22A 5E0XA 5AVIA 2V0VA 3GYTA 5DXBB 3SP9A 4IA2A 2VSRA 3VT3A 2O4JA 2Q3YA 4KZIA 5DMCA 1NRLA 3HZFA 1SKXA 3D6DA 2YLYA 1YJEA 1L2JA 4X1FA 1T7FA 1T7TA 3OS8C 3ADTA 2ZK2A 5G45A 2PIOA 3KPZA 3Q95B 4RAKA 2HASA 3RY9A 1FBYA 1U3RA 3PCUA 3VT9A 5KCTA 3D57A 3JZCA 2PIRA 5JJMA 5KRFA 5DXKA 4QK4A 1ZGYA 3DR1A 3O1EA 4RMDA 2AX6A 3RLJA 5HZCA 2I0JA 3CS4A 5DYDA 1DKFB 1EREA 3TX7B 3W5PA 3V49A 1SJ0A 3LBDA 5LWPA 3H52A 2HWRA 2QA6A 5G46A 4K7AA 3ILZA 3VSOA 5KCUA 1XPCA 2P1TA 2ZLAA 3MNEA 1XNXA 3D24A 3R29A 5EC9A 3W0IA 2ZKCA 3CS6A 3DCTA 4G1DA 3OMOA 2ZXMA 3B67A 5FQSA 4J5WC 4OFRA 4M8HA 4RWVA 5A86A 1NAVA 3X36A 1G5YA 3AN3A 3HC6A 4RUPA 3AURA 3CS8A 5AZVA 4ZJRA 1R1KA 2R40D 5AAVB 4G21A 1QKTA 1T79A 4IU7A 3AFRA 4B7WA 3OS8A 4RFWA 3V9VA 5I4VA 5FQTA 3R8IA 4MG7A 1S9PA 2AX9A 5KD9A 1L2IA 5HJPA 4JL4A 2AM9A 2PIXA 5DIDA 1PQ6A 2YJDA 5G43A 5E19A 1XP6A 3DZUD 4RZGA 4IW8A 3E00D 4ONIA 4OZRU 3A40X 5AAUA 3UVVA 3FXVA 3OZJA 1VJBA 4DK8A 3AX8A 3FEJA 4DQMA 3L3ZA 4OKXA 4OJ9A 3R5NA 1T76A 2QW4A 3B0RA 4OH6A 5GIEA 5DRMA 4E2JA 2ZNNA 4DK7A 1A52A 1XAPA 3OOKA 1PQCA 2HBHA 2BJ4B 5C4OA 4DOSA 4OK1A 2HAMA 2GIUA 2ZXZA 1T74A 4FNEA 3FALB 2AMAA 5DWIA 3OSIA 4K4JA 4PWLA 1K74D 2PIWA 1RKGA 2YHDA 3TY0A 2QGTA 3NOAA 3ERDA 3OLSA 4A4VA 2AA6A 5DX3A 2NV7A 2OVMA 1U3QA 4BCRA 4J5XA 5DKSA 1R6GA 3HLVA 3T03A 2VV4B 3WJ5A 2P1UA 5DMFA 1UPWA 1OT7A 4ZNTA 3BC5A 5L7HA 3AZ2A 4N73A 4HLWA 3HODA 1IE8A 4IA1A 5DX3B 3V4AA 3R5MA 3VJIA 2NW4A 5FQRA 1FM6A 1SQNA 3RUTA 3X1HA 2Q5GA 3ET3A 5HYRA 3K6PA 3R8DA 5KRLA 3CDSA 2QABA 3K8SA 5ETHA 3A9EA 3OZ0A 2GP7A 4QM0A 5DSHA 5B41A 2Q7JA 3CJWA 4OGHA 4IV2A 2PIVA 4FN9A 4OH5A 1XJ7A 3OSWA 1M7WA 1XLSA 4OLMA 3W0HA 1KNUA 3FUGA 2ZK3A 1M2ZA 4XT9A 5ICKA 2QTUA 1YP0A 2ACLA 3IXPA 3F5CB 1QKMA 1T7RA 1NDEA 2FAIA 1T73A 3UUAB 1RJKA 3AUQA 1XV9B 3R2AA 3CQVA 4IW6A 2AX7A 4N1YA 3UUDA 4N5GA 1XNNA 4P6WA 1XVPB 2HCDA 3B3KA 3CWDA 1YUCA 3UU7B 4ZNHA 1S9QA 2HB8A 1G2NA 4S0SA 4UDDA 4ZO1X 3ZRAA 5KCEA 3WFGA 2PIUA 2J7YA 4PLEA 5GT4A 3GWSX 2ZFXA 4TUZB 2P1VA 4RUJA 3V3EA 5DXBA 5DZ1A 5JI0D 2OM9A 2HFPA 2GL8A 3S9SA 3B0TA 2Q70A 4L98A 3VT6A 4IWFA 2GWXA 4XLDA 5E15A 1ZDTA 4MG9A 2OVHA 3TKMA 3A2HA 4Y29A 3GN8A 4OFUA 5DIGA 4XAOA 1FM9D 3Q95A 4JGVA 4R06A 2FVJA 1N46A 2QA8B 3IXPD 3KMZA 1LV2A 3WT7A 5KCCA 3D90A 2P7AA 4IS8A 3FC6A 2LBDA 4G2IA 4OIUA 2R40A 2P54A 4M8EA 3GYUA 1EXXA 5M96A 5AWKA 4ZI1A 4S15A 4A4WA 4MGAB 4TV1A 2QMVA 5DWLA 3WFFA 5DI7A 3A78A 5APHA 2QPYA 1GWRA 2Q5PA 5HYKA 3DZUA 2J14A 2P4YA 3E00A 2YJAB 3L0LA 3CDPA 1PQ9A 2G0GA 4NB6A 1I37A 1MV9A 2HVCA 5FQVA 2NXXA 4OC7A 4G2HA 5DVCA 2B1VA 2Q1HA 1E3GA 3VJSA 4CSJA 5KRCA 2W8YA 2PIQA 3UUCA 1OSHA 2AA7A 2F4BA 2Z4JA 1ZKYA 1OVLA 3B66A 4J24A 3KWYA 3OMQA 4RZEA 5DLRA 5APKA 4IUIA 2JJ3A 2AA2A 4MG5A 1E3KA 2ATHA 2AYRA 2YLQA 1YA3A 4G20A 4LNXA 1QKUA 1UHLB 3G0WA 5APJA 3ZQTA 3ADSA 2Q61A 5ACCA 2H77A 2O4RA 4RUOX 5IXKA 1K74A 5K13A 3LMPA 4MG8B 2Q8SA 4K6IA 2POGA 4YMQA 1XQCA 2G44A 4JYGA 1Z5XE 3IPUA 4OIVA 5L7GA 4J5XC 1SR7A 2I4ZA 1ILGA 2J4AA 4ZNUA 4Q0AC 2QXMA 3R8AA 2AXAA 3KYTA 3WWRA 4OILA 4MGBA 4UDBA 2YATA 5JJMB 2Q59B 3OMKA 4POHA 5B5BA 5JY3A 3O1DA 3VSPA 1X7BA 1ZAFA 3HM1A 3H0AD 5C4UA 5C4TA 3KDTA 2IOKA 5L11A 3KMGA 4HEEX 2EWPA 4ZOMA 3PBAA 5FQPA 3DCUA 3WGPA 3ZRBA 3ET1A 3X31A 5KROA 2XHSA 2ZMJA 3FALA 2Z4BA 5G42A 1XIUA 5DXEA 2R6WA 1G50A 2VV2A 4MGDB 3FS1A 4KZJA 1R20D 4YT1A 5DXMA 4L96A 1ZH7A 1PZLA 5L7EA 1YOWA 3W0GA 2AA5A 1I7IA 4Q13A 1RDTD 1XB7A 2VV4A 3K23A 3OOFA 4UDCA 4WLBA 5KRHA 2FSZA 3D5FA 3VN2A 3AUNA 3VJTA 4OHAA 4JYIA 2OUZA 3A2IA 2B1ZA 2QH6A 2G0HA 3W0CA 4EM9A 2IHQA 5DUHA 4PP5A 2XYJA 1T63A 4QE8A 3B1MA 4OARA 4ZNSA 3OKHA 5DXGA 4PXMA 4R6SA 2VV0A 4E4QA 2JF9A 1NQ1A 2ZK5A 5DV3A 1T5ZA 3GWXA 3P89A 4XUHA 1DB1A 4RMCA 1TXIA 4OEYA 2GPUA 3B65A 2Q7IA 4ZO1B 4DORA 3N00A 3HO0A 1MZNA 2VV1B 5HCVA 2ZLCA 1K4WA 5DKEA 2I4PA 3UUAA 3WT5A 5DZ0A 3FEIA 2XYXA 4WHFA 3V3QA 3VRVA 5KCFA 1YMTA 1BSXA 1KKQA 1Y0SA 3ADXA 5DXQA 4N8RA 5DKBA 1EXAA 1FM9A 1XVPA 2PITA 1ILHA 2JFAB 3CTBA 3NSPA 4OEZA 1M13A 1T7MA 4PP3A 3VTDA 1HJ1A 3W0AA 1R5KA 3ADVA 4NUFA 5EJVA 2Q6SA 2NPAA 1GS4A 1XP9A 3B5RA 5AYGA 3VI8A 3ERTA 3OSAA 1UOMA 4OZTE 1TFCA 2GPOA 2I0GA 2PKLA 3W0JA 3PLZA 4ZN9A 2Q6RA 2ABIA 4ZN7A 2QZOB 5KRMA 3TKCA 3WTQA 2B50A 2B23A 4YPQA 3DT3A 5LGAA 3WT6A 2GPPA 2ZK0A 3DZYD 4OKWA 3KBAA 2QR9A 3OKIA 3GBKA 2QA8A 5GICA 1ZEOA 2QSEA 4G1YA 1HG4A 2O9IA 3NSQA 1ZDUA 2Q60A 3ADWA 4FHIA 4IVYA 4OEDA 2AB2A 3L0JA 3SP6A 3AN4A 3OS9A 4PRGA 4QL8A 2ZXNA 4MG6A 1RK3A 3HC5A 3HQ5A 4NY9A 3RVFA 2OCFA 5DTVA 1RKHA 3A2JA 3FLIA 4MGAA 2ZMHA 2AO6A 4NIEA 2ACLB 2REWA 2ZBSA 4E4KA 2QE4A 4IA3A 1P8DA 1X7RA 1XDKB 1FD0A 4WHGA 5KR9A 1U3SA 4XTAA 5DXPA 3KDUA 1DKFA 4MGCA 3FURA 1NYXA 3VRWA 4PLDA 3AZ1A 3OMMA 5E7VA 4CI4A 2R6YA 3BQDA 2ZL9A 3IA6A 5DZIA 3W5TA 3X1IA 1ERRA 1N83A 5CJ6A 3WJ4A 3OGTA 5KYJA 3H0AA 3U9QA 5DU5A 3E94A 4YNKA 3W5QA 4QJRA 2AX8A 2OAXA 1Y0XX 5DZ3A 1UHLA 1OSVA 4PF3A 3CLDA 2ZK6A 3UP0A 2HB7A 1X7EA 1YIMA 4MG9B 5AAVA 1FCYA 4MG8A 3KFCA 1R20A 4ZNWA 3WMHA 3L3XA 4FGYA 2E2RA 4REEA 2ZASA 1NQ0A 3F7DA 2ZMIA 2ZNQA 3HVLA 1Z5XU 2PNUA 3G8IA 3QT0A 4ITFA 4OJBA 4QE6A 3VT8A 3FC6B 1RDTA 3GD2A 2Q59A 1XZXX 4LSJA 1IE9A 3G8OA 3IMYA 5DRJA 3W0YA 4CI5A 3P88A 5KYAA 5KCWA 3PEQA 3ADUA 1KV6A 2PIPL 2PJLA 5AK2A 4RE8A 4TV1B 3OMPA 3VRUA 5EITA 3SZ1A 1XOWA 2J7XA 5IAWA 5AWJA 5G44A 2VSTA 2Q6JA 3P0UA 4MGDA 4UDAA 4X1GA 5AVLA 2OZ7A 3UP3A 2AAXA 1FCZA 1MVCA 4MDDA 1X78A 2ZY0A 3L03A 3AZ3A 2BAWA 2BJ4A 1NQ7A 4IWCA 2QNVA 1X7JA 2YFEA 2GTKA 4DM6A 2P7GA 2ZVTA 5DKGA 1K7LA 2QXSA 1OVLB 3IPSA 4RMEA 2XYWA 5DV8A 1S19A 1U9EA 4RZFA 5E14A 2IOGA 4Q50A 4P6XA 5GIDA 5DY8A 4OJ4A 1YOKA 1YINA 2Q7LA
chains in the Genus database with same CATH superfamily
