4A4VA

Ligand binding domain of human ppar gamma in complex with amorfrutin 2
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
275
structure length
264
Chain Sequence
QLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKISKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Characterization of Amorfrutins Bound to the Peroxisome Proliferator-Activated Receptor Gamma.
pubmed doi rcsb
molecule keywords PEROXISOME PROLIFERATOR-ACTIVATED RECEPTOR GAMMA
molecule tags Receptor
source organism Homo sapiens
total genus 102
structure length 264
sequence length 275
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 4a4vA00
4IA2A 1P8DA 3WWRA 1OVLB 3IPUA 3OLSA 5JJMB 1YA3A 2I0JA 5AAVB 4YMQA 3DZUA 4IWFA 3B0RA 4OLMA 4WHFA 3GZ9A 3VT9A 4OFUA 2ZK6A 3B65A 4E4QA 1E3KA 2QA8B 4A4WA 2PIVA 2HWQA 3OSIA 3F5CB 5KYJA 4QE6A 4MGCA 1XNNA 3R29A 5DUHA 2PIXA 2QGTA 1GS4A 2ZXNA 5KRFA 5FQSA 2Q6RA 4XLDA 3W0IA 3X31A 1QKMA 2POGA 4ZO1B 2AO6A 1T7TA 5KRHA 3R5NA 4FN9A 4OARA 1SR7A 3H0AD 3B66A 3AURA 2QW4A 3CWDA 5E7VA 4TUZB 1XP1A 4UDBA 2G0GA 5KCWA 4R2UA 1YYEA 3AZ2A 1UHLB 3MNOA 3ILZA 3VRWA 2GTKA 2Q8SA 3TX7B 1T7MA 3UVVB 2XKWA 4OZTU 5DXBB 2B50A 2PJLA 1SJ0A 2Q6JA 3IMYA 5APHA 1K74A 3PLZA 3RY9A 3UUDA 3W0GA 3CLDA 1IE8A 2ZMJA 3GWSX 3A78A 1ZH7A 3FURA 3KBAA 3OKHA 4MG9B 2Q7JA 4OGHA 3DZUD 4LBDA 2YLOA 2PRGA 4ZNSA 3GBKA 4WVDA 3VSPA 1L2IA 2ZK5A 4DK8A 3OMQA 1T74A 2ZFXA 2HC4A 3WT7A 4PPSA 5G43A 4PPPA 2AXAA 3TKCA 3VTBA 2J7YA 3RUUA 4QK4A 5DXMA 3ZRBA 4QE8A 1XNXA 1RK3A 1NDEA 3D24A 3PRGA 4G2HA 4ONIA 4PP3A 4POHA 5CJ6A 4IUIA 2ZBSA 3B0QA 1NRLA 3TY0A 2P7AA 4G1ZA 3NSQA 3VT5A 3KDUA 4OEDA 2AX6A 2R40A 3G8OA 3IPQA 4L98A 2QNVA 3ERDA 5GIDA 5AWJA 3WGPA 5B5BA 4QL8A 1YP0A 1T5ZA 1EXXA 3ZR7A 2Q3YA 1I38A 1OSHA 3WT6A 1XB7A 2Z4BA 3A2HA 3D90A 4K7AA 4S15A 4OFRA 2B23A 3UU7B 2P15A 3OSWA 2QR9A 2IOKA 2O4RA 2P7GA 4OIUA 5FQRA 4E2JA 2ZMIA 5DSHA 3V3EA 4IQRA 1N4HA 4MG6A 1P93A 3WFGA 3RVFA 4OJBA 2QGWA 2I4JA 4PXMA 4TV1A 2Q5SA 1SQNA 1XAPA 5IXKA 4IA3A 3UP0A 1MZNA 1G50A 1XP9A 2Q7LA 4PF3A 5AZVA 5KRMA 1FM9A 1VJBA 1FCXA 4N5GA 4OZTE 4R6SA 5DKBA 2AX7A 3RLJA 2ZNPA 1DKFA 5G3JA 4Q13A 1Y9RA 5DXEA 1FM6D 1S19A 2BJ4A 5GICA 2HASA 2R40D 2VV4A 2VV0A 3DR1A 3ET0A 3FALB 1Y0XX 4CI5A 5JY3A 3AX8A 1A52A 4RZGA 2FSZA 3FEJA 2Q5GA 3WJ5A 5DRMA 5HZCA 3OLFA 2J7XA 3RLLA 1UOMA 2Q60A 2ZLCA 2ZLAA 3CS8A 4OZRU 2YLPA 3AZ1A 3A9EA 5ACCA 2GPPA 2HBHA 5DXPA 1NQ0A 5M96A 3V9VA 4ZN7A 3HM1A 3E00A 2HFPA 1FD0A 2ZXZA 4ZJWA 1SKXA 3D6DA 4JGVA 2YLQA 4MGBA 5DZ0A 3ADVA 2Q1VA 4RWVA 5DK9A 5DV6A 1UPVA 2PIQA 4RMCA 5KRCA 1FM9D 2OVMA 2HCDA 4FHIA 4RUPA 3WTQA 5G44A 4X1GA 1PRGA 3TKMA 2ZNNA 1KV6A 5EHJA 3X1IA 1X7RA 1BSXA 2AB2A 4ZNHA 3CS6A 2R6WA 2PITA 4OKBA 1ERRA 5HJPA 1XV9A 1QKNA 3KPZA 3L0EA 5FQTA 1S9QA 5E19A 1T7RA 2VV3A 2QZOA 5C4SA 2I0GA 3RUTA 2GP7A 1FCYA 2GPVA 5DV8A 5L7EA 2FAIA 4ITEA 2XYXA 3SP6A 2LBDA 1WM0X 5AAUA 5G5WA 5JJMA 5E1CA 3D5FA 4KZMA 4MG5A 5DTVA 5DWIA 4HEEX 4PRGA 4PWLA 1A28A 2G44A 3VT3A 1YY4A 3UUAB 1N46A 4DORA 3P89A 2Q5PA 1U3SA 3HC5A 4MGDB 4POJA 4OKWA 1ZAFA 2NXXA 3OS8A 4LNWA 4REFA 3W0CA 1NYXA 5HYRA 4DM8A 5KCTA 3P0UA 3PEQA 4IA1A 3FXVA 1T73A 2OUZA 3V49A 3V9TA 4WLBA 3D57A 3DCUA 4ITFA 4KZJA 4JYGA 4OEYA 2OZ7A 1QKTA 5L11A 3B3KA 3W5PA 1HG4A 4FNEA 2VV2A 1NQ1A 3A2JA 3VJHA 1XDKA 3E94A 5KCEA 5G46A 4DOSA 1YIMA 5K13A 3IPSA 4OZRE 4MG7A 4OIVA 1K7LA 1ILGA 3KDTA 4Q50A 2H79A 3VHVA 1M2ZA 2IOGA 3B0TA 5DX3A 5E15A 3KMZA 4JYHA 4J5WA 2Q70A 4LNXA 1XZXX 2A3IA 5KR9A 4FHHA 1XJ7A 3VRUA 5KRKA 1R1KA 2HARA 2ABIA 2NXXE 3B1MA 5DXGA 4IU7A 4IVYA 3CDSA 1U3RA 3G9EA 3OGTA 5KCCA 4LTWA 4PLEA 2QA8A 2Z4JA 1GWRA 3X36A 4G1DA 2ZK4A 1Y0SA 2AM9A 4TV1B 2Q59A 2QXSA 3R8DA 3MNPA 3VT7A 3F7DA 2QTUA 3FC6A 2AA6A 3VJTA 4ZO1X 5DVVA 1DKFB 1K74D 4TUZA 2HB8A 5ICKA 3IXPA 3Q95A 4CI4A 1ILHA 2PIWA 2QE4A 3KYTA 2VV4B 2HB7A 4RZEA 5AWKA 2AA7A 3FS1A 3L1BA 4XTAA 4OJ4A 5ETHA 1EREA 4MGAA 5HCVA 4OKXA 3G0WA 4RMEA 5AZTA 1EXAA 3R8IA 3VRVA 5DI7A 2O9IA 1XVPA 3UP3A 1R1KD 5DVSA 3VHUA 3W0YA 1KNUA 1T63A 4MG8A 1OT7A 4OH6A 4DQMA 1XLSE 3K22A 4WPFA 3HVLA 4E4KA 1N83A 3K23A 3VT6A 2NW4A 2W8YA 2ACLB 1ZGYA 2ZMHA 4PP6A 4YPQA 1GWXA 5H1EA 2Q1HA 3W0HA 2AYRA 4MGBB 3GD2A 3A3ZX 3VTDA 5LWPA 3DY6A 3OZ0A 4PP5A 3WFFA 2XYJA 3AUNA 3FEIA 3KFCA 2PIPL 1XQCA 5GT4A 2ZKCA 2GPOA 1S9PA 3ADTA 3AZ3A 2YLYA 5DZ3A 2V7CA 5DZIA 4RMDA 2OVHA 3IXPD 3GWXA 3W5RA 3VRTA 5HJPB 2V0VA 3H52A 4ZNTA 1I7GA 5AVIA 2QZOB 4LSJA 5GIEA 1S0XA 3OS8C 4S14A 2ZNOA 1DB1A 1ZKYA 3VTCA 3DT3A 1NAXA 1TXIA 3FLIA 4NIEA 3ET1A 3A40X 5DU5A 5HJSA 5KCUA 3NOAA 4IW8A 1Q4XA 3V9YA 3GN8A 3B68A 3OSAA 2JFAA 2AAXA 3KMGA 2P1UA 3BEJA 5DWLA 1YJEA 2PIOA 2ZK1A 4QM0A 5FQPA 4OK1A 4BCRA 1QKUA 1X78A 3HZFA 3L0LA 4ZOMA 5DWJA 4M8EA 1PQ6A 1T79A 2GWXA 3PO9A 2NPAA 1PQCA 1X76A 5KCDA 5G45A 5DYDA 2P1TA 2YJAB 3FUGA 2G0HA 3V3QA 5KRIA 4J5WC 2Q7IA 4IW6A 5DIGA 2H77A 2J4AA 1NHZA 4ZJRA 4JAZA 4WQPA 4P6XA 2I4PA 1XDKB 2PKLA 3B0WA 3CJWA 5C4UA 3VN2A 1LV2A 3ET3A 3E7CA 3GYTA 4J24A 4OEAA 3OOFA 3O1DA 4S0TA 4ZNVA 1XQ3A 3OAPA 4OKTA 2OCFA 3N00A 2VV1A 4MG7B 4ZN9A 1FBYA 5DL4A 2OM9A 3FALA 2ZK3A 2QMVA 3HQ5A 4IV4A 4G21A 4L96A 3E00D 1T65A 3OS9A 3HC6A 2AWHA 5DIEA 1H9UA 2ZK2A 3IA6A 3R8AA 5KD9A 3UUDB 2QH6A 4F9MA 3ADWA 1Z5XU 3JZBA 4APUA 1KKQA 3CS4A 5DKGA 3OMKA 5DZHA 2YHDA 1T76A 4DMAA 4PLDA 5AVLA 1MVCA 3LMPA 5L7HA 5DXKA 5C4OA 2P4YA 1GWQA 3V4AA 3GYUA 3LBDA 3K6PA 4OEZA 3SP9A 3L0JA 5KRLA 2OAXA 5DUEA 3VHWA 4OC7A 5DY8A 4MDDA 4N73A 2YATA 3W5TA 1ZDUA 3CDPA 4CSJA 1X7BA 3B67A 5EI1A 5I4VA 4WHGA 4G2IA 1YUCA 3B5RA 3NSPA 4RUOX 3UUCA 1XPCA 2Q59B 5DUGA 4YNKA 3L3ZA 5A86A 2REWA 1I7IA 2J14A 3FC6B 5E0WA 2PIUA 2G5OA 4G20A 5DKEA 1YINA 3WJ4A 4NUFA 3VJIA 1XP6A 3ADXA 2QSEA 5DXRA 3W0JA 2XYWA 3Q95B 2QA6A 4UDDA 3U9QA 3W0AA 2IHQA 1OVLA 2NV7A 1YOKA 1G1UA 3OZJA 3OLLA 4X1FA 4ZNUA 5KYAA 5DIDA 4NB6A 4XUMA 5AAVA 3DZYA 1U3QA 1I37A 3AN3A 1NQ2A 4MGAB 1RDTA 4RUJA 4EM9A 1PCGA 5DVCA 2GL8A 3JZCA 5DRJA 5F9BA 5KRJA 1XLSA 1XVPB 2YJDA 4RZFA 1K4WA 1PZLA 1Z95A 3F5CA 1R6GA 4MG8B 5EC9A 3SZ1A 3UUAA 3VT4A 4RAKA 3VSOA 3CQVA 4FGYA 4RE8A 4MGDA 5KCFA 1U9EA 3PBAA 2AA5A 2B1ZA 3P8XA 1RJKA 5APKA 1HJ1A 1NAVA 4OH5A 4Q0AC 4REEA 1TFCA 2GIUA 4EMAA 2BAWA 4OHAA 2QABA 1UHLA 2BJ4B 4UDCA 2P1VA 1NQ7A 3OMPA 1ZUCA 5DKSA 4R06A 3UVVA 4IV2A 1R20A 5DV3A 4IWCA 2ZVTA 4G1YA 5DXBA 1L2JA 1NUOA 3KWYA 3ET2A 3BC5A 5E14A 1MV9A 1Z5XE 3AFRA 5LGAA 1FM6A 3HODA 3OMOA 1PQ9A 4IVWA 2JJ3A 5EJVA 5AYGA 2B1VA 4YT1A 4UDAA 4MG9A 3A9EB 3PCUA 4J5XC 5E0XA 3WT5A 3DZYD 4NQAB 3A2IA 3O1EA 1RDTD 1YOWA 2ZXMA 5FQVA 1PDUA 3EYBA 3DCTA 3ZRAA 5IAWA 1ZDTA 2P54A 3MNEA 5DP0A 5AK2A 5EITA 5DYBA 4XI3A 1X7JA 3X1HA 2HAMA 2I4ZA 2JFAB 1M13A 1UPWA 2ZNQA 1IE9A 4XT9A 3R5MA 1FCZA 5B41A 2AMAA 5JI0D 5DMFA 3ADUA 5C4TA 1X7EA 5DWGA 5DZ1A 5EGVA 2AA2A 2VSTA 4JYIA 5KROA 5G42A 3T03A 1T7FA 3HLVA 3QT0A 3R2AA 4A2JA 1XOWA 1XV9B 2POBA 3AN4A 2HVCA 1G5YA 4N1YA 4OILA 3VJSA 4ZI1A 2YFEA 4P6WA 2R6YA 1R20D 2AX9A 3P88A 2AMBA 5DMCA 4DM6A 3ADSA 3OOKA 4RFWA 4HLWA 3VI8A 3OMMA 2VV1B 3UU7A 4DK7A 1YMTA 2GPUA 2F4BA 3OKIA 4PVUA 3CTBA 3VT8A 4J5XA 2FVJA 2Q7KA 3M7RA 1E3GA 1R5KA 2XHSA 3K8SA 4XUHA 4B7WA 4XAOA 2O4JA 3BQDA 5SYZA 3ZQTA 4OJ9A 3L03A 2AX8A 3KMRA 5IZ0A 2ACLA 4JL4A 3ERTA 3WMHA 5APJA 1OSVA 2Q61A 3W5QA 4ZNWA 4M8HA 4NY9A 4QJRA 3HO0A 4IA7A 1RKHA 4N8RA 2EWPA 1M7WA 3H0AA 1PK5A 2ZL9A 4IS8A 4XHDA 5DLRA 2PIRA 2E2RA 2Q6SA 1RKGA 2HWRA 2ATHA 2P7ZA 4J26A 1XIUA 4Y29A 4O8FA 5DXQA 1LBDA 5HYKA 5KRAA 1G2NA 2PNUA 2ZASA 2QXMA 2ZK0A 3AUQA 4S0SA 5DX3B 2ZY0A 2JF9A 2VSRA 5DWEA 4K4JA 5L7GA 3S9SA 3G8IA 2PINA 4K6IA 4A4VA 3L3XA 4KZIA 1S0ZA 2QPYA 1ZEOA
chains in the Genus database with same CATH superfamily
4IA2A 1P8DA 3WWRA 1OVLB 3IPUA 3OLSA 5JJMB 1YA3A 2I0JA 5AAVB 4YMQA 3DZUA 4IWFA 3B0RA 4OLMA 4WHFA 3GZ9A 3VT9A 4OFUA 2ZK6A 3B65A 4E4QA 1E3KA 2QA8B 4A4WA 2PIVA 2HWQA 3OSIA 3F5CB 5KYJA 4QE6A 4MGCA 1XNNA 3R29A 5DUHA 2PIXA 2QGTA 1GS4A 2ZXNA 5KRFA 5FQSA 2Q6RA 4XLDA 3W0IA 3X31A 1QKMA 2POGA 4ZO1B 2AO6A 1T7TA 5KRHA 3R5NA 4FN9A 4OARA 1SR7A 3H0AD 3B66A 3AURA 2QW4A 3CWDA 5E7VA 4TUZB 1XP1A 4UDBA 2G0GA 5KCWA 4R2UA 1YYEA 3AZ2A 1UHLB 3MNOA 3ILZA 3VRWA 2GTKA 2Q8SA 3TX7B 1T7MA 3UVVB 2XKWA 4OZTU 5DXBB 2B50A 2PJLA 1SJ0A 2Q6JA 3IMYA 5APHA 1K74A 3PLZA 3RY9A 3UUDA 3W0GA 3CLDA 1IE8A 2ZMJA 3GWSX 3A78A 1ZH7A 3FURA 3KBAA 3OKHA 4MG9B 2Q7JA 4OGHA 3DZUD 4LBDA 2YLOA 2PRGA 4ZNSA 3GBKA 4WVDA 3VSPA 1L2IA 2ZK5A 4DK8A 3OMQA 1T74A 2ZFXA 