4XHDA 1XP1A 2QGWA 1PRGA 3B0WA 4JYHA 5AZTA 3OLLA 4JAZA 4LNWA 1PDUA 4EMAA 4MG7B 4WVDA 4DM8A 2VV3A 2P15A 3P8XA 5HJPB 3PRGA 4POJA 4IA7A 4MGBB 1H9UA 2HARA 3IPQA 2PRGA 1XQ3A 4OZRE 5EI1A 2VV1A 4WQPA 5DYBA 1YY4A 3UVVB 5KCDA 1NHZA 4J5WA 5DP0A 1LBDA 2I4JA 1GWXA 1NAXA 2YLOA 2ZK1A 3V9YA 2POBA 3DZYA 3OLFA 1GWQA 2JFAA 4ZJWA 1R1KD 4A2JA 3G9EA 5F9BA 4ITEA 5DV6A 3F5CA 3L1BA 1XLSE 5KRAA 2ZK4A 1YYEA 2Q5SA 2ZNPA 3MNOA 3VTCA 5DWJA 3VHVA 5DVSA 1XV9A 2HC4A 4PPPA 4FHHA 5DWGA 3VTBA 5HJSA 4XI3A 4OEAA 3V9TA 2H79A 4OKBA 3W5RA 1QKNA 3UU7A 4OZTU 2AMBA 1X76A 5E1CA 2QZOA 4LTWA 1Z95A 3VHWA 1NUOA 4DMAA 5KRKA 3ZR7A 4PPSA 5DWEA 3B68A 1G1UA 4R2UA 1PK5A 1I7GA 5DIEA 1Y9RA 5DZHA 5DL4A 4LBDA 4TUZA 3EYBA 4KZMA 3VJHA 2XKWA 3PO9A 1ZUCA 2YLPA 5DXRA 1Q4XA 4REFA 1T65A 2G5OA 3MNPA 4OKTA 3ET2A 5IZ0A 5C4SA 5DUGA 3JZBA 4NQAB 5KRJA 5DVVA 3A9EB 1I38A 3VT4A 2Q7KA 4F9MA 3VRTA 2V7CA 1XDKA 3L0EA 1P93A 3VT7A 1A28A 1S0XA 2HWQA 3A3ZX 3B0QA 3OAPA 4S14A 3ET0A 4J26A 5DK9A 5E0WA 4WPFA 3GZ9A 4PVUA 2PINA 2A3IA 3RUUA 1NQ2A 4IVWA 5SYZA 4O8FA 1FM6D 1N4HA 1UPVA 3BEJA 1FCXA 2ZNOA 3M7RA 1S0ZA 5DUEA 3UUDB 1WM0X 4G1ZA 4IQRA 3KMRA 3VT5A 5KRIA 4IV4A 3RLLA 2AWHA 2P7ZA 4PP6A 5EHJA 4APUA 3E7CA 3VHUA 2GPVA 5G3JA 4ZNVA 1PCGA 2NXXE 3DY6A 5H1EA 4XUMA 2Q1VA 5EGVA 4S0TA 5G5WA 3K22A 5E0XA 5AVIA 2V0VA 3GYTA 5DXBB 3SP9A 4IA2A 2VSRA 3VT3A 2O4JA 2Q3YA 4KZIA 5DMCA 1NRLA 3HZFA 1SKXA 3D6DA 2YLYA 1YJEA 1L2JA 4X1FA 1T7FA 1T7TA 3OS8C 3ADTA 2ZK2A 5G45A 2PIOA 3KPZA 3Q95B 4RAKA 2HASA 3RY9A 1FBYA 1U3RA 3PCUA 3VT9A 5KCTA 3D57A 3JZCA 2PIRA 5JJMA 5KRFA 5DXKA 4QK4A 1ZGYA 3DR1A 3O1EA 4RMDA 2AX6A 3RLJA 5HZCA 2I0JA 3CS4A 5DYDA 1DKFB 1EREA 3TX7B 3W5PA 3V49A 1SJ0A 3LBDA 5LWPA 3H52A 2HWRA 2QA6A 5G46A 4K7AA 3ILZA 3VSOA 5KCUA 1XPCA 2P1TA 2ZLAA 3MNEA 1XNXA 3D24A 3R29A 5EC9A 3W0IA 2ZKCA 3CS6A 3DCTA 4G1DA 3OMOA 2ZXMA 3B67A 5FQSA 4J5WC 4OFRA 4M8HA 4RWVA 5A86A 1NAVA 3X36A 1G5YA 3AN3A 3HC6A 4RUPA 3AURA 3CS8A 5AZVA 4ZJRA 1R1KA 2R40D 5AAVB 4G21A 1QKTA 1T79A 4IU7A 3AFRA 4B7WA 3OS8A 4RFWA 3V9VA 5I4VA 5FQTA 3R8IA 4MG7A 1S9PA 2AX9A 5KD9A 1L2IA 5HJPA 4JL4A 2AM9A 2PIXA 5DIDA 1PQ6A 2YJDA 5G43A 5E19A 1XP6A 3DZUD 4RZGA 4IW8A 3E00D 4ONIA 4OZRU 3A40X 5AAUA 3UVVA 3FXVA 3OZJA 1VJBA 4DK8A 3AX8A 3FEJA 4DQMA 3L3ZA 4OKXA 4OJ9A 3R5NA 1T76A 2QW4A 3B0RA 4OH6A 5GIEA 5DRMA 4E2JA 2ZNNA 4DK7A 1A52A 1XAPA 3OOKA 1PQCA 2HBHA 2BJ4B 5C4OA 4DOSA 4OK1A 2HAMA 2GIUA 2ZXZA 1T74A 4FNEA 3FALB 2AMAA 5DWIA 3OSIA 4K4JA 4PWLA 1K74D 2PIWA 1RKGA 2YHDA 3TY0A 2QGTA 3NOAA 3ERDA 3OLSA 4A4VA 2AA6A 5DX3A 2NV7A 2OVMA 1U3QA 4BCRA 4J5XA 5DKSA 1R6GA 3HLVA 3T03A 2VV4B 3WJ5A 2P1UA 5DMFA 1UPWA 1OT7A 4ZNTA 3BC5A 5L7HA 3AZ2A 4N73A 4HLWA 3HODA 1IE8A 4IA1A 5DX3B 3V4AA 3R5MA 3VJIA 2NW4A 5FQRA 1FM6A 1SQNA 3RUTA 3X1HA 2Q5GA 3ET3A 5HYRA 3K6PA 3R8DA 5KRLA 3CDSA 2QABA 3K8SA 5ETHA 3A9EA 3OZ0A 2GP7A 4QM0A 5DSHA 5B41A 2Q7JA 3CJWA 4OGHA 4IV2A 2PIVA 4FN9A 4OH5A 1XJ7A 3OSWA 1M7WA 1XLSA 4OLMA 3W0HA 1KNUA 3FUGA 2ZK3A 1M2ZA 4XT9A 5ICKA 2QTUA 1YP0A 2ACLA 3IXPA 3F5CB 1QKMA 1T7RA 1NDEA 2FAIA 1T73A 3UUAB 1RJKA 3AUQA 1XV9B 3R2AA 3CQVA 4IW6A 2AX7A 4N1YA 3UUDA 4N5GA 1XNNA 4P6WA 1XVPB 2HCDA 3B3KA 3CWDA 1YUCA 3UU7B 4ZNHA 1S9QA 2HB8A 1G2NA 4S0SA 4UDDA 4ZO1X 3ZRAA 5KCEA 3WFGA 2PIUA 2J7YA 4PLEA 5GT4A 3GWSX 2ZFXA 4TUZB 2P1VA 4RUJA 3V3EA 5DXBA 5DZ1A 5JI0D 2OM9A 2HFPA 2GL8A 3S9SA 3B0TA 2Q70A 4L98A 3VT6A 4IWFA 2GWXA 4XLDA 5E15A 1ZDTA 4MG9A 2OVHA 3TKMA 3A2HA 4Y29A 3GN8A 4OFUA 5DIGA 4XAOA 1FM9D 3Q95A 4JGVA 4R06A 2FVJA 1N46A 2QA8B 3IXPD 3KMZA 1LV2A 3WT7A 5KCCA 3D90A 2P7AA 4IS8A 3FC6A 2LBDA 4G2IA 4OIUA 2R40A 2P54A 4M8EA 3GYUA 1EXXA 5M96A 5AWKA 4ZI1A 4S15A 4A4WA 4MGAB 4TV1A 2QMVA 5DWLA 3WFFA 5DI7A 3A78A 5APHA 2QPYA 1GWRA 2Q5PA 5HYKA 3DZUA 2J14A 2P4YA 3E00A 2YJAB 3L0LA 3CDPA 1PQ9A 2G0GA 4NB6A 1I37A 1MV9A 2HVCA 5FQVA 2NXXA 4OC7A 4G2HA 5DVCA 2B1VA 2Q1HA 1E3GA 3VJSA 4CSJA 5KRCA 2W8YA 2PIQA 3UUCA 1OSHA 2AA7A 2F4BA 2Z4JA 1ZKYA 1OVLA 3B66A 4J24A 3KWYA 3OMQA 4RZEA 5DLRA 5APKA 4IUIA 2JJ3A 2AA2A 4MG5A 1E3KA 2ATHA 2AYRA 2YLQA 1YA3A 4G20A 4LNXA 1QKUA 1UHLB 3G0WA 5APJA 3ZQTA 3ADSA 2Q61A 5ACCA 2H77A 2O4RA 4RUOX 5IXKA 1K74A 5K13A 3LMPA 4MG8B 2Q8SA 4K6IA 2POGA 4YMQA 1XQCA 2G44A 4JYGA 1Z5XE 3IPUA 4OIVA 5L7GA 4J5XC 1SR7A 2I4ZA 1ILGA 2J4AA 4ZNUA 4Q0AC 2QXMA 3R8AA 2AXAA 3KYTA 3WWRA 4OILA 4MGBA 4UDBA 2YATA 5JJMB 2Q59B 3OMKA 4POHA 5B5BA 5JY3A 3O1DA 3VSPA 1X7BA 1ZAFA 3HM1A 3H0AD 5C4UA 5C4TA 3KDTA 2IOKA 5L11A 3KMGA 4HEEX 2EWPA 4ZOMA 3PBAA 5FQPA 3DCUA 3WGPA 3ZRBA 3ET1A 3X31A 5KROA 2XHSA 2ZMJA 3FALA 2Z4BA 5G42A 1XIUA 5DXEA 2R6WA 1G50A 2VV2A 4MGDB 3FS1A 4KZJA 1R20D 4YT1A 5DXMA 4L96A 1ZH7A 1PZLA 5L7EA 1YOWA 3W0GA 2AA5A 1I7IA 4Q13A 1RDTD 1XB7A 2VV4A 3K23A 3OOFA 4UDCA 4WLBA 5KRHA 2FSZA 3D5FA 3VN2A 3AUNA 3VJTA 4OHAA 4JYIA 2OUZA 3A2IA 2B1ZA 2QH6A 2G0HA 3W0CA 4EM9A 2IHQA 5DUHA 4PP5A 2XYJA 1T63A 4QE8A 3B1MA 4OARA 4ZNSA 3OKHA 5DXGA 4PXMA 4R6SA 2VV0A 4E4QA 2JF9A 1NQ1A 2ZK5A 5DV3A 1T5ZA 3GWXA 3P89A 4XUHA 1DB1A 4RMCA 1TXIA 4OEYA 2GPUA 3B65A 2Q7IA 4ZO1B 4DORA 3N00A 3HO0A 1MZNA 2VV1B 5HCVA 2ZLCA 1K4WA 5DKEA 2I4PA 3UUAA 3WT5A 5DZ0A 3FEIA 2XYXA 4WHFA 3V3QA 3VRVA 5KCFA 1YMTA 1BSXA 1KKQA 1Y0SA 3ADXA 5DXQA 4N8RA 5DKBA 1EXAA 1FM9A 1XVPA 2PITA 1ILHA 2JFAB 3CTBA 3NSPA 4OEZA 1M13A 1T7MA 4PP3A 3VTDA 1HJ1A 3W0AA 1R5KA 3ADVA 4NUFA 5EJVA 2Q6SA 2NPAA 1GS4A 1XP9A 3B5RA 5AYGA 3VI8A 3ERTA 3OSAA 1UOMA 4OZTE 1TFCA 2GPOA 2I0GA 2PKLA 3W0JA 3PLZA 4ZN9A 2Q6RA 2ABIA 4ZN7A 2QZOB 5KRMA 3TKCA 3WTQA 2B50A 2B23A 4YPQA 3DT3A 5LGAA 3WT6A 2GPPA 2ZK0A 3DZYD 4OKWA 3KBAA 2QR9A 3OKIA 3GBKA 2QA8A 5GICA 1ZEOA 2QSEA 4G1YA 1HG4A 2O9IA 3NSQA 1ZDUA 2Q60A 3ADWA 4FHIA 4IVYA 4OEDA 2AB2A 3L0JA 3SP6A 3AN4A 3OS9A 4PRGA 4QL8A 2ZXNA 4MG6A 1RK3A 3HC5A 3HQ5A 4NY9A 3RVFA 2OCFA 5DTVA 1RKHA 3A2JA 3FLIA 4MGAA 2ZMHA 2AO6A 4NIEA 2ACLB 2REWA 2ZBSA 4E4KA 2QE4A 4IA3A 1P8DA 1X7RA 1XDKB 1FD0A 4WHGA 5KR9A 1U3SA 4XTAA 5DXPA 3KDUA 1DKFA 4MGCA 3FURA 1NYXA 3VRWA 4PLDA 3AZ1A 3OMMA 5E7VA 4CI4A 2R6YA 3BQDA 2ZL9A 3IA6A 5DZIA 3W5TA 3X1IA 1ERRA 1N83A 5CJ6A 3WJ4A 3OGTA 5KYJA 3H0AA 3U9QA 5DU5A 3E94A 4YNKA 3W5QA 4QJRA 2AX8A 2OAXA 1Y0XX 5DZ3A 1UHLA 1OSVA 4PF3A 3CLDA 2ZK6A 3UP0A 2HB7A 1X7EA 1YIMA 4MG9B 5AAVA 1FCYA 4MG8A 3KFCA 1R20A 4ZNWA 3WMHA 3L3XA 4FGYA 2E2RA 4REEA 2ZASA 1NQ0A 3F7DA 2ZMIA 2ZNQA 3HVLA 1Z5XU 2PNUA 3G8IA 3QT0A 4ITFA 4OJBA 4QE6A 3VT8A 3FC6B 1RDTA 3GD2A 2Q59A 1XZXX 4LSJA 1IE9A 3G8OA 3IMYA 5DRJA 3W0YA 4CI5A 3P88A 5KYAA 5KCWA 3PEQA 3ADUA 1KV6A 2PIPL 2PJLA 5AK2A 4RE8A 4TV1B 3OMPA 3VRUA 5EITA 3SZ1A 1XOWA 2J7XA 5IAWA 5AWJA 5G44A 2VSTA 2Q6JA 3P0UA 4MGDA 4UDAA 4X1GA 5AVLA 2OZ7A 3UP3A 2AAXA 1FCZA 1MVCA 4MDDA 1X78A 2ZY0A 3L03A 3AZ3A 2BAWA 2BJ4A 1NQ7A 4IWCA 2QNVA 1X7JA 2YFEA 2GTKA 4DM6A 2P7GA 2ZVTA 5DKGA 1K7LA 2QXSA 1OVLB 3IPSA 4RMEA 2XYWA 5DV8A 1S19A 1U9EA 4RZFA 5E14A 2IOGA 4Q50A 4P6XA 5GIDA 5DY8A 4OJ4A 1YOKA 1YINA 2Q7LA
chains in the Genus database with same CATH topology