2HC4A 3WT7A 4PPSA 5G43A 4PPPA 2AXAA 3TKCA 3VTBA 2J7YA 3RUUA 4QK4A 5DXMA 3ZRBA 4QE8A 1XNXA 1RK3A 1NDEA 3D24A 3PRGA 4G2HA 4ONIA 4PP3A 4POHA 5CJ6A 4IUIA 2ZBSA 3B0QA 1NRLA 3TY0A 2P7AA 4G1ZA 3NSQA 3VT5A 3KDUA 4OEDA 2AX6A 2R40A 3G8OA 3IPQA 4L98A 2QNVA 3ERDA 5GIDA 5AWJA 3WGPA 5B5BA 4QL8A 1YP0A 1T5ZA 1EXXA 3ZR7A 2Q3YA 1I38A 1OSHA 3WT6A 1XB7A 2Z4BA 3A2HA 3D90A 4K7AA 4S15A 4OFRA 2B23A 3UU7B 2P15A 3OSWA 2QR9A 2IOKA 2O4RA 2P7GA 4OIUA 5FQRA 4E2JA 2ZMIA 5DSHA 3V3EA 4IQRA 1N4HA 4MG6A 1P93A 3WFGA 3RVFA 4OJBA 2QGWA 2I4JA 4PXMA 4TV1A 2Q5SA 1SQNA 1XAPA 5IXKA 4IA3A 3UP0A 1MZNA 1G50A 1XP9A 2Q7LA 4PF3A 5AZVA 5KRMA 1FM9A 1VJBA 1FCXA 4N5GA 4OZTE 4R6SA 5DKBA 2AX7A 3RLJA 2ZNPA 1DKFA 5G3JA 4Q13A 1Y9RA 5DXEA 1FM6D 1S19A 2BJ4A 5GICA 2HASA 2R40D 2VV4A 2VV0A 3DR1A 3ET0A 3FALB 1Y0XX 4CI5A 5JY3A 3AX8A 1A52A 4RZGA 2FSZA 3FEJA 2Q5GA 3WJ5A 5DRMA 5HZCA 3OLFA 2J7XA 3RLLA 1UOMA 2Q60A 2ZLCA 2ZLAA 3CS8A 4OZRU 2YLPA 3AZ1A 3A9EA 5ACCA 2GPPA 2HBHA 5DXPA 1NQ0A 5M96A 3V9VA 4ZN7A 3HM1A 3E00A 2HFPA 1FD0A 2ZXZA 4ZJWA 1SKXA 3D6DA 4JGVA 2YLQA 4MGBA 5DZ0A 3ADVA 2Q1VA 4RWVA 5DK9A 5DV6A 1UPVA 2PIQA 4RMCA 5KRCA 1FM9D 2OVMA 2HCDA 4FHIA 4RUPA 3WTQA 5G44A 4X1GA 1PRGA 3TKMA 2ZNNA 1KV6A 5EHJA 3X1IA 1X7RA 1BSXA 2AB2A 4ZNHA 3CS6A 2R6WA 2PITA 4OKBA 1ERRA 5HJPA 1XV9A 1QKNA 3KPZA 3L0EA 5FQTA 1S9QA 5E19A 1T7RA 2VV3A 2QZOA 5C4SA 2I0GA 3RUTA 2GP7A 1FCYA 2GPVA 5DV8A 5L7EA 2FAIA 4ITEA 2XYXA 3SP6A 2LBDA 1WM0X 5AAUA 5G5WA 5JJMA 5E1CA 3D5FA 4KZMA 4MG5A 5DTVA 5DWIA 4HEEX 4PRGA 4PWLA 1A28A 2G44A 3VT3A 1YY4A 3UUAB 1N46A 4DORA 3P89A 2Q5PA 1U3SA 3HC5A 4MGDB 4POJA 4OKWA 1ZAFA 2NXXA 3OS8A 4LNWA 4REFA 3W0CA 1NYXA 5HYRA 4DM8A 5KCTA 3P0UA 3PEQA 4IA1A 3FXVA 1T73A 2OUZA 3V49A 3V9TA 4WLBA 3D57A 3DCUA 4ITFA 4KZJA 4JYGA 4OEYA 2OZ7A 1QKTA 5L11A 3B3KA 3W5PA 1HG4A 4FNEA 2VV2A 1NQ1A 3A2JA 3VJHA 1XDKA 3E94A 5KCEA 5G46A 4DOSA 1YIMA 5K13A 3IPSA 4OZRE 4MG7A 4OIVA 1K7LA 1ILGA 3KDTA 4Q50A 2H79A 3VHVA 1M2ZA 2IOGA 3B0TA 5DX3A 5E15A 3KMZA 4JYHA 4J5WA 2Q70A 4LNXA 1XZXX 2A3IA 5KR9A 4FHHA 1XJ7A 3VRUA 5KRKA 1R1KA 2HARA 2ABIA 2NXXE 3B1MA 5DXGA 4IU7A 4IVYA 3CDSA 1U3RA 3G9EA 3OGTA 5KCCA 4LTWA 4PLEA 2QA8A 2Z4JA 1GWRA 3X36A 4G1DA 2ZK4A 1Y0SA 2AM9A 4TV1B 2Q59A 2QXSA 3R8DA 3MNPA 3VT7A 3F7DA 2QTUA 3FC6A 2AA6A 3VJTA 4ZO1X 5DVVA 1DKFB 1K74D 4TUZA 2HB8A 5ICKA 3IXPA 3Q95A 4CI4A 1ILHA 2PIWA 2QE4A 3KYTA 2VV4B 2HB7A 4RZEA 5AWKA 2AA7A 3FS1A 3L1BA 4XTAA 4OJ4A 5ETHA 1EREA 4MGAA 5HCVA 4OKXA 3G0WA 4RMEA 5AZTA 1EXAA 3R8IA 3VRVA 5DI7A 2O9IA 1XVPA 3UP3A 1R1KD 5DVSA 3VHUA 3W0YA 1KNUA 1T63A 4MG8A 1OT7A 4OH6A 4DQMA 1XLSE 3K22A 4WPFA 3HVLA 4E4KA 1N83A 3K23A 3VT6A 2NW4A 2W8YA 2ACLB 1ZGYA 2ZMHA 4PP6A 4YPQA 1GWXA 5H1EA 2Q1HA 3W0HA 2AYRA 4MGBB 3GD2A 3A3ZX 3VTDA 5LWPA 3DY6A 3OZ0A 4PP5A 3WFFA 2XYJA 3AUNA 3FEIA 3KFCA 2PIPL 1XQCA 5GT4A 2ZKCA 2GPOA 1S9PA 3ADTA 3AZ3A 2YLYA 5DZ3A 2V7CA 5DZIA 4RMDA 2OVHA 3IXPD 3GWXA 3W5RA 3VRTA 5HJPB 2V0VA 3H52A 4ZNTA 1I7GA 5AVIA 2QZOB 4LSJA 5GIEA 1S0XA 3OS8C 4S14A 2ZNOA 1DB1A 1ZKYA 3VTCA 3DT3A 1NAXA 1TXIA 3FLIA 4NIEA 3ET1A 3A40X 5DU5A 5HJSA 5KCUA 3NOAA 4IW8A 1Q4XA 3V9YA 3GN8A 3B68A 3OSAA 2JFAA 2AAXA 3KMGA 2P1UA 3BEJA 5DWLA 1YJEA 2PIOA 2ZK1A 4QM0A 5FQPA 4OK1A 4BCRA 1QKUA 1X78A 3HZFA 3L0LA 4ZOMA 5DWJA 4M8EA 1PQ6A 1T79A 2GWXA 3PO9A 2NPAA 1PQCA 1X76A 5KCDA 5G45A 5DYDA 2P1TA 2YJAB 3FUGA 2G0HA 3V3QA 5KRIA 4J5WC 2Q7IA 4IW6A 5DIGA 2H77A 2J4AA 1NHZA 4ZJRA 4JAZA 4WQPA 4P6XA 2I4PA 1XDKB 2PKLA 3B0WA 3CJWA 5C4UA 3VN2A 1LV2A 3ET3A 3E7CA 3GYTA 4J24A 4OEAA 3OOFA 3O1DA 4S0TA 4ZNVA 1XQ3A 3OAPA 4OKTA 2OCFA 3N00A 2VV1A 4MG7B 4ZN9A 1FBYA 5DL4A 2OM9A 3FALA 2ZK3A 2QMVA 3HQ5A 4IV4A 4G21A 4L96A 3E00D 1T65A 3OS9A 3HC6A 2AWHA 5DIEA 1H9UA 2ZK2A 3IA6A 3R8AA 5KD9A 3UUDB 2QH6A 4F9MA 3ADWA 1Z5XU 3JZBA 4APUA 1KKQA 3CS4A 5DKGA 3OMKA 5DZHA 2YHDA 1T76A 4DMAA 4PLDA 5AVLA 1MVCA 3LMPA 5L7HA 5DXKA 5C4OA 2P4YA 1GWQA 3V4AA 3GYUA 3LBDA 3K6PA 4OEZA 3SP9A 3L0JA 5KRLA 2OAXA 5DUEA 3VHWA 4OC7A 5DY8A 4MDDA 4N73A 2YATA 3W5TA 1ZDUA 3CDPA 4CSJA 1X7BA 3B67A 5EI1A 5I4VA 4WHGA 4G2IA 1YUCA 3B5RA 3NSPA 4RUOX 3UUCA 1XPCA 2Q59B 5DUGA 4YNKA 3L3ZA 5A86A 2REWA 1I7IA 2J14A 3FC6B 5E0WA 2PIUA 2G5OA 4G20A 5DKEA 1YINA 3WJ4A 4NUFA 3VJIA 1XP6A 3ADXA 2QSEA 5DXRA 3W0JA 2XYWA 3Q95B 2QA6A 4UDDA 3U9QA 3W0AA 2IHQA 1OVLA 2NV7A 1YOKA 1G1UA 3OZJA 3OLLA 4X1FA 4ZNUA 5KYAA 5DIDA 4NB6A 4XUMA 5AAVA 3DZYA 1U3QA 1I37A 3AN3A 1NQ2A 4MGAB 1RDTA 4RUJA 4EM9A 1PCGA 5DVCA 2GL8A 3JZCA 5DRJA 5F9BA 5KRJA 1XLSA 1XVPB 2YJDA 4RZFA 1K4WA 1PZLA 1Z95A 3F5CA 1R6GA 4MG8B 5EC9A 3SZ1A 3UUAA 3VT4A 4RAKA 3VSOA 3CQVA 4FGYA 4RE8A 4MGDA 5KCFA 1U9EA 3PBAA 2AA5A 2B1ZA 3P8XA 1RJKA 5APKA 1HJ1A 1NAVA 4OH5A 4Q0AC 4REEA 1TFCA 2GIUA 4EMAA 2BAWA 4OHAA 2QABA 1UHLA 2BJ4B 4UDCA 2P1VA 1NQ7A 3OMPA 1ZUCA 5DKSA 4R06A 3UVVA 4IV2A 1R20A 5DV3A 4IWCA 2ZVTA 4G1YA 5DXBA 1L2JA 1NUOA 3KWYA 3ET2A 3BC5A 5E14A 1MV9A 1Z5XE 3AFRA 5LGAA 1FM6A 3HODA 3OMOA 1PQ9A 4IVWA 2JJ3A 5EJVA 5AYGA 2B1VA 4YT1A 4UDAA 4MG9A 3A9EB 3PCUA 4J5XC 5E0XA 3WT5A 3DZYD 4NQAB 3A2IA 3O1EA 1RDTD 1YOWA 2ZXMA 5FQVA 1PDUA 3EYBA 3DCTA 3ZRAA 5IAWA 1ZDTA 2P54A 3MNEA 5DP0A 5AK2A 5EITA 5DYBA 4XI3A 1X7JA 3X1HA 2HAMA 2I4ZA 2JFAB 1M13A 1UPWA 2ZNQA 1IE9A 4XT9A 3R5MA 1FCZA 5B41A 2AMAA 5JI0D 5DMFA 3ADUA 5C4TA 1X7EA 5DWGA 5DZ1A 5EGVA 2AA2A 2VSTA 4JYIA 5KROA 5G42A 3T03A 1T7FA 3HLVA 3QT0A 3R2AA 4A2JA 1XOWA 1XV9B 2POBA 3AN4A 2HVCA 1G5YA 4N1YA 4OILA 3VJSA 4ZI1A 2YFEA 4P6WA 2R6YA 1R20D 2AX9A 3P88A 2AMBA 5DMCA 4DM6A 3ADSA 3OOKA 4RFWA 4HLWA 3VI8A 3OMMA 2VV1B 3UU7A 4DK7A 1YMTA 2GPUA 2F4BA 3OKIA 4PVUA 3CTBA 3VT8A 4J5XA 2FVJA 2Q7KA 3M7RA 1E3GA 1R5KA 2XHSA 3K8SA 4XUHA 4B7WA 4XAOA 2O4JA 3BQDA 5SYZA 3ZQTA 4OJ9A 3L03A 2AX8A 3KMRA 5IZ0A 2ACLA 4JL4A 3ERTA 3WMHA 5APJA 1OSVA 2Q61A 3W5QA 4ZNWA 4M8HA 4NY9A 4QJRA 3HO0A 4IA7A 1RKHA 4N8RA 2EWPA 1M7WA 3H0AA 1PK5A 2ZL9A 4IS8A 4XHDA 5DLRA 2PIRA 2E2RA 2Q6SA 1RKGA 2HWRA 2ATHA 2P7ZA 4J26A 1XIUA 4Y29A 4O8FA 5DXQA 1LBDA 5HYKA 5KRAA 1G2NA 2PNUA 2ZASA 2QXMA 2ZK0A 3AUQA 4S0SA 5DX3B 2ZY0A 2JF9A 2VSRA 5DWEA 4K4JA 5L7GA 3S9SA 3G8IA 2PINA 4K6IA 4A4VA 3L3XA 4KZIA 1S0ZA 2QPYA 1ZEOA
chains in the Genus database with same CATH topology
4IA2A 1P8DA 3WWRA 1OVLB 3IPUA 3OLSA 5JJMB 1YA3A 2I0JA 5AAVB 4YMQA 3DZUA 4IWFA 3B0RA 4OLMA 4WHFA 3GZ9A 3VT9A 4OFUA 2ZK6A 3B65A 4E4QA 1E3KA 2QA8B 4A4WA 2PIVA 2HWQA 3OSIA 3F5CB 5KYJA 4QE6A 4MGCA 1XNNA 3R29A 5DUHA 2PIXA 2QGTA 1GS4A 2ZXNA 5KRFA 5FQSA 2Q6RA 4XLDA 3W0IA 3X31A 1QKMA 2POGA 4ZO1B 2AO6A 1T7TA 5KRHA 3R5NA 4FN9A 4OARA 1SR7A 3H0AD 3B66A 3AURA 2QW4A 3CWDA 5E7VA 4TUZB 1XP1A 4UDBA 2G0GA 5KCWA 4R2UA 1YYEA 3AZ2A 1UHLB 3MNOA 3ILZA 3VRWA 2GTKA 2Q8SA 3TX7B 1T7MA 3UVVB 2XKWA 4OZTU 5DXBB 2B50A 2PJLA 1SJ0A 2Q6JA 3IMYA 5APHA 1K74A 3PLZA 3RY9A 3UUDA 3W0GA 3CLDA 1IE8A 2ZMJA 3GWSX 3A78A 1ZH7A 3FURA 3KBAA 3OKHA 4MG9B 2Q7JA 4OGHA 3DZUD 4LBDA 2YLOA 2PRGA 4ZNSA 3GBKA 4WVDA 3VSPA 1L2IA 2ZK5A 4DK8A 3OMQA 1T74A 2ZFXA 2HC4A 3WT7A 4PPSA 5G43A 4PPPA 2AXAA 3TKCA 3VTBA 2J7YA 3RUUA 4QK4A 5DXMA 3ZRBA 4QE8A 1XNXA 1RK3A 1NDEA 3D24A 3PRGA 4G2HA 4ONIA 4PP3A 4POHA 5CJ6A 4IUIA 2ZBSA 3B0QA 1NRLA 3TY0A 2P7AA 4G1ZA 3NSQA 3VT5A 3KDUA 4OEDA 2AX6A 2R40A 3G8OA 3IPQA 4L98A 2QNVA 3ERDA 5GIDA 5AWJA 3WGPA 5B5BA 4QL8A 1YP0A 1T5ZA 1EXXA 3ZR7A 2Q3YA 1I38A 1OSHA 3WT6A 1XB7A 2Z4BA 3A2HA 3D90A 4K7AA 4S15A 4OFRA 2B23A 3UU7B 2P15A 3OSWA 2QR9A 2IOKA 2O4RA 2P7GA 4OIUA 5FQRA 4E2JA 2ZMIA 5DSHA 3V3EA 4IQRA 1N4HA 4MG6A 1P93A 3WFGA 3RVFA 4OJBA 2QGWA 2I4JA 4PXMA 4TV1A 2Q5SA 1SQNA 1XAPA 5IXKA 4IA3A 3UP0A 1MZNA 1G50A 1XP9A 2Q7LA 4PF3A 5AZVA 5KRMA 1FM9A 1VJBA 1FCXA 4N5GA 4OZTE 4R6SA 5DKBA 2AX7A 3RLJA 2ZNPA 1DKFA 5G3JA 4Q13A 1Y9RA 5DXEA 1FM6D 1S19A 2BJ4A 5GICA 2HASA 2R40D 2VV4A 2VV0A 3DR1A 3ET0A 3FALB 1Y0XX 4CI5A 5JY3A 3AX8A 1A52A 4RZGA 2FSZA 3FEJA 2Q5GA 3WJ5A 5DRMA 5HZCA 3OLFA 2J7XA 3RLLA 1UOMA 2Q60A 2ZLCA 2ZLAA 3CS8A 4OZRU 2YLPA 3AZ1A 3A9EA 5ACCA 2GPPA 2HBHA 5DXPA 1NQ0A 5M96A 3V9VA 4ZN7A 3HM1A 3E00A 2HFPA 1FD0A 2ZXZA 4ZJWA 1SKXA 3D6DA 4JGVA 2YLQA 4MGBA 5DZ0A 3ADVA 2Q1VA 4RWVA 5DK9A 5DV6A 1UPVA 2PIQA 4RMCA 5KRCA 1FM9D 2OVMA 2HCDA 4FHIA 4RUPA 3WTQA 5G44A 4X1GA 1PRGA 3TKMA 2ZNNA 1KV6A 5EHJA 3X1IA 1X7RA 1BSXA 2AB2A 4ZNHA 3CS6A 2R6WA 2PITA 4OKBA 1ERRA 5HJPA 1XV9A 1QKNA 3KPZA 3L0EA 5FQTA 1S9QA 5E19A 1T7RA 2VV3A 2QZOA 5C4SA 2I0GA 3RUTA 2GP7A 1FCYA 2GPVA 5DV8A 5L7EA 2FAIA 4ITEA 2XYXA 