4XHDA 1XP1A 2QGWA 1PRGA 3B0WA 4JYHA 5AZTA 3OLLA 4JAZA 4LNWA 1PDUA 4EMAA 4MG7B 4WVDA 4DM8A 2VV3A 2P15A 3P8XA 5HJPB 3PRGA 4POJA 4IA7A 4MGBB 1H9UA 2HARA 3IPQA 2PRGA 1XQ3A 4OZRE 5EI1A 2VV1A 4WQPA 5DYBA 1YY4A 3UVVB 5KCDA 1NHZA 4J5WA 5DP0A 1LBDA 2I4JA 1GWXA 1NAXA 2YLOA 2ZK1A 3V9YA 2POBA 3DZYA 3OLFA 1GWQA 2JFAA 4ZJWA 1R1KD 4A2JA 3G9EA 5F9BA 4ITEA 5DV6A 3F5CA 3L1BA 1XLSE 5KRAA 2ZK4A 1YYEA 2Q5SA 2ZNPA 3MNOA 3VTCA 5DWJA 3VHVA 5DVSA 1XV9A 2HC4A 4PPPA 4FHHA 5DWGA 3VTBA 5HJSA 4XI3A 4OEAA 3V9TA 2H79A 4OKBA 3W5RA 1QKNA 3UU7A 4OZTU 2AMBA 1X76A 5E1CA 2QZOA 4LTWA 1Z95A 3VHWA 1NUOA 4DMAA 5KRKA 3ZR7A 4PPSA 5DWEA 3B68A 1G1UA 4R2UA 1PK5A 1I7GA 5DIEA 1Y9RA 5DZHA 5DL4A 4LBDA 4TUZA 3EYBA 4KZMA 3VJHA 2XKWA 3PO9A 1ZUCA 2YLPA 5DXRA 1Q4XA 4REFA 1T65A 2G5OA 3MNPA 4OKTA 3ET2A 5IZ0A 5C4SA 5DUGA 3JZBA 4NQAB 5KRJA 5DVVA 3A9EB 1I38A 3VT4A 2Q7KA 4F9MA 3VRTA 2V7CA 1XDKA 3L0EA 1P93A 3VT7A 1A28A 1S0XA 2HWQA 3A3ZX 3B0QA 3OAPA 4S14A 3ET0A 4J26A 5DK9A 5E0WA 4WPFA 3GZ9A 4PVUA 2PINA 2A3IA 3RUUA 1NQ2A 4IVWA 5SYZA 4O8FA 1FM6D 1N4HA 1UPVA 3BEJA 1FCXA 2ZNOA 3M7RA 1S0ZA 5DUEA 3UUDB 1WM0X 4G1ZA 4IQRA 3KMRA 3VT5A 5KRIA 4IV4A 3RLLA 2AWHA 2P7ZA 4PP6A 5EHJA 4APUA 3E7CA 3VHUA 2GPVA 5G3JA 4ZNVA 1PCGA 2NXXE 3DY6A 5H1EA 4XUMA 2Q1VA 5EGVA 4S0TA 5G5WA 3K22A 5E0XA 5AVIA 2V0VA 3GYTA 5DXBB 3SP9A 4IA2A 2VSRA 3VT3A 2O4JA 2Q3YA 4KZIA 5DMCA 1NRLA 3HZFA 1SKXA 3D6DA 2YLYA 1YJEA 1L2JA 4X1FA 1T7FA 1T7TA 3OS8C 3ADTA 2ZK2A 5G45A 2PIOA 3KPZA 3Q95B 4RAKA 2HASA 3RY9A 1FBYA 1U3RA 3PCUA 3VT9A 5KCTA 3D57A 3JZCA 2PIRA 5JJMA 5KRFA 5DXKA 4QK4A 1ZGYA 3DR1A 3O1EA 4RMDA 2AX6A 3RLJA 5HZCA 2I0JA 3CS4A 5DYDA 1DKFB 1EREA 3TX7B 3W5PA 3V49A 1SJ0A 3LBDA 5LWPA 3H52A 2HWRA 2QA6A 5G46A 4K7AA 3ILZA 3VSOA 5KCUA 1XPCA 2P1TA 2ZLAA 3MNEA 1XNXA 3D24A 3R29A 5EC9A 3W0IA 2ZKCA 3CS6A 3DCTA 4G1DA 3OMOA 2ZXMA 3B67A 5FQSA 4J5WC 4OFRA 4M8HA 4RWVA 5A86A 1NAVA 3X36A 1G5YA 3AN3A 3HC6A 4RUPA 3AURA 3CS8A 5AZVA 4ZJRA 1R1KA 2R40D 5AAVB 4G21A 1QKTA 1T79A 4IU7A 3AFRA 4B7WA 3OS8A 4RFWA 3V9VA 5I4VA 5FQTA 3R8IA 4MG7A 1S9PA 2AX9A 5KD9A 1L2IA 5HJPA 4JL4A 2AM9A 2PIXA 5DIDA 1PQ6A 2YJDA 5G43A 5E19A 1XP6A 3DZUD 4RZGA 4IW8A 3E00D 4ONIA 4OZRU 3A40X 5AAUA 3UVVA 3FXVA 3OZJA 1VJBA 4DK8A 3AX8A 3FEJA 4DQMA 3L3ZA 4OKXA 4OJ9A 3R5NA 1T76A 2QW4A 3B0RA 4OH6A 5GIEA 5DRMA 4E2JA 2ZNNA 4DK7A 1A52A 1XAPA 3OOKA 1PQCA 2HBHA 2BJ4B 5C4OA 4DOSA 4OK1A 2HAMA 2GIUA 2ZXZA 1T74A 4FNEA 3FALB 2AMAA 5DWIA 3OSIA 4K4JA 4PWLA 1K74D 2PIWA 1RKGA 2YHDA 3TY0A 2QGTA 3NOAA 3ERDA 3OLSA 4A4VA 2AA6A 5DX3A 2NV7A 2OVMA 1U3QA 4BCRA 4J5XA 5DKSA 1R6GA 3HLVA 3T03A 2VV4B 3WJ5A 2P1UA 5DMFA 1UPWA 1OT7A 4ZNTA 3BC5A 5L7HA 3AZ2A 4N73A 4HLWA 3HODA 1IE8A 4IA1A 5DX3B 3V4AA 3R5MA 3VJIA 2NW4A 5FQRA 1FM6A 1SQNA 3RUTA 3X1HA 2Q5GA 3ET3A 5HYRA 3K6PA 3R8DA 5KRLA 3CDSA 2QABA 3K8SA 5ETHA 3A9EA 3OZ0A 2GP7A 4QM0A 5DSHA 5B41A 2Q7JA 3CJWA 4OGHA 4IV2A 2PIVA 4FN9A 4OH5A 1XJ7A 3OSWA 1M7WA 1XLSA 4OLMA 3W0HA 1KNUA 3FUGA 2ZK3A 1M2ZA 4XT9A 5ICKA 2QTUA 1YP0A 2ACLA 3IXPA 3F5CB 1QKMA 1T7RA 1NDEA 2FAIA 1T73A 3UUAB 1RJKA 3AUQA 1XV9B 3R2AA 3CQVA 4IW6A 2AX7A 4N1YA 3UUDA 4N5GA 1XNNA 4P6WA 1XVPB 2HCDA 3B3KA 3CWDA 1YUCA 3UU7B 4ZNHA 1S9QA 2HB8A 1G2NA 4S0SA 4UDDA 4ZO1X 3ZRAA 5KCEA 3WFGA 2PIUA 2J7YA 4PLEA 5GT4A 3GWSX 2ZFXA 4TUZB 2P1VA 4RUJA 3V3EA 5DXBA 5DZ1A 5JI0D 2OM9A 2HFPA 2GL8A 3S9SA 3B0TA 2Q70A 4L98A 3VT6A 4IWFA 2GWXA 4XLDA 5E15A 1ZDTA 4MG9A 2OVHA 3TKMA 3A2HA 4Y29A 3GN8A 4OFUA 5DIGA 4XAOA 1FM9D 3Q95A 4JGVA 4R06A 2FVJA 1N46A 2QA8B 3IXPD 3KMZA 1LV2A 3WT7A 5KCCA 3D90A 2P7AA 4IS8A 3FC6A 2LBDA 4G2IA 4OIUA 2R40A 2P54A 4M8EA 3GYUA 1EXXA 5M96A 5AWKA 4ZI1A 4S15A 4A4WA 4MGAB 4TV1A 2QMVA 5DWLA 3WFFA 5DI7A 3A78A 5APHA 2QPYA 1GWRA 2Q5PA 5HYKA 3DZUA 2J14A 2P4YA 3E00A 2YJAB 3L0LA 3CDPA 1PQ9A 2G0GA 4NB6A 1I37A 1MV9A 2HVCA 5FQVA 2NXXA 4OC7A 4G2HA 5DVCA 2B1VA 2Q1HA 1E3GA 3VJSA 4CSJA 5KRCA 2W8YA 2PIQA 3UUCA 1OSHA 2AA7A 2F4BA 2Z4JA 1ZKYA 1OVLA 3B66A 4J24A 3KWYA 3OMQA 4RZEA 5DLRA 5APKA 4IUIA 2JJ3A 2AA2A 4MG5A 1E3KA 2ATHA 2AYRA 2YLQA 1YA3A 4G20A 4LNXA 1QKUA 1UHLB 3G0WA 5APJA 3ZQTA 3ADSA 2Q61A 5ACCA 2H77A 2O4RA 4RUOX 5IXKA 1K74A 5K13A 3LMPA 4MG8B 2Q8SA 4K6IA 2POGA 4YMQA 1XQCA 2G44A 4JYGA 1Z5XE 3IPUA 4OIVA 5L7GA 4J5XC 1SR7A 2I4ZA 1ILGA 2J4AA 4ZNUA 4Q0AC 2QXMA 3R8AA 2AXAA 3KYTA 3WWRA 4OILA 4MGBA 4UDBA 2YATA 5JJMB 2Q59B 3OMKA 4POHA 5B5BA 5JY3A 3O1DA 3VSPA 1X7BA 1ZAFA 3HM1A 3H0AD 5C4UA 5C4TA 3KDTA 2IOKA 5L11A 3KMGA 4HEEX 2EWPA 4ZOMA 3PBAA 5FQPA 3DCUA 3WGPA 3ZRBA 3ET1A 3X31A 5KROA 2XHSA 2ZMJA 3FALA 2Z4BA 5G42A 1XIUA 5DXEA 2R6WA 1G50A 2VV2A 4MGDB 3FS1A 4KZJA 1R20D 4YT1A 5DXMA 4L96A 1ZH7A 1PZLA 5L7EA 1YOWA 3W0GA 2AA5A 1I7IA 4Q13A 1RDTD 1XB7A 2VV4A 3K23A 3OOFA 4UDCA 4WLBA 5KRHA 2FSZA 3D5FA 3VN2A 3AUNA 3VJTA 4OHAA 4JYIA 2OUZA 3A2IA 2B1ZA 2QH6A 2G0HA 3W0CA 4EM9A 2IHQA 5DUHA 4PP5A 2XYJA 1T63A 4QE8A 3B1MA 4OARA 4ZNSA 3OKHA 5DXGA 4PXMA 4R6SA 2VV0A 4E4QA 2JF9A 1NQ1A 2ZK5A 5DV3A 1T5ZA 3GWXA 3P89A 4XUHA 1DB1A 4RMCA 1TXIA 4OEYA 2GPUA 3B65A 2Q7IA 4ZO1B 4DORA 3N00A 3HO0A 1MZNA 2VV1B 5HCVA 2ZLCA 1K4WA 5DKEA 2I4PA 3UUAA 3WT5A 5DZ0A 3FEIA 2XYXA 4WHFA 3V3QA 3VRVA 5KCFA 1YMTA 1BSXA 1KKQA 1Y0SA 3ADXA 5DXQA 4N8RA 5DKBA 1EXAA 1FM9A 1XVPA 2PITA 1ILHA 2JFAB 3CTBA 3NSPA 4OEZA 1M13A 1T7MA 4PP3A 3VTDA 1HJ1A 3W0AA 1R5KA 3ADVA 4NUFA 5EJVA 2Q6SA 2NPAA 1GS4A 1XP9A 3B5RA 5AYGA 3VI8A 3ERTA 3OSAA 1UOMA 4OZTE 1TFCA 2GPOA 2I0GA 2PKLA 3W0JA 3PLZA 4ZN9A 2Q6RA 2ABIA 4ZN7A 2QZOB 5KRMA 3TKCA 3WTQA 2B50A 2B23A 4YPQA 3DT3A 5LGAA 3WT6A 2GPPA 2ZK0A 3DZYD 4OKWA 3KBAA 2QR9A 3OKIA 3GBKA 2QA8A 5GICA 1ZEOA 2QSEA 4G1YA 1HG4A 2O9IA 3NSQA 1ZDUA 2Q60A 3ADWA 4FHIA 4IVYA 4OEDA 2AB2A 3L0JA 3SP6A 3AN4A 3OS9A 4PRGA 4QL8A 2ZXNA 4MG6A 1RK3A 3HC5A 3HQ5A 4NY9A 3RVFA 2OCFA 5DTVA 1RKHA 3A2JA 3FLIA 4MGAA 2ZMHA 2AO6A 4NIEA 2ACLB 2REWA 2ZBSA 4E4KA 2QE4A 4IA3A 1P8DA 1X7RA 1XDKB 1FD0A 4WHGA 5KR9A 1U3SA 4XTAA 5DXPA 3KDUA 1DKFA 4MGCA 3FURA 1NYXA 3VRWA 4PLDA 3AZ1A 3OMMA 5E7VA 4CI4A 2R6YA 3BQDA 2ZL9A 3IA6A 5DZIA 3W5TA 3X1IA 1ERRA 1N83A 5CJ6A 3WJ4A 3OGTA 5KYJA 3H0AA 3U9QA 5DU5A 3E94A 4YNKA 3W5QA 4QJRA 2AX8A 2OAXA 1Y0XX 5DZ3A 1UHLA 1OSVA 4PF3A 3CLDA 2ZK6A 3UP0A 2HB7A 1X7EA 1YIMA 4MG9B 5AAVA 1FCYA 4MG8A 3KFCA 1R20A 4ZNWA 3WMHA 3L3XA 4FGYA 2E2RA 4REEA 2ZASA 1NQ0A 3F7DA 2ZMIA 2ZNQA 3HVLA 1Z5XU 2PNUA 3G8IA 3QT0A 4ITFA 4OJBA 4QE6A 3VT8A 3FC6B 1RDTA 3GD2A 2Q59A 1XZXX 4LSJA 1IE9A 3G8OA 3IMYA 5DRJA 3W0YA 4CI5A 3P88A 5KYAA 5KCWA 3PEQA 3ADUA 1KV6A 2PIPL 2PJLA 5AK2A 4RE8A 4TV1B 3OMPA 3VRUA 5EITA 3SZ1A 1XOWA 2J7XA 5IAWA 5AWJA 5G44A 2VSTA 2Q6JA 3P0UA 4MGDA 4UDAA 4X1GA 5AVLA 2OZ7A 3UP3A 2AAXA 1FCZA 1MVCA 4MDDA 1X78A 2ZY0A 3L03A 3AZ3A 2BAWA 2BJ4A 1NQ7A 4IWCA 2QNVA 1X7JA 2YFEA 2GTKA 4DM6A 2P7GA 2ZVTA 5DKGA 1K7LA 2QXSA 1OVLB 3IPSA 4RMEA 2XYWA 5DV8A 1S19A 1U9EA 4RZFA 5E14A 2IOGA 4Q50A 4P6XA 5GIDA 5DY8A 4OJ4A 1YOKA 1YINA 2Q7LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XHD A;  1XP1 A;  2QGW A;  1PRG A;  3B0W A;  4JYH A;  5AZT A;  3OLL A;  4JAZ A;  4LNW A;  1PDU A;  4EMA A;  4MG7 B;  4WVD A;  4DM8 A;  2VV3 A;  2P15 A;  3P8X A;  5HJP B;  3PRG A;  4POJ A;  4IA7 A;  4MGB B;  1H9U A;  2HAR A;  3IPQ A;  2PRG A;  1XQ3 A;  4OZR E;  5EI1 A;  2VV1 A;  4WQP A;  5DYB A;  1YY4 A;  3UVV B;  5KCD A;  1NHZ A;  4J5W A;  5DP0 A;  1LBD A;  2I4J A;  1GWX A;  1NAX A;  2YLO A;  2ZK1 A;  3V9Y A;  2POB A;  3DZY A;  3OLF A;  1GWQ A;  2JFA A;  4ZJW A;  1R1K D;  4A2J A;  3G9E A;  5F9B A;  4ITE A;  5DV6 A;  3F5C A;  3L1B A;  1XLS E;  5KRA A;  2ZK4 A;  1YYE A;  2Q5S A;  2ZNP A;  3MNO A;  3VTC A;  5DWJ A;  3VHV A;  5DVS A;  1XV9 A;  2HC4 A;  4PPP A;  4FHH A;  5DWG A;  3VTB A;  5HJS A;  4XI3 A;  4OEA A;  3V9T A;  2H79 A;  4OKB A;  3W5R A;  1QKN A;  3UU7 A;  4OZT U;  2AMB A;  1X76 A;  5E1C A;  2QZO A;  4LTW A;  1Z95 A;  3VHW A;  1NUO A;  4DMA A;  5KRK A;  3ZR7 A;  4PPS A;  5DWE A;  3B68 A;  1G1U A;  4R2U A;  1PK5 A;  1I7G A;  5DIE A;  1Y9R A;  5DZH A;  5DL4 A;  4LBD A;  4TUZ A;  3EYB A;  4KZM A;  3VJH A;  2XKW A;  3PO9 A;  1ZUC A;  2YLP A;  5DXR A;  1Q4X A;  4REF A;  1T65 A;  2G5O A;  3MNP A;  4OKT A;  3ET2 A;  5IZ0 A;  5C4S A;  5DUG A;  3JZB A;  4NQA B;  5KRJ A;  5DVV A;  3A9E B;  1I38 A;  3VT4 A;  2Q7K A;  4F9M A;  3VRT A;  2V7C A;  1XDK A;  3L0E A;  1P93 A;  3VT7 A;  1A28 A;  1S0X A;  2HWQ A;  3A3Z X;  3B0Q A;  3OAP A;  4S14 A;  3ET0 A;  4J26 A;  5DK9 A;  5E0W A;  4WPF A;  3GZ9 A;  4PVU A;  2PIN A;  2A3I A;  3RUU A;  1NQ2 A;  4IVW A;  5SYZ A;  4O8F A;  1FM6 D;  1N4H A;  1UPV A;  3BEJ A;  1FCX A;  2ZNO A;  3M7R A;  1S0Z A;  5DUE A;  3UUD B;  1WM0 X;  4G1Z A;  4IQR A;  3KMR A;  3VT5 A;  5KRI A;  4IV4 A;  3RLL A;  2AWH A;  2P7Z A;  4PP6 A;  5EHJ A;  4APU A;  3E7C A;  3VHU A;  2GPV A;  5G3J A;  4ZNV A;  1PCG A;  2NXX E;  3DY6 A;  5H1E A;  4XUM A;  2Q1V A;  5EGV A;  4S0T A;  5G5W A;  3K22 A;  5E0X A;  5AVI A;  2V0V A;  3GYT A;  5DXB B;  3SP9 A;  4IA2 A;  2VSR A;  3VT3 A;  2O4J A;  2Q3Y A;  4KZI A;  5DMC A;  1NRL A;  3HZF A;  1SKX A;  3D6D A;  2YLY A;  1YJE A;  1L2J A;  4X1F A;  1T7F A;  1T7T A;  3OS8 C;  3ADT A;  2ZK2 A;  5G45 A;  2PIO A;  3KPZ A;  3Q95 B;  4RAK A;  2HAS A;  3RY9 A;  1FBY A;  1U3R A;  3PCU A;  3VT9 A;  5KCT A;  3D57 A;  3JZC A;  2PIR A;  5JJM A;  5KRF A;  5DXK A;  4QK4 A;  1ZGY A;  3DR1 A;  3O1E A;  4RMD A;  2AX6 A;  3RLJ A;  5HZC A;  2I0J A;  3CS4 A;  5DYD A;  1DKF B;  1ERE A;  3TX7 B;  3W5P A;  3V49 A;  1SJ0 A;  3LBD A;  5LWP A;  3H52 A;  2HWR A;  2QA6 A;  5G46 A;  4K7A A;  3ILZ A;  3VSO A;  5KCU A;  1XPC A;  2P1T A;  2ZLA A;  3MNE A;  1XNX A;  3D24 A;  3R29 A;  5EC9 A;  3W0I A;  2ZKC A;  3CS6 A;  3DCT A;  4G1D A;  3OMO A;  2ZXM A;  3B67 A;  5FQS A;  4J5W C;  4OFR A;  4M8H A;  4RWV A;  5A86 A;  1NAV A;  3X36 A;  1G5Y A;  3AN3 A;  3HC6 A;  4RUP A;  3AUR A;  3CS8 A;  5AZV A;  4ZJR A;  1R1K A;  2R40 D;  5AAV B;  4G21 A;  1QKT A;  1T79 A;  4IU7 A;  3AFR A;  4B7W A;  3OS8 A;  4RFW A;  3V9V A;  5I4V A;  5FQT A;  3R8I A;  4MG7 A;  1S9P A;  2AX9 A;  5KD9 A;  1L2I A;  5HJP A;  4JL4 A;  2AM9 A;  2PIX A;  5DID A;  1PQ6 A;  2YJD A;  5G43 A;  5E19 A;  1XP6 A;  3DZU D;  4RZG A;  4IW8 A;  3E00 D;  4ONI A;  4OZR U;  3A40 X;  5AAU A;  3UVV A;  3FXV A;  3OZJ A;  1VJB A;  4DK8 A;  3AX8 A;  3FEJ A;  4DQM A;  3L3Z A;  4OKX A;  4OJ9 A;  3R5N A;  1T76 A;  2QW4 A;  3B0R A;  4OH6 A;  5GIE A;  5DRM A;  4E2J A;  2ZNN A;  4DK7 A;  1A52 A;  1XAP A;  3OOK A;  1PQC A;  2HBH A;  2BJ4 B;  5C4O A;  4DOS A;  4OK1 A;  2HAM A;  2GIU A;  2ZXZ A;  1T74 A;  4FNE A;  3FAL B;  2AMA A;  5DWI A;  3OSI A;  4K4J A;  4PWL A;  1K74 D;  2PIW A;  1RKG A;  2YHD A;  3TY0 A;  2QGT A;  3NOA A;  3ERD A;  3OLS A;  4A4V A;  2AA6 A;  5DX3 A;  2NV7 A;  2OVM A;  1U3Q A;  4BCR A;  4J5X A;  5DKS A;  1R6G A;  3HLV A;  3T03 A;  2VV4 B;  3WJ5 A;  2P1U A;  5DMF A;  1UPW A;  1OT7 A;  4ZNT A;  3BC5 A;  5L7H A;  3AZ2 A;  4N73 A;  4HLW A;  3HOD A;  1IE8 A;  4IA1 A;  5DX3 B;  3V4A A;  3R5M A;  3VJI A;  2NW4 A;  5FQR A;  1FM6 A;  1SQN A;  3RUT A;  3X1H A;  2Q5G A;  3ET3 A;  5HYR A;  3K6P A;  3R8D A;  5KRL A;  3CDS A;  2QAB A;  3K8S A;  5ETH A;  3A9E A;  3OZ0 A;  2GP7 A;  4QM0 A;  5DSH A;  5B41 A;  2Q7J A;  3CJW A;  4OGH A;  4IV2 A;  2PIV A;  4FN9 A;  4OH5 A;  1XJ7 A;  3OSW A;  1M7W A;  1XLS A;  4OLM A;  3W0H A;  1KNU A;  3FUG A;  2ZK3 A;  1M2Z A;  4XT9 A;  5ICK A;  2QTU A;  1YP0 A;  2ACL A;  3IXP A;  3F5C B;  1QKM A;  1T7R A;  1NDE A;  2FAI A;  1T73 A;  3UUA B;  1RJK A;  3AUQ A;  1XV9 B;  3R2A A;  3CQV A;  4IW6 A;  2AX7 A;  4N1Y A;  3UUD A;  4N5G A;  1XNN A;  4P6W A;  1XVP B;  2HCD A;  3B3K A;  3CWD A;  1YUC A;  3UU7 B;  4ZNH A;  1S9Q A;  2HB8 A;  1G2N A;  4S0S A;  4UDD A;  4ZO1 X;  3ZRA A;  5KCE A;  3WFG A;  2PIU A;  2J7Y A;  4PLE A;  5GT4 A;  3GWS X;  2ZFX A;  4TUZ B;  2P1V A;  4RUJ A;  3V3E A;  5DXB A;  5DZ1 A;  5JI0 D;  2OM9 A;  2HFP A;  2GL8 A;  3S9S A;  3B0T A;  2Q70 A;  4L98 A;  3VT6 A;  4IWF A;  2GWX A;  4XLD A;  5E15 A;  1ZDT A;  4MG9 A;  2OVH A;  3TKM A;  3A2H A;  4Y29 A;  3GN8 A;  4OFU A;  5DIG A;  4XAO A;  1FM9 D;  3Q95 A;  4JGV A;  4R06 A;  2FVJ A;  1N46 A;  2QA8 B;  3IXP D;  3KMZ A;  1LV2 A;  3WT7 A;  5KCC A;  3D90 A;  2P7A A;  4IS8 A;  3FC6 A;  2LBD A;  4G2I A;  4OIU A;  2R40 A;  2P54 A;  4M8E A;  3GYU A;  1EXX A;  5M96 A;  5AWK A;  4ZI1 A;  4S15 A;  4A4W A;  4MGA B;  4TV1 A;  2QMV A;  5DWL A;  3WFF A;  5DI7 A;  3A78 A;  5APH A;  2QPY A;  1GWR A;  2Q5P A;  5HYK A;  3DZU A;  2J14 A;  2P4Y A;  3E00 A;  2YJA B;  3L0L A;  3CDP A;  1PQ9 A;  2G0G A;  4NB6 A;  1I37 A;  1MV9 A;  2HVC A;  5FQV A;  2NXX A;  4OC7 A;  4G2H A;  5DVC A;  2B1V A;  2Q1H A;  1E3G A;  3VJS