3SP6A 2LBDA 1WM0X 5AAUA 5G5WA 5JJMA 5E1CA 3D5FA 4KZMA 4MG5A 5DTVA 5DWIA 4HEEX 4PRGA 4PWLA 1A28A 2G44A 3VT3A 1YY4A 3UUAB 1N46A 4DORA 3P89A 2Q5PA 1U3SA 3HC5A 4MGDB 4POJA 4OKWA 1ZAFA 2NXXA 3OS8A 4LNWA 4REFA 3W0CA 1NYXA 5HYRA 4DM8A 5KCTA 3P0UA 3PEQA 4IA1A 3FXVA 1T73A 2OUZA 3V49A 3V9TA 4WLBA 3D57A 3DCUA 4ITFA 4KZJA 4JYGA 4OEYA 2OZ7A 1QKTA 5L11A 3B3KA 3W5PA 1HG4A 4FNEA 2VV2A 1NQ1A 3A2JA 3VJHA 1XDKA 3E94A 5KCEA 5G46A 4DOSA 1YIMA 5K13A 3IPSA 4OZRE 4MG7A 4OIVA 1K7LA 1ILGA 3KDTA 4Q50A 2H79A 3VHVA 1M2ZA 2IOGA 3B0TA 5DX3A 5E15A 3KMZA 4JYHA 4J5WA 2Q70A 4LNXA 1XZXX 2A3IA 5KR9A 4FHHA 1XJ7A 3VRUA 5KRKA 1R1KA 2HARA 2ABIA 2NXXE 3B1MA 5DXGA 4IU7A 4IVYA 3CDSA 1U3RA 3G9EA 3OGTA 5KCCA 4LTWA 4PLEA 2QA8A 2Z4JA 1GWRA 3X36A 4G1DA 2ZK4A 1Y0SA 2AM9A 4TV1B 2Q59A 2QXSA 3R8DA 3MNPA 3VT7A 3F7DA 2QTUA 3FC6A 2AA6A 3VJTA 4ZO1X 5DVVA 1DKFB 1K74D 4TUZA 2HB8A 5ICKA 3IXPA 3Q95A 4CI4A 1ILHA 2PIWA 2QE4A 3KYTA 2VV4B 2HB7A 4RZEA 5AWKA 2AA7A 3FS1A 3L1BA 4XTAA 4OJ4A 5ETHA 1EREA 4MGAA 5HCVA 4OKXA 3G0WA 4RMEA 5AZTA 1EXAA 3R8IA 3VRVA 5DI7A 2O9IA 1XVPA 3UP3A 1R1KD 5DVSA 3VHUA 3W0YA 1KNUA 1T63A 4MG8A 1OT7A 4OH6A 4DQMA 1XLSE 3K22A 4WPFA 3HVLA 4E4KA 1N83A 3K23A 3VT6A 2NW4A 2W8YA 2ACLB 1ZGYA 2ZMHA 4PP6A 4YPQA 1GWXA 5H1EA 2Q1HA 3W0HA 2AYRA 4MGBB 3GD2A 3A3ZX 3VTDA 5LWPA 3DY6A 3OZ0A 4PP5A 3WFFA 2XYJA 3AUNA 3FEIA 3KFCA 2PIPL 1XQCA 5GT4A 2ZKCA 2GPOA 1S9PA 3ADTA 3AZ3A 2YLYA 5DZ3A 2V7CA 5DZIA 4RMDA 2OVHA 3IXPD 3GWXA 3W5RA 3VRTA 5HJPB 2V0VA 3H52A 4ZNTA 1I7GA 5AVIA 2QZOB 4LSJA 5GIEA 1S0XA 3OS8C 4S14A 2ZNOA 1DB1A 1ZKYA 3VTCA 3DT3A 1NAXA 1TXIA 3FLIA 4NIEA 3ET1A 3A40X 5DU5A 5HJSA 5KCUA 3NOAA 4IW8A 1Q4XA 3V9YA 3GN8A 3B68A 3OSAA 2JFAA 2AAXA 3KMGA 2P1UA 3BEJA 5DWLA 1YJEA 2PIOA 2ZK1A 4QM0A 5FQPA 4OK1A 4BCRA 1QKUA 1X78A 3HZFA 3L0LA 4ZOMA 5DWJA 4M8EA 1PQ6A 1T79A 2GWXA 3PO9A 2NPAA 1PQCA 1X76A 5KCDA 5G45A 5DYDA 2P1TA 2YJAB 3FUGA 2G0HA 3V3QA 5KRIA 4J5WC 2Q7IA 4IW6A 5DIGA 2H77A 2J4AA 1NHZA 4ZJRA 4JAZA 4WQPA 4P6XA 2I4PA 1XDKB 2PKLA 3B0WA 3CJWA 5C4UA 3VN2A 1LV2A 3ET3A 3E7CA 3GYTA 4J24A 4OEAA 3OOFA 3O1DA 4S0TA 4ZNVA 1XQ3A 3OAPA 4OKTA 2OCFA 3N00A 2VV1A 4MG7B 4ZN9A 1FBYA 5DL4A 2OM9A 3FALA 2ZK3A 2QMVA 3HQ5A 4IV4A 4G21A 4L96A 3E00D 1T65A 3OS9A 3HC6A 2AWHA 5DIEA 1H9UA 2ZK2A 3IA6A 3R8AA 5KD9A 3UUDB 2QH6A 4F9MA 3ADWA 1Z5XU 3JZBA 4APUA 1KKQA 3CS4A 5DKGA 3OMKA 5DZHA 2YHDA 1T76A 4DMAA 4PLDA 5AVLA 1MVCA 3LMPA 5L7HA 5DXKA 5C4OA 2P4YA 1GWQA 3V4AA 3GYUA 3LBDA 3K6PA 4OEZA 3SP9A 3L0JA 5KRLA 2OAXA 5DUEA 3VHWA 4OC7A 5DY8A 4MDDA 4N73A 2YATA 3W5TA 1ZDUA 3CDPA 4CSJA 1X7BA 3B67A 5EI1A 5I4VA 4WHGA 4G2IA 1YUCA 3B5RA 3NSPA 4RUOX 3UUCA 1XPCA 2Q59B 5DUGA 4YNKA 3L3ZA 5A86A 2REWA 1I7IA 2J14A 3FC6B 5E0WA 2PIUA 2G5OA 4G20A 5DKEA 1YINA 3WJ4A 4NUFA 3VJIA 1XP6A 3ADXA 2QSEA 5DXRA 3W0JA 2XYWA 3Q95B 2QA6A 4UDDA 3U9QA 3W0AA 2IHQA 1OVLA 2NV7A 1YOKA 1G1UA 3OZJA 3OLLA 4X1FA 4ZNUA 5KYAA 5DIDA 4NB6A 4XUMA 5AAVA 3DZYA 1U3QA 1I37A 3AN3A 1NQ2A 4MGAB 1RDTA 4RUJA 4EM9A 1PCGA 5DVCA 2GL8A 3JZCA 5DRJA 5F9BA 5KRJA 1XLSA 1XVPB 2YJDA 4RZFA 1K4WA 1PZLA 1Z95A 3F5CA 1R6GA 4MG8B 5EC9A 3SZ1A 3UUAA 3VT4A 4RAKA 3VSOA 3CQVA 4FGYA 4RE8A 4MGDA 5KCFA 1U9EA 3PBAA 2AA5A 2B1ZA 3P8XA 1RJKA 5APKA 1HJ1A 1NAVA 4OH5A 4Q0AC 4REEA 1TFCA 2GIUA 4EMAA 2BAWA 4OHAA 2QABA 1UHLA 2BJ4B 4UDCA 2P1VA 1NQ7A 3OMPA 1ZUCA 5DKSA 4R06A 3UVVA 4IV2A 1R20A 5DV3A 4IWCA 2ZVTA 4G1YA 5DXBA 1L2JA 1NUOA 3KWYA 3ET2A 3BC5A 5E14A 1MV9A 1Z5XE 3AFRA 5LGAA 1FM6A 3HODA 3OMOA 1PQ9A 4IVWA 2JJ3A 5EJVA 5AYGA 2B1VA 4YT1A 4UDAA 4MG9A 3A9EB 3PCUA 4J5XC 5E0XA 3WT5A 3DZYD 4NQAB 3A2IA 3O1EA 1RDTD 1YOWA 2ZXMA 5FQVA 1PDUA 3EYBA 3DCTA 3ZRAA 5IAWA 1ZDTA 2P54A 3MNEA 5DP0A 5AK2A 5EITA 5DYBA 4XI3A 1X7JA 3X1HA 2HAMA 2I4ZA 2JFAB 1M13A 1UPWA 2ZNQA 1IE9A 4XT9A 3R5MA 1FCZA 5B41A 2AMAA 5JI0D 5DMFA 3ADUA 5C4TA 1X7EA 5DWGA 5DZ1A 5EGVA 2AA2A 2VSTA 4JYIA 5KROA 5G42A 3T03A 1T7FA 3HLVA 3QT0A 3R2AA 4A2JA 1XOWA 1XV9B 2POBA 3AN4A 2HVCA 1G5YA 4N1YA 4OILA 3VJSA 4ZI1A 2YFEA 4P6WA 2R6YA 1R20D 2AX9A 3P88A 2AMBA 5DMCA 4DM6A 3ADSA 3OOKA 4RFWA 4HLWA 3VI8A 3OMMA 2VV1B 3UU7A 4DK7A 1YMTA 2GPUA 2F4BA 3OKIA 4PVUA 3CTBA 3VT8A 4J5XA 2FVJA 2Q7KA 3M7RA 1E3GA 1R5KA 2XHSA 3K8SA 4XUHA 4B7WA 4XAOA 2O4JA 3BQDA 5SYZA 3ZQTA 4OJ9A 3L03A 2AX8A 3KMRA 5IZ0A 2ACLA 4JL4A 3ERTA 3WMHA 5APJA 1OSVA 2Q61A 3W5QA 4ZNWA 4M8HA 4NY9A 4QJRA 3HO0A 4IA7A 1RKHA 4N8RA 2EWPA 1M7WA 3H0AA 1PK5A 2ZL9A 4IS8A 4XHDA 5DLRA 2PIRA 2E2RA 2Q6SA 1RKGA 2HWRA 2ATHA 2P7ZA 4J26A 1XIUA 4Y29A 4O8FA 5DXQA 1LBDA 5HYKA 5KRAA 1G2NA 2PNUA 2ZASA 2QXMA 2ZK0A 3AUQA 4S0SA 5DX3B 2ZY0A 2JF9A 2VSRA 5DWEA 4K4JA 5L7GA 3S9SA 3G8IA 2PINA 4K6IA 4A4VA 3L3XA 4KZIA 1S0ZA 2QPYA 1ZEOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IA2 A;  1P8D A;  3WWR A;  1OVL B;  3IPU A;  3OLS A;  5JJM B;  1YA3 A;  2I0J A;  5AAV B;  4YMQ A;  3DZU A;  4IWF A;  3B0R A;  4OLM A;  4WHF A;  3GZ9 A;  3VT9 A;  4OFU A;  2ZK6 A;  3B65 A;  4E4Q A;  1E3K A;  2QA8 B;  4A4W A;  2PIV A;  2HWQ A;  3OSI A;  3F5C B;  5KYJ A;  4QE6 A;  4MGC A;  1XNN A;  3R29 A;  5DUH A;  2PIX A;  2QGT A;  1GS4 A;  2ZXN A;  5KRF A;  5FQS A;  2Q6R A;  4XLD A;  3W0I A;  3X31 A;  1QKM A;  2POG A;  4ZO1 B;  2AO6 A;  1T7T A;  5KRH A;  3R5N A;  4FN9 A;  4OAR A;  1SR7 A;  3H0A D;  3B66 A;  3AUR A;  2QW4 A;  3CWD A;  5E7V A;  4TUZ B;  1XP1 A;  4UDB A;  2G0G A;  5KCW A;  4R2U A;  1YYE A;  3AZ2 A;  1UHL B;  3MNO A;  3ILZ A;  3VRW A;  2GTK A;  2Q8S A;  3TX7 B;  1T7M A;  3UVV B;  2XKW A;  4OZT U;  5DXB B;  2B50 A;  2PJL A;  1SJ0 A;  2Q6J A;  3IMY A;  5APH A;  1K74 A;  3PLZ A;  3RY9 A;  3UUD A;  3W0G A;  3CLD A;  1IE8 A;  2ZMJ A;  3GWS X;  3A78 A;  1ZH7 A;  3FUR A;  3KBA A;  3OKH A;  4MG9 B;  2Q7J A;  4OGH A;  3DZU D;  4LBD A;  2YLO A;  2PRG A;  4ZNS A;  3GBK A;  4WVD A;  3VSP A;  1L2I A;  2ZK5 A;  4DK8 A;  3OMQ A;  1T74 A;  2ZFX A;  2HC4 A;  3WT7 A;  4PPS A;  5G43 A;  4PPP A;  2AXA A;  3TKC A;  3VTB A;  2J7Y A;  3RUU A;  4QK4 A;  5DXM A;  3ZRB A;  4QE8 A;  1XNX A;  1RK3 A;  1NDE A;  3D24 A;  3PRG A;  4G2H A;  4ONI A;  4PP3 A;  4POH A;  5CJ6 A;  4IUI A;  2ZBS A;  3B0Q A;  1NRL A;  3TY0 A;  2P7A A;  4G1Z A;  3NSQ A;  3VT5 A;  3KDU A;  4OED A;  2AX6 A;  2R40 A;  3G8O A;  3IPQ A;  4L98 A;  2QNV A;  3ERD A;  5GID A;  5AWJ A;  3WGP A;  5B5B A;  4QL8 A;  1YP0 A;  1T5Z A;  1EXX A;  3ZR7 A;  2Q3Y A;  1I38 A;  1OSH A;  3WT6 A;  1XB7 A;  2Z4B A;  3A2H A;  3D90 A;  4K7A A;  4S15 A;  4OFR A;  2B23 A;  3UU7 B;  2P15 A;  3OSW A;  2QR9 A;  2IOK A;  2O4R A;  2P7G A;  4OIU A;  5FQR A;  4E2J A;  2ZMI A;  5DSH A;  3V3E A;  4IQR A;  1N4H A;  4MG6 A;  1P93 A;  3WFG A;  3RVF A;  4OJB A;  2QGW A;  2I4J A;  4PXM A;  4TV1 A;  2Q5S A;  1SQN A;  1XAP A;  5IXK A;  4IA3 A;  3UP0 A;  1MZN A;  1G50 A;  1XP9 A;  2Q7L A;  4PF3 A;  5AZV A;  5KRM A;  1FM9 A;  1VJB A;  1FCX A;  4N5G A;  4OZT E;  4R6S A;  5DKB A;  2AX7 A;  3RLJ A;  2ZNP A;  1DKF A;  5G3J A;  4Q13 A;  1Y9R A;  5DXE A;  1FM6 D;  1S19 A;  2BJ4 A;  5GIC A;  2HAS A;  2R40 D;  2VV4 A;  2VV0 A;  3DR1 A;  3ET0 A;  3FAL B;  1Y0X X;  4CI5 A;  5JY3 A;  3AX8 A;  1A52 A;  4RZG A;  2FSZ A;  3FEJ A;  2Q5G A;  3WJ5 A;  5DRM A;  5HZC A;  3OLF A;  2J7X A;  3RLL A;  1UOM A;  2Q60 A;  2ZLC A;  2ZLA A;  3CS8 A;  4OZR U;  2YLP A;  3AZ1 A;  3A9E A;  5ACC A;  2GPP A;  2HBH A;  5DXP A;  1NQ0 A;  5M96 A;  3V9V A;  4ZN7 A;  3HM1 A;  3E00 A;  2HFP A;  1FD0 A;  2ZXZ A;  4ZJW A;  1SKX A;  3D6D A;  4JGV A;  2YLQ A;  4MGB A;  5DZ0 A;  3ADV A;  2Q1V A;  4RWV A;  5DK9 A;  5DV6 A;  1UPV A;  2PIQ A;  4RMC A;  5KRC A;  1FM9 D;  2OVM A;  2HCD A;  4FHI A;  4RUP A;  3WTQ A;  5G44 A;  4X1G A;  1PRG A;  3TKM A;  2ZNN A;  1KV6 A;  5EHJ A;  3X1I A;  1X7R A;  1BSX A;  2AB2 A;  4ZNH A;  3CS6 A;  2R6W A;  2PIT A;  4OKB A;  1ERR A;  5HJP A;  1XV9 A;  1QKN A;  3KPZ A;  3L0E A;  5FQT A;  1S9Q A;  5E19 A;  1T7R A;  2VV3 A;  2QZO A;  5C4S A;  2I0G A;  3RUT A;  2GP7 A;  1FCY A;  2GPV A;  5DV8 A;  5L7E A;  2FAI A;  4ITE A;  2XYX A;  3SP6 A;  2LBD A;  1WM0 X;  5AAU A;  5G5W A;  5JJM A;  5E1C A;  3D5F A;  4KZM A;  4MG5 A;  5DTV A;  5DWI A;  4HEE X;  4PRG A;  4PWL A;  1A28 A;  2G44 A;  3VT3 A;  1YY4 A;  3UUA B;  1N46 A;  4DOR A;  3P89 A;  2Q5P A;  1U3S A;  3HC5 A;  4MGD B;  4POJ A;  4OKW A;  1ZAF A;  2NXX A;  3OS8 A;  4LNW A;  4REF A;  3W0C A;  1NYX