A;  4CSJ A;  5KRC A;  2W8Y A;  2PIQ A;  3UUC A;  1OSH A;  2AA7 A;  2F4B A;  2Z4J A;  1ZKY A;  1OVL A;  3B66 A;  4J24 A;  3KWY A;  3OMQ A;  4RZE A;  5DLR A;  5APK A;  4IUI A;  2JJ3 A;  2AA2 A;  4MG5 A;  1E3K A;  2ATH A;  2AYR A;  2YLQ A;  1YA3 A;  4G20 A;  4LNX A;  1QKU A;  1UHL B;  3G0W A;  5APJ A;  3ZQT A;  3ADS A;  2Q61 A;  5ACC A;  2H77 A;  2O4R A;  4RUO X;  5IXK A;  1K74 A;  5K13 A;  3LMP A;  4MG8 B;  2Q8S A;  4K6I A;  2POG A;  4YMQ A;  1XQC A;  2G44 A;  4JYG A;  1Z5X E;  3IPU A;  4OIV A;  5L7G A;  4J5X C;  1SR7 A;  2I4Z A;  1ILG A;  2J4A A;  4ZNU A;  4Q0A C;  2QXM A;  3R8A A;  2AXA A;  3KYT A;  3WWR A;  4OIL A;  4MGB A;  4UDB A;  2YAT A;  5JJM B;  2Q59 B;  3OMK A;  4POH A;  5B5B A;  5JY3 A;  3O1D A;  3VSP A;  1X7B A;  1ZAF A;  3HM1 A;  3H0A D;  5C4U A;  5C4T A;  3KDT A;  2IOK A;  5L11 A;  3KMG A;  4HEE X;  2EWP A;  4ZOM A;  3PBA A;  5FQP A;  3DCU A;  3WGP A;  3ZRB A;  3ET1 A;  3X31 A;  5KRO A;  2XHS A;  2ZMJ A;  3FAL A;  2Z4B A;  5G42 A;  1XIU A;  5DXE A;  2R6W A;  1G50 A;  2VV2 A;  4MGD B;  3FS1 A;  4KZJ A;  1R20 D;  4YT1 A;  5DXM A;  4L96 A;  1ZH7 A;  1PZL A;  5L7E A;  1YOW A;  3W0G A;  2AA5 A;  1I7I A;  4Q13 A;  1RDT D;  1XB7 A;  2VV4 A;  3K23 A;  3OOF A;  4UDC A;  4WLB A;  5KRH A;  2FSZ A;  3D5F A;  3VN2 A;  3AUN A;  3VJT A;  4OHA A;  4JYI A;  2OUZ A;  3A2I A;  2B1Z A;  2QH6 A;  2G0H A;  3W0C A;  4EM9 A;  2IHQ A;  5DUH A;  4PP5 A;  2XYJ A;  1T63 A;  4QE8 A;  3B1M A;  4OAR A;  4ZNS A;  3OKH A;  5DXG A;  4PXM A;  4R6S A;  2VV0 A;  4E4Q A;  2JF9 A;  1NQ1 A;  2ZK5 A;  5DV3 A;  1T5Z A;  3GWX A;  3P89 A;  4XUH A;  1DB1 A;  4RMC A;  1TXI A;  4OEY A;  2GPU A;  3B65 A;  2Q7I A;  4ZO1 B;  4DOR A;  3N00 A;  3HO0 A;  1MZN A;  2VV1 B;  5HCV A;  2ZLC A;  1K4W A;  5DKE A;  2I4P A;  3UUA A;  3WT5 A;  5DZ0 A;  3FEI A;  2XYX A;  4WHF A;  3V3Q A;  3VRV A;  5KCF A;  1YMT A;  1BSX A;  1KKQ A;  1Y0S A;  3ADX A;  5DXQ A;  4N8R A;  5DKB A;  1EXA A;  1FM9 A;  1XVP A;  2PIT A;  1ILH A;  2JFA B;  3CTB A;  3NSP A;  4OEZ A;  1M13 A;  1T7M A;  4PP3 A;  3VTD A;  1HJ1 A;  3W0A A;  1R5K A;  3ADV A;  4NUF A;  5EJV A;  2Q6S A;  2NPA A;  1GS4 A;  1XP9 A;  3B5R A;  5AYG A;  3VI8 A;  3ERT A;  3OSA A;  1UOM A;  4OZT E;  1TFC A;  2GPO A;  2I0G A;  2PKL A;  3W0J A;  3PLZ A;  4ZN9 A;  2Q6R A;  2ABI A;  4ZN7 A;  2QZO B;  5KRM A;  3TKC A;  3WTQ A;  2B50 A;  2B23 A;  4YPQ A;  3DT3 A;  5LGA A;  3WT6 A;  2GPP A;  2ZK0 A;  3DZY D;  4OKW A;  3KBA A;  2QR9 A;  3OKI A;  3GBK A;  2QA8 A;  5GIC A;  1ZEO A;  2QSE A;  4G1Y A;  1HG4 A;  2O9I A;  3NSQ A;  1ZDU A;  2Q60 A;  3ADW A;  4FHI A;  4IVY A;  4OED A;  2AB2 A;  3L0J A;  3SP6 A;  3AN4 A;  3OS9 A;  4PRG A;  4QL8 A;  2ZXN A;  4MG6 A;  1RK3 A;  3HC5 A;  3HQ5 A;  4NY9 A;  3RVF A;  2OCF A;  5DTV A;  1RKH A;  3A2J A;  3FLI A;  4MGA A;  2ZMH A;  2AO6 A;  4NIE A;  2ACL B;  2REW A;  2ZBS A;  4E4K A;  2QE4 A;  4IA3 A;  1P8D A;  1X7R A;  1XDK B;  1FD0 A;  4WHG A;  5KR9 A;  1U3S A;  4XTA A;  5DXP A;  3KDU A;  1DKF A;  4MGC A;  3FUR A;  1NYX A;  3VRW A;  4PLD A;  3AZ1 A;  3OMM A;  5E7V A;  4CI4 A;  2R6Y A;  3BQD A;  2ZL9 A;  3IA6 A;  5DZI A;  3W5T A;  3X1I A;  1ERR A;  1N83 A;  5CJ6 A;  3WJ4 A;  3OGT A;  5KYJ A;  3H0A A;  3U9Q A;  5DU5 A;  3E94 A;  4YNK A;  3W5Q A;  4QJR A;  2AX8 A;  2OAX A;  1Y0X X;  5DZ3 A;  1UHL A;  1OSV A;  4PF3 A;  3CLD A;  2ZK6 A;  3UP0 A;  2HB7 A;  1X7E A;  1YIM A;  4MG9 B;  5AAV A;  1FCY A;  4MG8 A;  3KFC A;  1R20 A;  4ZNW A;  3WMH A;  3L3X A;  4FGY A;  2E2R A;  4REE A;  2ZAS A;  1NQ0 A;  3F7D A;  2ZMI A;  2ZNQ A;  3HVL A;  1Z5X U;  2PNU A;  3G8I A;  3QT0 A;  4ITF A;  4OJB A;  4QE6 A;  3VT8 A;  3FC6 B;  1RDT A;  3GD2 A;  2Q59 A;  1XZX X;  4LSJ A;  1IE9 A;  3G8O A;  3IMY A;  5DRJ A;  3W0Y A;  4CI5 A;  3P88 A;  5KYA A;  5KCW A;  3PEQ A;  3ADU A;  1KV6 A;  2PIP L;  2PJL A;  5AK2 A;  4RE8 A;  4TV1 B;  3OMP A;  3VRU A;  5EIT A;  3SZ1 A;  1XOW A;  2J7X A;  5IAW A;  5AWJ A;  5G44 A;  2VST A;  2Q6J A;  3P0U A;  4MGD A;  4UDA A;  4X1G A;  5AVL A;  2OZ7 A;  3UP3 A;  2AAX A;  1FCZ A;  1MVC A;  4MDD A;  1X78 A;  2ZY0 A;  3L03 A;  3AZ3 A;  2BAW A;  2BJ4 A;  1NQ7 A;  4IWC A;  2QNV A;  1X7J A;  2YFE A;  2GTK A;  4DM6 A;  2P7G A;  2ZVT A;  5DKG A;  1K7L A;  2QXS A;  1OVL B;  3IPS A;  4RME A;  2XYW A;  5DV8 A;  1S19 A;  1U9E A;  4RZF A;  5E14 A;  2IOG A;  4Q50 A;  4P6X A;  5GID A;  5DY8 A;  4OJ4 A;  1YOK A;  1YIN A;  2Q7L A; 
#chains in the Genus database with same CATH topology
 4XHD A;  1XP1 A;  2QGW A;  1PRG A;  3B0W A;  4JYH A;  5AZT A;  3OLL A;  4JAZ A;  4LNW A;  1PDU A;  4EMA A;  4MG7 B;  4WVD A;  4DM8 A;  2VV3 A;  2P15 A;  3P8X A;  5HJP B;  3PRG A;  4POJ A;  4IA7 A;  4MGB B;  1H9U A;  2HAR A;  3IPQ A;  2PRG A;  1XQ3 A;  4OZR E;  5EI1 A;  2VV1 A;  4WQP A;  5DYB A;  1YY4 A;  3UVV B;  5KCD A;  1NHZ A;  4J5W A;  5DP0 A;  1LBD A;  2I4J A;  1GWX A;  1NAX A;  2YLO A;  2ZK1 A;  3V9Y A;  2POB A;  3DZY A;  3OLF A;  1GWQ A;  2JFA A;  4ZJW A;  1R1K D;  4A2J A;  3G9E A;  5F9B A;  4ITE A;  5DV6 A;  3F5C A;  3L1B A;  1XLS E;  5KRA A;  2ZK4 A;  1YYE A;  2Q5S A;  2ZNP A;  3MNO A;  3VTC A;  5DWJ A;  3VHV A;  5DVS A;  1XV9 A;  2HC4 A;  4PPP A;  4FHH A;  5DWG A;  3VTB A;  5HJS A;  4XI3 A;  4OEA A;  3V9T A;  2H79 A;  4OKB A;  3W5R A;  1QKN A;  3UU7 A;  4OZT U;  2AMB A;  1X76 A;  5E1C A;  2QZO A;  4LTW A;  1Z95 A;  3VHW A;  1NUO A;  4DMA A;  5KRK A;  3ZR7 A;  4PPS A;  5DWE A;  3B68 A;  1G1U A;  4R2U A;  1PK5 A;  1I7G A;  5DIE A;  1Y9R A;  5DZH A;  5DL4 A;  4LBD A;  4TUZ A;  3EYB A;  4KZM A;  3VJH A;  2XKW A;  3PO9 A;  1ZUC A;  2YLP A;  5DXR A;  1Q4X A;  4REF A;  1T65 A;  2G5O A;  3MNP A;  4OKT A;  3ET2 A;  5IZ0 A;  5C4S A;  5DUG A;  3JZB A;  4NQA B;  5KRJ A;  5DVV A;  3A9E B;  1I38 A;  3VT4 A;  2Q7K A;  4F9M A;  3VRT A;  2V7C A;  1XDK A;  3L0E A;  1P93 A;  3VT7 A;  1A28 A;  1S0X A;  2HWQ A;  3A3Z X;  3B0Q A;  3OAP A;  4S14 A;  3ET0 A;  4J26 A;  5DK9 A;  5E0W A;  4WPF A;  3GZ9 A;  4PVU A;  2PIN A;  2A3I A;  3RUU A;  1NQ2 A;  4IVW A;  5SYZ A;  4O8F A;  1FM6 D;  1N4H A;  1UPV A;  3BEJ A;  1FCX A;  2ZNO A;  3M7R A;  1S0Z A;  5DUE A;  3UUD B;  1WM0 X;  4G1Z A;  4IQR A;  3KMR A;  3VT5 A;  5KRI A;  4IV4 A;  3RLL