A;  5HYR A;  4DM8 A;  5KCT A;  3P0U A;  3PEQ A;  4IA1 A;  3FXV A;  1T73 A;  2OUZ A;  3V49 A;  3V9T A;  4WLB A;  3D57 A;  3DCU A;  4ITF A;  4KZJ A;  4JYG A;  4OEY A;  2OZ7 A;  1QKT A;  5L11 A;  3B3K A;  3W5P A;  1HG4 A;  4FNE A;  2VV2 A;  1NQ1 A;  3A2J A;  3VJH A;  1XDK A;  3E94 A;  5KCE A;  5G46 A;  4DOS A;  1YIM A;  5K13 A;  3IPS A;  4OZR E;  4MG7 A;  4OIV A;  1K7L A;  1ILG A;  3KDT A;  4Q50 A;  2H79 A;  3VHV A;  1M2Z A;  2IOG A;  3B0T A;  5DX3 A;  5E15 A;  3KMZ A;  4JYH A;  4J5W A;  2Q70 A;  4LNX A;  1XZX X;  2A3I A;  5KR9 A;  4FHH A;  1XJ7 A;  3VRU A;  5KRK A;  1R1K A;  2HAR A;  2ABI A;  2NXX E;  3B1M A;  5DXG A;  4IU7 A;  4IVY A;  3CDS A;  1U3R A;  3G9E A;  3OGT A;  5KCC A;  4LTW A;  4PLE A;  2QA8 A;  2Z4J A;  1GWR A;  3X36 A;  4G1D A;  2ZK4 A;  1Y0S A;  2AM9 A;  4TV1 B;  2Q59 A;  2QXS A;  3R8D A;  3MNP A;  3VT7 A;  3F7D A;  2QTU A;  3FC6 A;  2AA6 A;  3VJT A;  4ZO1 X;  5DVV A;  1DKF B;  1K74 D;  4TUZ A;  2HB8 A;  5ICK A;  3IXP A;  3Q95 A;  4CI4 A;  1ILH A;  2PIW A;  2QE4 A;  3KYT A;  2VV4 B;  2HB7 A;  4RZE A;  5AWK A;  2AA7 A;  3FS1 A;  3L1B A;  4XTA A;  4OJ4 A;  5ETH A;  1ERE A;  4MGA A;  5HCV A;  4OKX A;  3G0W A;  4RME A;  5AZT A;  1EXA A;  3R8I A;  3VRV A;  5DI7 A;  2O9I A;  1XVP A;  3UP3 A;  1R1K D;  5DVS A;  3VHU A;  3W0Y A;  1KNU A;  1T63 A;  4MG8 A;  1OT7 A;  4OH6 A;  4DQM A;  1XLS E;  3K22 A;  4WPF A;  3HVL A;  4E4K A;  1N83 A;  3K23 A;  3VT6 A;  2NW4 A;  2W8Y A;  2ACL B;  1ZGY A;  2ZMH A;  4PP6 A;  4YPQ A;  1GWX A;  5H1E A;  2Q1H A;  3W0H A;  2AYR A;  4MGB B;  3GD2 A;  3A3Z X;  3VTD A;  5LWP A;  3DY6 A;  3OZ0 A;  4PP5 A;  3WFF A;  2XYJ A;  3AUN A;  3FEI A;  3KFC A;  2PIP L;  1XQC A;  5GT4 A;  2ZKC A;  2GPO A;  1S9P A;  3ADT A;  3AZ3 A;  2YLY A;  5DZ3 A;  2V7C A;  5DZI A;  4RMD A;  2OVH A;  3IXP D;  3GWX A;  3W5R A;  3VRT A;  5HJP B;  2V0V A;  3H52 A;  4ZNT A;  1I7G A;  5AVI A;  2QZO B;  4LSJ A;  5GIE A;  1S0X A;  3OS8 C;  4S14 A;  2ZNO A;  1DB1 A;  1ZKY A;  3VTC A;  3DT3 A;  1NAX A;  1TXI A;  3FLI A;  4NIE A;  3ET1 A;  3A40 X;  5DU5 A;  5HJS A;  5KCU A;  3NOA A;  4IW8 A;  1Q4X A;  3V9Y A;  3GN8 A;  3B68 A;  3OSA A;  2JFA A;  2AAX A;  3KMG A;  2P1U A;  3BEJ A;  5DWL A;  1YJE A;  2PIO A;  2ZK1 A;  4QM0 A;  5FQP A;  4OK1 A;  4BCR A;  1QKU A;  1X78 A;  3HZF A;  3L0L A;  4ZOM A;  5DWJ A;  4M8E A;  1PQ6 A;  1T79 A;  2GWX A;  3PO9 A;  2NPA A;  1PQC A;  1X76 A;  5KCD A;  5G45 A;  5DYD A;  2P1T A;  2YJA B;  3FUG A;  2G0H A;  3V3Q A;  5KRI A;  4J5W C;  2Q7I A;  4IW6 A;  5DIG A;  2H77 A;  2J4A A;  1NHZ A;  4ZJR A;  4JAZ A;  4WQP A;  4P6X A;  2I4P A;  1XDK B;  2PKL A;  3B0W A;  3CJW A;  5C4U A;  3VN2 A;  1LV2 A;  3ET3 A;  3E7C A;  3GYT A;  4J24 A;  4OEA A;  3OOF A;  3O1D A;  4S0T A;  4ZNV A;  1XQ3 A;  3OAP A;  4OKT A;  2OCF A;  3N00 A;  2VV1 A;  4MG7 B;  4ZN9 A;  1FBY A;  5DL4 A;  2OM9 A;  3FAL A;  2ZK3 A;  2QMV A;  3HQ5 A;  4IV4 A;  4G21 A;  4L96 A;  3E00 D;  1T65 A;  3OS9 A;  3HC6 A;  2AWH A;  5DIE A;  1H9U A;  2ZK2 A;  3IA6 A;  3R8A A;  5KD9 A;  3UUD B;  2QH6 A;  4F9M A;  3ADW A;  1Z5X U;  3JZB A;  4APU A;  1KKQ A;  3CS4 A;  5DKG A;  3OMK A;  5DZH A;  2YHD A;  1T76 A;  4DMA A;  4PLD A;  5AVL A;  1MVC A;  3LMP A;  5L7H A;  5DXK A;  5C4O A;  2P4Y A;  1GWQ A;  3V4A A;  3GYU A;  3LBD A;  3K6P A;  4OEZ A;  3SP9 A;  3L0J A;  5KRL A;  2OAX A;  5DUE A;  3VHW A;  4OC7 A;  5DY8 A;  4MDD A;  4N73 A;  2YAT A;  3W5T A;  1ZDU A;  3CDP A;  4CSJ A;  1X7B A;  3B67 A;  5EI1 A;  5I4V A;  4WHG A;  4G2I A;  1YUC A;  3B5R A;  3NSP A;  4RUO X;  3UUC A;  1XPC A;  2Q59 B;  5DUG A;  4YNK A;  3L3Z A;  5A86 A;  2REW A;  1I7I A;  2J14 A;  3FC6 B;  5E0W A;  2PIU A;  2G5O A;  4G20 A;  5DKE A;  1YIN A;  3WJ4 A;  4NUF A;  3VJI A;  1XP6 A;  3ADX A;  2QSE A;  5DXR A;  3W0J A;  2XYW A;  3Q95 B;  2QA6 A;  4UDD A;  3U9Q A;  3W0A A;  2IHQ A;  1OVL A;  2NV7 A;  1YOK A;  1G1U A;  3OZJ A;  3OLL A;  4X1F A;  4ZNU A;  5KYA A;  5DID A;  4NB6 A;  4XUM A;  5AAV A;  3DZY A;  1U3Q A;  1I37 A;  3AN3 A;  1NQ2 A;  4MGA B;  1RDT A;  4RUJ A;  4EM9 A;  1PCG A;  5DVC A;  2GL8 A;  3JZC