A;  2AWH A;  2P7Z A;  4PP6 A;  5EHJ A;  4APU A;  3E7C A;  3VHU A;  2GPV A;  5G3J A;  4ZNV A;  1PCG A;  2NXX E;  3DY6 A;  5H1E A;  4XUM A;  2Q1V A;  5EGV A;  4S0T A;  5G5W A;  3K22 A;  5E0X A;  5AVI A;  2V0V A;  3GYT A;  5DXB B;  3SP9 A;  4IA2 A;  2VSR A;  3VT3 A;  2O4J A;  2Q3Y A;  4KZI A;  5DMC A;  1NRL A;  3HZF A;  1SKX A;  3D6D A;  2YLY A;  1YJE A;  1L2J A;  4X1F A;  1T7F A;  1T7T A;  3OS8 C;  3ADT A;  2ZK2 A;  5G45 A;  2PIO A;  3KPZ A;  3Q95 B;  4RAK A;  2HAS A;  3RY9 A;  1FBY A;  1U3R A;  3PCU A;  3VT9 A;  5KCT A;  3D57 A;  3JZC A;  2PIR A;  5JJM A;  5KRF A;  5DXK A;  4QK4 A;  1ZGY A;  3DR1 A;  3O1E A;  4RMD A;  2AX6 A;  3RLJ A;  5HZC A;  2I0J A;  3CS4 A;  5DYD A;  1DKF B;  1ERE A;  3TX7 B;  3W5P A;  3V49 A;  1SJ0 A;  3LBD A;  5LWP A;  3H52 A;  2HWR A;  2QA6 A;  5G46 A;  4K7A A;  3ILZ A;  3VSO A;  5KCU A;  1XPC A;  2P1T A;  2ZLA A;  3MNE A;  1XNX A;  3D24 A;  3R29 A;  5EC9 A;  3W0I A;  2ZKC A;  3CS6 A;  3DCT A;  4G1D A;  3OMO A;  2ZXM A;  3B67 A;  5FQS A;  4J5W C;  4OFR A;  4M8H A;  4RWV A;  5A86 A;  1NAV A;  3X36 A;  1G5Y A;  3AN3 A;  3HC6 A;  4RUP A;  3AUR A;  3CS8 A;  5AZV A;  4ZJR A;  1R1K A;  2R40 D;  5AAV B;  4G21 A;  1QKT A;  1T79 A;  4IU7 A;  3AFR A;  4B7W A;  3OS8 A;  4RFW A;  3V9V A;  5I4V A;  5FQT A;  3R8I A;  4MG7 A;  1S9P A;  2AX9 A;  5KD9 A;  1L2I A;  5HJP A;  4JL4 A;  2AM9 A;  2PIX A;  5DID A;  1PQ6 A;  2YJD A;  5G43 A;  5E19 A;  1XP6 A;  3DZU D;  4RZG A;  4IW8 A;  3E00 D;  4ONI A;  4OZR U;  3A40 X;  5AAU A;  3UVV A;  3FXV A;  3OZJ A;  1VJB A;  4DK8 A;  3AX8 A;  3FEJ A;  4DQM A;  3L3Z A;  4OKX A;  4OJ9 A;  3R5N A;  1T76 A;  2QW4 A;  3B0R A;  4OH6 A;  5GIE A;  5DRM A;  4E2J A;  2ZNN A;  4DK7 A;  1A52 A;  1XAP A;  3OOK A;  1PQC A;  2HBH A;  2BJ4 B;  5C4O A;  4DOS A;  4OK1 A;  2HAM A;  2GIU A;  2ZXZ A;  1T74 A;  4FNE A;  3FAL B;  2AMA A;  5DWI A;  3OSI A;  4K4J A;  4PWL A;  1K74 D;  2PIW A;  1RKG A;  2YHD A;  3TY0 A;  2QGT A;  3NOA A;  3ERD A;  3OLS A;  4A4V A;  2AA6 A;  5DX3 A;  2NV7 A;  2OVM A;  1U3Q A;  4BCR A;  4J5X A;  5DKS A;  1R6G A;  3HLV A;  3T03 A;  2VV4 B;  3WJ5 A;  2P1U A;  5DMF A;  1UPW A;  1OT7 A;  4ZNT A;  3BC5 A;  5L7H A;  3AZ2 A;  4N73 A;  4HLW A;  3HOD A;  1IE8 A;  4IA1 A;  5DX3 B;  3V4A A;  3R5M A;  3VJI A;  2NW4 A;  5FQR A;  1FM6 A;  1SQN A;  3RUT A;  3X1H A;  2Q5G A;  3ET3 A;  5HYR A;  3K6P A;  3R8D A;  5KRL A;  3CDS A;  2QAB A;  3K8S A;  5ETH A;  3A9E A;  3OZ0 A;  2GP7 A;  4QM0 A;  5DSH A;  5B41 A;  2Q7J A;  3CJW A;  4OGH A;  4IV2 A;  2PIV A;  4FN9 A;  4OH5 A;  1XJ7 A;  3OSW A;  1M7W A;  1XLS A;  4OLM A;  3W0H A;  1KNU A;  3FUG A;  2ZK3 A;  1M2Z A;  4XT9 A;  5ICK A;  2QTU A;  1YP0 A;  2ACL A;  3IXP A;  3F5C B;  1QKM A;  1T7R A;  1NDE A;  2FAI A;  1T73 A;  3UUA B;  1RJK A;  3AUQ A;  1XV9 B;  3R2A A;  3CQV A;  4IW6 A;  2AX7 A;  4N1Y A;  3UUD A;  4N5G A;  1XNN A;  4P6W A;  1XVP B;  2HCD A;  3B3K A;  3CWD A;  1YUC A;  3UU7 B;  4ZNH A;  1S9Q A;  2HB8 A;  1G2N A;  4S0S A;  4UDD A;  4ZO1 X;  3ZRA A;  5KCE A;  3WFG A;  2PIU A;  2J7Y A;  4PLE A;  5GT4 A;  3GWS X;  2ZFX A;  4TUZ B;  2P1V A;  4RUJ A;  3V3E A;  5DXB A;  5DZ1 A;  5JI0 D;  2OM9 A;  2HFP A;  2GL8 A;  3S9S A;  3B0T A;  2Q70 A;  4L98 A;  3VT6 A;  4IWF A;  2GWX A;  4XLD A;  5E15 A;  1ZDT A;  4MG9 A;  2OVH A;  3TKM A;  3A2H A;  4Y29 A;  3GN8 A;  4OFU A;  5DIG A;  4XAO A;  1FM9 D;  3Q95 A;  4JGV A;  4R06 A;  2FVJ A;  1N46 A;  2QA8 B;  3IXP D;  3KMZ A;  1LV2 A;  3WT7 A;  5KCC A;  3D90 A;  2P7A A;  4IS8 A;  3FC6 A;  2LBD A;  4G2I A;  4OIU A;  2R40 A;  2P54 A;  4M8E A;  3GYU A;  1EXX A;  5M96 A;  5AWK A;  4ZI1 A;  4S15 A;  4A4W A;  4MGA B;  4TV1 A;  2QMV A;  5DWL A;  3WFF A;  5DI7 A;  3A78 A;  5APH A;  2QPY A;  1GWR A;  2Q5P A;  5HYK A;  3DZU A;  2J14 A;  2P4Y A;  3E00 A;  2YJA B;  3L0L A;  3CDP A;  1PQ9 A;  2G0G A;  4NB6 A;  1I37 A;  1MV9 A;  2HVC A;  5FQV A;  2NXX A;  4OC7 A;  4G2H A;  5DVC A;  2B1V A;  2Q1H A;  1E3G A;  3VJS A;  4CSJ A;  5KRC A;  2W8Y A;  2PIQ A;  3UUC A;  1OSH A;  2AA7 A;  2F4B A;  2Z4J A;  1ZKY A;  1OVL A;  3B66 A;  4J24 A;  3KWY A;  3OMQ A;  4RZE A;  5DLR A;  5APK A;  4IUI A;  2JJ3 A;  2AA2 A;  4MG5 A;  1E3K A;  2ATH A;  2AYR A;  2YLQ A;  1YA3 A;  4G20 A;  4LNX A;  1QKU A;  1UHL B;  3G0W A;  5APJ A;  3ZQT A;  3ADS A;  2Q61 A;  5ACC A;  2H77 A;  2O4R A;  4RUO X;  5IXK A;  1K74 A;  5K13 A;  3LMP A;  4MG8 B;  2Q8S A;  4K6I A;  2POG A;  4YMQ A;  1XQC A;  2G44 A;  4JYG A;  1Z5X E;  3IPU A;  4OIV A;  5L7G A;  4J5X C;  1SR7 A;  2I4Z A;  1ILG A;  2J4A A;  4ZNU A;  4Q0A C;  2QXM A;  3R8A A;  2AXA A;  3KYT A;  3WWR A;  4OIL A;  4MGB A;  4UDB A;  2YAT A;  5JJM B;  2Q59 B;  3OMK A;  4POH A;  5B5B A;  5JY3 A;  3O1D A;  3VSP A;  1X7B A;  1ZAF A;  3HM1 A;  3H0A D;  5C4U A;  5C4T A;  3KDT A;  2IOK A;  5L11 A;  3KMG A;  4HEE X;  2EWP A;  4ZOM A;  3PBA A;  5FQP A;  3DCU A;  3WGP A;  3ZRB A;  3ET1 A;  3X31 A;  5KRO A;  2XHS A;  2ZMJ A;  3FAL A;  2Z4B A;  5G42 A;  1XIU A;  5DXE A;  2R6W A;  1G50 A;  2VV2 A;  4MGD B;  3FS1 A;  4KZJ A;  1R20 D;  4YT1 A;  5DXM A;  4L96 A;  1ZH7 A;  1PZL A;  5L7E A;  1YOW A;  3W0G A;  2AA5 A;  1I7I A;  4Q13 A;  1RDT D;  1XB7 A;  2VV4 A;  3K23 A;  3OOF A;  4UDC A;  4WLB A;  5KRH A;  2FSZ A;  3D5F A;  3VN2 A;  3AUN A;  3VJT A;  4OHA A;  4JYI A;  2OUZ A;  3A2I A;  2B1Z A;  2QH6 A;  2G0H A;  3W0C A;  4EM9 A;  2IHQ A;  5DUH A;  4PP5 A;  2XYJ A;  1T63 A;  4QE8 A;  3B1M A;  4OAR A;  4ZNS A;  3OKH A;  5DXG A;  4PXM A;  4R6S A;  2VV0 A;  4E4Q A;  2JF9 A;  1NQ1 A;  2ZK5 A;  5DV3 A;  1T5Z A;  3GWX A;  3P89 A;  4XUH A;  1DB1 A;  4RMC A;  1TXI A;  4OEY A;  2GPU A;  3B65 A;  2Q7I A;  4ZO1 B;  4DOR A;  3N00 A;  3HO0 A;  1MZN A;  2VV1 B;  5HCV A;  2ZLC A;  1K4W A;  5DKE A;  2I4P A;  3UUA A;  3WT5 A;  5DZ0 A;  3FEI A;  2XYX A;  4WHF A;  3V3Q A;  3VRV A;  5KCF A;  1YMT A;  1BSX A;  1KKQ A;  1Y0S A;  3ADX A;  5DXQ A;  4N8R A;  5DKB A;  1EXA A;  1FM9 A;  1XVP A;  2PIT A;  1ILH A;  2JFA B;  3CTB A;  3NSP A;  4OEZ A;  1M13 A;  1T7M A;  4PP3 A;  3VTD A;  1HJ1 A;  3W0A A;  1R5K A;  3ADV A;  4NUF A;  5EJV A;  2Q6S A;  2NPA A;  1GS4 A;  1XP9 A;  3B5R A;  5AYG A;  3VI8 A;  3ERT A;  3OSA A;  1UOM A;  4OZT E;  1TFC A;  2GPO A;  2I0G A;  2PKL A;  3W0J A;  3PLZ A;  4ZN9 A;  2Q6R A;  2ABI A;  4ZN7 A;  2QZO B;  5KRM A;  3TKC A;  3WTQ A;  2B50 A;  2B23 A;  4YPQ A;  3DT3 A;  5LGA A;  3WT6 A;  2GPP A;  2ZK0 A;  3DZY D;  4OKW A;  3KBA A;  2QR9 A;  3OKI A;  3GBK A;  2QA8 A;  5GIC A;  1ZEO A;  2QSE A;  4G1Y A;  1HG4 A;  2O9I A;  3NSQ A;  1ZDU A;  2Q60 A;  3ADW A;  4FHI A;  4IVY A;  4OED A;  2AB2 A;  3L0J A;  3SP6 A;  3AN4 A;  3OS9 A;  4PRG A;  4QL8 A;  2ZXN A;  4MG6 A;  1RK3 A;  3HC5 A;  3HQ5 A;  4NY9 A;  3RVF A;  2OCF A;  5DTV A;  1RKH A;  3A2J A;  3FLI A;  4MGA A;  2ZMH A;  2AO6 A;  4NIE A;  2ACL B;  2REW A;  2ZBS A;  4E4K A;  2QE4 A;  4IA3 A;  1P8D A;  1X7R A;  1XDK B;  1FD0 A;  4WHG A;  5KR9 A;  1U3S A;  4XTA A;  5DXP A;  3KDU A;  1DKF A;  4MGC A;  3FUR A;  1NYX A;  3VRW A;  4PLD A;  3AZ1 A;  3OMM A;  5E7V A;  4CI4 A;  2R6Y A;  3BQD A;  2ZL9 A;  3IA6 A;  5DZI A;  3W5T A;  3X1I A;  1ERR A;  1N83 A;  5CJ6 A;  3WJ4 A;  3OGT A;  5KYJ A;  3H0A A;  3U9Q A;  5DU5 A;  3E94 A;  4YNK A;  3W5Q A;  4QJR A;  2AX8 A;  2OAX A;  1Y0X X;  5DZ3 A;  1UHL A;  1OSV A;  4PF3 A;  3CLD A;  2ZK6 A;  3UP0 A;  2HB7 A;  1X7E A;  1YIM A;  4MG9 B;  5AAV A;  1FCY A;  4MG8 A;  3KFC A;  1R20 A;  4ZNW A;  3WMH A;  3L3X A;  4FGY A;  2E2R A;  4REE A;  2ZAS A;  1NQ0 A;  3F7D A;  2ZMI A;  2ZNQ A;  3HVL A;  1Z5X U;  2PNU A;  3G8I A;  3QT0 A;  4ITF A;  4OJB A;  4QE6 A;  3VT8 A;  3FC6 B;  1RDT A;  3GD2 A;  2Q59 A;  1XZX X;  4LSJ A;  1IE9 A;  3G8O A;  3IMY A;  5DRJ A;  3W0Y A;  4CI5 A;  3P88 A;  5KYA A;  5KCW A;  3PEQ A;  3ADU A;  1KV6 A;  2PIP L;  2PJL A;  5AK2 A;  4RE8 A;  4TV1 B;  3OMP A;  3VRU A;  5EIT A;  3SZ1 A;  1XOW A;  2J7X A;  5IAW A;  5AWJ A;  5G44 A;  2VST A;  2Q6J A;  3P0U A;  4MGD A;  4UDA A;  4X1G A;  5AVL A;  2OZ7 A;  3UP3 A;  2AAX A;  1FCZ A;  1MVC A;  4MDD A;  1X78 A;  2ZY0 A;  3L03 A;  3AZ3 A;  2BAW A;  2BJ4 A;  1NQ7 A;  4IWC A;  2QNV A;  1X7J A;  2YFE A;  2GTK A;  4DM6 A;  2P7G A;  2ZVT A;  5DKG A;  1K7L A;  2QXS A;  1OVL B;  3IPS A;  4RME A;  2XYW A;  5DV8 A;  1S19 A;  1U9E A;  4RZF A;  5E14 A;  2IOG A;  4Q50 A;  4P6X A;  5GID A;  5DY8 A;  4OJ4 A;  1YOK A;  1YIN A;  2Q7L A; 
#chains in the Genus database with same CATH homology
 4XHD A;  1XP1 A;  2QGW A;  1PRG A;  3B0W A;  4JYH A;  5AZT A;  3OLL A;  4JAZ A;  4LNW A;  1PDU A;  4EMA A;  4MG7 B;  4WVD A;  4DM8 A;  2VV3 A;  2P15 A;  3P8X A;  5HJP B;  3PRG A;  4POJ A;  4IA7 A;  4MGB B;  1H9U A;  2HAR A;  3IPQ A;  2PRG A;  1XQ3 A;  4OZR E;  5EI1 A;  2VV1 A;  4WQP A;  5DYB A;  1YY4 A;  3UVV B;  5KCD A;  1NHZ A;  4J5W A;  5DP0 A;  1LBD A;  2I4J A;  1GWX A;  1NAX A;  2YLO A;  2ZK1 A;  3V9Y A;  2POB A;  3DZY A;  3OLF A;  1GWQ A;  2JFA A;  4ZJW A;  1R1K D;  4A2J A;  3G9E A;  5F9B A;  4ITE A;  5DV6 A;  3F5C A;  3L1B A;  1XLS E;  5KRA A;  2ZK4 A;  1YYE A;  2Q5S A;  2ZNP A;  3MNO A;  3VTC A;  5DWJ A;  3VHV A;  5DVS A;  1XV9 A;  2HC4 A;  4PPP A;  4FHH A;  5DWG A;  3VTB A;  5HJS A;  4XI3 A;  4OEA A;  3V9T A;  2H79 A;  4OKB A;  3W5R A;  1QKN A;  3UU7 A;  4OZT U;  2AMB A;  1X76 A;  5E1C A;  2QZO A;  4LTW A;  1Z95 A;  3VHW A;  1NUO A;  4DMA A;  5KRK A;  3ZR7 A;  4PPS A;  5DWE A;  3B68 A;  1G1U A;  4R2U A;  1PK5 A;  1I7G A;  5DIE A;  1Y9R A;  5DZH A;  5DL4 A;  4LBD A;  4TUZ A;  3EYB A;  4KZM A;  3VJH A;  2XKW A;  3PO9 A;  1ZUC A;  2YLP A;  5DXR A;  1Q4X A;  4REF A;  1T65 A;  2G5O A;  3MNP A;  4OKT A;  3ET2 A;  5IZ0 A;  5C4S A;  5DUG A;  3JZB A;  4NQA B;  5KRJ A;  5DVV A;  3A9E B;  1I38 A;  3VT4 A;  2Q7K A;  4F9M A;  3VRT A;  2V7C A;  1XDK A;  3L0E A;  1P93 A;  3VT7 A;  1A28 A;  1S0X A;  2HWQ A;  3A3Z X;  3B0Q A;  3OAP A;  4S14 A;  3ET0 A;  4J26 A;  5DK9 A;  5E0W A;  4WPF A;  3GZ9 A;  4PVU A;  2PIN A;  2A3I A;  3RUU A;  1NQ2 A;  4IVW A;  5SYZ A;  4O8F A;  1FM6 D;  1N4H A;  1UPV A;  3BEJ A;  1FCX A;  2ZNO A;  3M7R A;  1S0Z A;  5DUE A;  3UUD B;  1WM0 X;  4G1Z A;  4IQR A;  3KMR A;  3VT5 A;  5KRI A;  4IV4 A;  3RLL A;  2AWH A;  2P7Z A;  4PP6 A;  5EHJ A;  4APU A;  3E7C A;  3VHU A;  2GPV A;  5G3J A;  4ZNV A;  1PCG A;  2NXX E;  3DY6 A;  5H1E A;  4XUM A;  2Q1V A;  5EGV A;  4S0T A;  5G5W A;  3K22 A;  5E0X A;  5AVI A;  2V0V A;  3GYT A;  5DXB B;  3SP9 A;  4IA2 A;  2VSR A;  3VT3 A;  2O4J A;  2Q3Y A;  4KZI A;  5DMC A;  1NRL A;  3HZF A;  1SKX A;  3D6D A;  2YLY A;  1YJE A;  1L2J A;  4X1F A;  1T7F A;  1T7T A;  3OS8 C;  3ADT A;  2ZK2 A;  5G45 A;  2PIO A;  3KPZ A;  3Q95 B;  4RAK A;  2HAS A;  3RY9 A;  1FBY A;  1U3R A;  3PCU A;  3VT9 A;  5KCT A;  3D57 A;  3JZC A;  2PIR A;  5JJM A;  5KRF A;  5DXK A;  4QK4 A;  1ZGY A;  3DR1 A;  3O1E A;  4RMD A;  2AX6 A;  3RLJ A;  5HZC A;  2I0J A;  3CS4 A;  5DYD A;  1DKF B;  1ERE A;  3TX7 B;  3W5P A;  3V49 A;  1SJ0 A;  3LBD A;  5LWP A;  3H52 A;  2HWR A;  2QA6 A;  5G46 A;  4K7A A;  3ILZ A;  3VSO A;  5KCU A;  1XPC A;  2P1T A;  2ZLA A;  3MNE A;  1XNX A;  3D24 A;  3R29 A;  5EC9 A;  3W0I A;  2ZKC A;  3CS6 A;  3DCT A;  4G1D A;  3OMO A;  2ZXM A;  3B67 A;  5FQS A;  4J5W C;  4OFR A;  4M8H A;  4RWV A;  5A86 A;  1NAV A;  3X36 A;  1G5Y A;  3AN3 A;  3HC6 A;  4RUP A;  3AUR A;  3CS8 A;  5AZV A;  4ZJR A;  1R1K A;  2R40 D;  5AAV B;  4G21 A;  1QKT A;  1T79 A;  4IU7 A;  3AFR A;  4B7W A;  3OS8 A;  4RFW A;  3V9V A;  5I4V A;  5FQT A;  3R8I A;  4MG7 A;  1S9P A;  2AX9 A;  5KD9 A;  1L2I A;  5HJP A;  4JL4 A;  2AM9 A;  2PIX A;  5DID A;  1PQ6 A;  2YJD A;  5G43 A;  5E19 A;  1XP6 A;  3DZU D;  4RZG A;  4IW8 A;  3E00 D;  4ONI A;  4OZR U;  3A40 X;  5AAU A;  3UVV A;  3FXV A;  3OZJ A;  1VJB A;  4DK8 A;  3AX8 A;  3FEJ A;  4DQM A;  3L3Z A;  4OKX A;  4OJ9 A;  3R5N A;  1T76 A;  2QW4 A;  3B0R A;  4OH6 A;  5GIE A;  5DRM A;  4E2J A;  2ZNN A;  4DK7 A;  1A52 A;  1XAP A;  3OOK A;  1PQC A;  2HBH A;  2BJ4 B;  5C4O A;  4DOS A;  4OK1 A;  2HAM A;  2GIU A;  2ZXZ A;  1T74 A;  4FNE A;  3FAL B;  2AMA A;  5DWI A;  3OSI A;  4K4J A;  4PWL A;  1K74 D;  2PIW A;  1RKG A;  2YHD A;  3TY0 A;  2QGT A;  3NOA A;  3ERD A;  3OLS A;  4A4V A;  2AA6 A;  5DX3 A;  2NV7 A;  2OVM A;  1U3Q A;  4BCR A;  4J5X A;  5DKS A;  1R6G A;  3HLV A;  3T03 A;  2VV4 B;  3WJ5 A;  2P1U A;  5DMF A;  1UPW A;  1OT7 A;  4ZNT A;  3BC5 A;  5L7H A;  3AZ2 A;  4N73 A;  4HLW A;  3HOD A;  1IE8 A;  4IA1 A;  5DX3 B;  3V4A A;  3R5M A;  3VJI A;  2NW4 A;  5FQR A;  1FM6 A;  1SQN A;  3RUT A;  3X1H A;  2Q5G A;  3ET3 A;  5HYR A;  3K6P A;  3R8D A;  5KRL A;  3CDS A;  2QAB A;  3K8S A;  5ETH A;  3A9E A;  3OZ0 A;  2GP7 A;  4QM0 A;  5DSH A;  5B41 A;  2Q7J A;  3CJW A;  4OGH A;  4IV2 A;  2PIV A;  4FN9 A;  4OH5 A;  1XJ7 A;  3OSW A;  1M7W A;  1XLS A;  4OLM A;  3W0H A;  1KNU A;  3FUG A;  2ZK3 A;  1M2Z A;  4XT9 A;  5ICK A;  2QTU A;  1YP0 A;  2ACL A;  3IXP A;  3F5C B;  1QKM A;  1T7R A;  1NDE A;  2FAI A;  1T73 A;  3UUA B;  1RJK A;  3AUQ A;  1XV9 B;  3R2A A;  3CQV A;  4IW6 A;  2AX7 A;  4N1Y A;  3UUD A;  4N5G A;  1XNN A;  4P6W A;  1XVP B;  2HCD A;  3B3K A;  3CWD A;  1YUC A;  3UU7 B;  4ZNH A;  1S9Q A;  2HB8 A;  1G2N A;  4S0S A;  4UDD A;  4ZO1 X;  3ZRA A;  5KCE A;  3WFG A;  2PIU A;  2J7Y A;  4PLE A;  5GT4 A;  3GWS X;  2ZFX A;  4TUZ B;  2P1V A;  4RUJ A;  3V3E A;  5DXB A;  5DZ1 A;  5JI0 D;  2OM9 A;  2HFP A;  2GL8 A;  3S9S A;  3B0T A;  2Q70 A;  4L98 A;  3VT6 A;  4IWF A;  2GWX A;  4XLD A;  5E15 A;  1ZDT A;  4MG9 A;  2OVH A;  3TKM A;  3A2H A;  4Y29 A;  3GN8 A;  4OFU A;  5DIG A;  4XAO A;  1FM9 D;  3Q95 A;  4JGV A;  4R06 A;  2FVJ A;  1N46 A;  2QA8 B;  3IXP D;  3KMZ A;  1LV2 A;  3WT7 A;  5KCC A;  3D90 A;  2P7A A;  4IS8 A;  3FC6 A;  2LBD A;  4G2I A;  4OIU A;  2R40 A;  2P54 A;  4M8E A;  3GYU A;  1EXX A;  5M96 A;  5AWK A;  4ZI1 A;  4S15 A;  4A4W A;  4MGA B;  4TV1 A;  2QMV A;  5DWL A;  3WFF A;  5DI7 A;  3A78 A;  5APH A;  2QPY A;  1GWR A;  2Q5P A;  5HYK A;  3DZU A;  2J14 A;  2P4Y A;  3E00 A;  2YJA B;  3L0L A;  3CDP A;  1PQ9 A;  2G0G A;  4NB6 A;  1I37 A;  1MV9 A;  2HVC A;  5FQV A;  2NXX A;  4OC7 A;  4G2H A;  5DVC A;  2B1V A;  2Q1H A;  1E3G A;  3VJS A;  4CSJ A;  5KRC A;  2W8Y A;  2PIQ A;  3UUC A;  1OSH A;  2AA7 A;  2F4B A;  2Z4J A;  1ZKY A;  1OVL A;  3B66 A;  4J24 A;  3KWY A;  3OMQ A;  4RZE A;  5DLR A;  5APK A;  4IUI A;  2JJ3 A;  2AA2 A;  4MG5 A;  1E3K A;  2ATH A;  2AYR A;  2YLQ A;  1YA3 A;  4G20 A;  4LNX A;  1QKU A;  1UHL B;  3G0W A;  5APJ A;  3ZQT A;  3ADS A;  2Q61 A;  5ACC A;  2H77 A;  2O4R A;  4RUO X;  5IXK A;  1K74 A;  5K13 A;  3LMP A;  4MG8 B;  2Q8S A;  4K6I A;  2POG A;  4YMQ A;  1XQC A;  2G44 A;  4JYG A;  1Z5X E;  3IPU A;  4OIV A;  5L7G A;  4J5X C;  1SR7 A;  2I4Z A;  1ILG A;  2J4A A;  4ZNU A;  4Q0A C;  2QXM A;  3R8A A;  2AXA A;  3KYT A;  3WWR A;  4OIL A;  4MGB A;  4UDB A;  2YAT A;  5JJM B;  2Q59 B;  3OMK A;  4POH A;  5B5B A;  5JY3 A;  3O1D A;  3VSP A;  1X7B A;  1ZAF A;  3HM1 A;  3H0A D;  5C4U A;  5C4T A;  3KDT A;  2IOK A;  5L11 A;  3KMG A;  4HEE X;  2EWP A;  4ZOM A;  3PBA A;  5FQP A;  3DCU A;  3WGP A;  3ZRB A;  3ET1 A;  3X31 A;  5KRO A;  2XHS A;  2ZMJ A;  3FAL A;  2Z4B A;  5G42 A;  1XIU A;  5DXE A;  2R6W A;  1G50 A;  2VV2 A;  4MGD B;  3FS1 A;  4KZJ A;  1R20 D;  4YT1 A;  5DXM A;  4L96 A;  1ZH7 A;  1PZL A;  5L7E A;  1YOW A;  3W0G A;  2AA5 A;  1I7I A;  4Q13 A;  1RDT D;  1XB7 A;  2VV4 A;  3K23 A;  3OOF A;  4UDC A;  4WLB A;  5KRH A;  2FSZ A;  3D5F A;  3VN2 A;  3AUN A;  3VJT A;  4OHA A;  4JYI A;  2OUZ A;  3A2I A;  2B1Z A;  2QH6 A;  2G0H A;  3W0C A;  4EM9 A;  2IHQ A;  5DUH A;  4PP5 A;  2XYJ A;  1T63 A;  4QE8 A;  3B1M A;  4OAR A;  4ZNS A;  3OKH A;  5DXG A;  4PXM A;  4R6S A;  2VV0 A;  4E4Q A;  2JF9 A;  1NQ1 A;  2ZK5 A;  5DV3 A;  1T5Z A;  3GWX A;  3P89 A;  4XUH A;  1DB1 A;  4RMC A;  1TXI A;  4OEY A;  2GPU A;  3B65 A;  2Q7I A;  4ZO1 B;  4DOR A;  3N00 A;  3HO0 A;  1MZN A;  2VV1 B;  5HCV A;  2ZLC A;  1K4W A;  5DKE A;  2I4P A;  3UUA A;  3WT5 A;  5DZ0 A;  3FEI A;  2XYX A;  4WHF A;  3V3Q A;  3VRV A;  5KCF A;  1YMT A;  1BSX A;  1KKQ A;  1Y0S A;  3ADX A;  5DXQ A;  4N8R A;  5DKB A;  1EXA A;  1FM9 A;  1XVP A;  2PIT A;  1ILH A;  2JFA B;  3CTB A;  3NSP A;  4OEZ A;  1M13 A;  1T7M A;  4PP3 A;  3VTD A;  1HJ1 A;  3W0A A;  1R5K A;  3ADV A;  4NUF A;  5EJV A;  2Q6S A;  2NPA A;  1GS4 A;  1XP9 A;  3B5R A;  5AYG A;  3VI8 A;  3ERT A;  3OSA A;  1UOM A;  4OZT E;  1TFC A;  2GPO A;  2I0G A;  2PKL A;  3W0J A;  3PLZ A;  4ZN9 A;  2Q6R A;  2ABI A;  4ZN7 A;  2QZO B;  5KRM A;  3TKC A;  3WTQ A;  2B50 A;  2B23 A;  4YPQ A;  3DT3 A;  5LGA A;  3WT6 A;  2GPP A;  2ZK0 A;  3DZY D;  4OKW A;  3KBA A;  2QR9 A;  3OKI A;  3GBK A;  2QA8 A;  5GIC A;  1ZEO A;  2QSE A;  4G1Y A;  1HG4 A;  2O9I A;  3NSQ A;  1ZDU A;  2Q60 A;  3ADW A;  4FHI A;  4IVY A;  4OED A;  2AB2 A;  3L0J A;  3SP6 A;  3AN4 A;  3OS9 A;  4PRG A;  4QL8 A;  2ZXN A;  4MG6 A;  1RK3 A;  3HC5 A;  3HQ5 A;  4NY9 A;  3RVF A;  2OCF A;  5DTV A;  1RKH A;  3A2J A;  3FLI A;  4MGA A;  2ZMH A;  2AO6 A;  4NIE A;  2ACL B;  2REW A;  2ZBS A;  4E4K A;  2QE4 A;  4IA3 A;  1P8D A;  1X7R A;  1XDK B;  1FD0 A;  4WHG A;  5KR9 A;  1U3S A;  4XTA A;  5DXP A;  3KDU A;  1DKF A;  4MGC A;  3FUR A;  1NYX A;  3VRW A;  4PLD A;  3AZ1 A;  3OMM A;  5E7V A;  4CI4 A;  2R6Y A;  3BQD A;  2ZL9 A;  3IA6 A;  5DZI A;  3W5T A;  3X1I A;  1ERR A;  1N83 A;  5CJ6 A;  3WJ4 A;  3OGT A;  5KYJ A;  3H0A A;  3U9Q A;  5DU5 A;  3E94 A;  4YNK A;  3W5Q A;  4QJR A;  2AX8 A;  2OAX A;  1Y0X X;  5DZ3 A;  1UHL A;  1OSV A;  4PF3 A;  3CLD A;  2ZK6 A;  3UP0 A;  2HB7 A;  1X7E A;  1YIM A;  4MG9 B;  5AAV A;  1FCY A;  4MG8 A;  3KFC A;  1R20 A;  4ZNW A;  3WMH A;  3L3X A;  4FGY A;  2E2R A;  4REE A;  2ZAS A;  1NQ0 A;  3F7D A;  2ZMI A;  2ZNQ A;  3HVL A;  1Z5X U;  2PNU A;  3G8I A;  3QT0 A;  4ITF A;  4OJB A;  4QE6 A;  3VT8 A;  3FC6 B;  1RDT A;  3GD2 A;  2Q59 A;  1XZX X;  4LSJ A;  1IE9 A;  3G8O A;  3IMY A;  5DRJ A;  3W0Y A;  4CI5 A;  3P88 A;  5KYA A;  5KCW A;  3PEQ A;  3ADU A;  1KV6 A;  2PIP L;  2PJL A;  5AK2 A;  4RE8 A;  4TV1 B;  3OMP A;  3VRU A;  5EIT A;  3SZ1 A;  1XOW A;  2J7X A;  5IAW A;  5AWJ A;  5G44 A;  2VST A;  2Q6J A;  3P0U A;  4MGD A;  4UDA A;  4X1G A;  5AVL A;  2OZ7 A;  3UP3 A;  2AAX A;  1FCZ A;  1MVC A;  4MDD A;  1X78 A;  2ZY0 A;  3L03 A;  3AZ3 A;  2BAW A;  2BJ4 A;  1NQ7 A;  4IWC A;  2QNV A;  1X7J A;  2YFE A;  2GTK A;  4DM6 A;  2P7G A;  2ZVT A;  5DKG A;  1K7L A;  2QXS A;  1OVL B;  3IPS A;  4RME A;  2XYW A;  5DV8 A;  1S19 A;  1U9E A;  4RZF A;  5E14 A;  2IOG A;  4Q50 A;  4P6X A;  5GID A;  5DY8 A;  4OJ4 A;  1YOK A;  1YIN A;  2Q7L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...