A;  5DRJ A;  5F9B A;  5KRJ A;  1XLS A;  1XVP B;  2YJD A;  4RZF A;  1K4W A;  1PZL A;  1Z95 A;  3F5C A;  1R6G A;  4MG8 B;  5EC9 A;  3SZ1 A;  3UUA A;  3VT4 A;  4RAK A;  3VSO A;  3CQV A;  4FGY A;  4RE8 A;  4MGD A;  5KCF A;  1U9E A;  3PBA A;  2AA5 A;  2B1Z A;  3P8X A;  1RJK A;  5APK A;  1HJ1 A;  1NAV A;  4OH5 A;  4Q0A C;  4REE A;  1TFC A;  2GIU A;  4EMA A;  2BAW A;  4OHA A;  2QAB A;  1UHL A;  2BJ4 B;  4UDC A;  2P1V A;  1NQ7 A;  3OMP A;  1ZUC A;  5DKS A;  4R06 A;  3UVV A;  4IV2 A;  1R20 A;  5DV3 A;  4IWC A;  2ZVT A;  4G1Y A;  5DXB A;  1L2J A;  1NUO A;  3KWY A;  3ET2 A;  3BC5 A;  5E14 A;  1MV9 A;  1Z5X E;  3AFR A;  5LGA A;  1FM6 A;  3HOD A;  3OMO A;  1PQ9 A;  4IVW A;  2JJ3 A;  5EJV A;  5AYG A;  2B1V A;  4YT1 A;  4UDA A;  4MG9 A;  3A9E B;  3PCU A;  4J5X C;  5E0X A;  3WT5 A;  3DZY D;  4NQA B;  3A2I A;  3O1E A;  1RDT D;  1YOW A;  2ZXM A;  5FQV A;  1PDU A;  3EYB A;  3DCT A;  3ZRA A;  5IAW A;  1ZDT A;  2P54 A;  3MNE A;  5DP0 A;  5AK2 A;  5EIT A;  5DYB A;  4XI3 A;  1X7J A;  3X1H A;  2HAM A;  2I4Z A;  2JFA B;  1M13 A;  1UPW A;  2ZNQ A;  1IE9 A;  4XT9 A;  3R5M A;  1FCZ A;  5B41 A;  2AMA A;  5JI0 D;  5DMF A;  3ADU A;  5C4T A;  1X7E A;  5DWG A;  5DZ1 A;  5EGV A;  2AA2 A;  2VST A;  4JYI A;  5KRO A;  5G42 A;  3T03 A;  1T7F A;  3HLV A;  3QT0 A;  3R2A A;  4A2J A;  1XOW A;  1XV9 B;  2POB A;  3AN4 A;  2HVC A;  1G5Y A;  4N1Y A;  4OIL A;  3VJS A;  4ZI1 A;  2YFE A;  4P6W A;  2R6Y A;  1R20 D;  2AX9 A;  3P88 A;  2AMB A;  5DMC A;  4DM6 A;  3ADS A;  3OOK A;  4RFW A;  4HLW A;  3VI8 A;  3OMM A;  2VV1 B;  3UU7 A;  4DK7 A;  1YMT A;  2GPU A;  2F4B A;  3OKI A;  4PVU A;  3CTB A;  3VT8 A;  4J5X A;  2FVJ A;  2Q7K A;  3M7R A;  1E3G A;  1R5K A;  2XHS A;  3K8S A;  4XUH A;  4B7W A;  4XAO A;  2O4J A;  3BQD A;  5SYZ A;  3ZQT A;  4OJ9 A;  3L03 A;  2AX8 A;  3KMR A;  5IZ0 A;  2ACL A;  4JL4 A;  3ERT A;  3WMH A;  5APJ A;  1OSV A;  2Q61 A;  3W5Q A;  4ZNW A;  4M8H A;  4NY9 A;  4QJR A;  3HO0 A;  4IA7 A;  1RKH A;  4N8R A;  2EWP A;  1M7W A;  3H0A A;  1PK5 A;  2ZL9 A;  4IS8 A;  4XHD A;  5DLR A;  2PIR A;  2E2R A;  2Q6S A;  1RKG A;  2HWR A;  2ATH A;  2P7Z A;  4J26 A;  1XIU A;  4Y29 A;  4O8F A;  5DXQ A;  1LBD A;  5HYK A;  5KRA A;  1G2N A;  2PNU A;  2ZAS A;  2QXM A;  2ZK0 A;  3AUQ A;  4S0S A;  5DX3 B;  2ZY0 A;  2JF9 A;  2VSR A;  5DWE A;  4K4J A;  5L7G A;  3S9S A;  3G8I A;  2PIN A;  4K6I A;  4A4V A;  3L3X A;  4KZI A;  1S0Z A;  2QPY A;  1ZEO A; 
#chains in the Genus database with same CATH topology
 4IA2 A;  1P8D A;  3WWR A;  1OVL B;  3IPU A;  3OLS A;  5JJM B;  1YA3 A;  2I0J A;  5AAV B;  4YMQ A;  3DZU A;  4IWF A;  3B0R A;  4OLM A;  4WHF A;  3GZ9 A;  3VT9 A;  4OFU A;  2ZK6 A;  3B65 A;  4E4Q A;  1E3K A;  2QA8 B;  4A4W A;  2PIV A;  2HWQ A;  3OSI A;  3F5C B;  5KYJ A;  4QE6 A;  4MGC A;  1XNN A;  3R29 A;  5DUH A;  2PIX A;  2QGT A;  1GS4 A;  2ZXN A;  5KRF A;  5FQS A;  2Q6R A;  4XLD A;  3W0I A;  3X31 A;  1QKM A;  2POG A;  4ZO1 B;  2AO6 A;  1T7T A;  5KRH A;  3R5N A;  4FN9 A;  4OAR A;  1SR7 A;  3H0A D;  3B66 A;  3AUR A;  2QW4 A;  3CWD A;  5E7V A;  4TUZ B;  1XP1 A;  4UDB A;  2G0G A;  5KCW A;  4R2U A;  1YYE A;  3AZ2 A;  1UHL B;  3MNO A;  3ILZ A;  3VRW A;  2GTK A;  2Q8S A;  3TX7 B;  1T7M A;  3UVV B;  2XKW A;  4OZT U;  5DXB B;  2B50 A;  2PJL A;  1SJ0 A;  2Q6J A;  3IMY A;  5APH A;  1K74 A;  3PLZ A;  3RY9 A;  3UUD A;  3W0G A;  3CLD A;  1IE8 A;  2ZMJ A;  3GWS X;  3A78 A;  1ZH7 A;  3FUR A;  3KBA A;  3OKH A;  4MG9 B;  2Q7J A;  4OGH A;  3DZU D;  4LBD A;  2YLO A;  2PRG A;  4ZNS A;  3GBK A;  4WVD A;  3VSP A;  1L2I A;  2ZK5 A;  4DK8 A;  3OMQ A;  1T74 A;  2ZFX A;  2HC4 A;  3WT7 A;  4PPS A;  5G43 A;  4PPP A;  2AXA A;  3TKC A;  3VTB A;  2J7Y A;  3RUU A;  4QK4 A;  5DXM A;  3ZRB A;  4QE8 A;  1XNX A;  1RK3 A;  1NDE A;  3D24 A;  3PRG A;  4G2H A;  4ONI A;  4PP3 A;  4POH A;  5CJ6 A;  4IUI A;  2ZBS A;  3B0Q A;  1NRL A;  3TY0 A;  2P7A A;  4G1Z A;  3NSQ A;  3VT5 A;  3KDU A;  4OED A;  2AX6 A;  2R40 A;  3G8O A;  3IPQ A;  4L98 A;  2QNV A;  3ERD A;  5GID A;  5AWJ A;  3WGP A;  5B5B A;  4QL8 A;  1YP0 A;  1T5Z A;  1EXX A;  3ZR7 A;  2Q3Y A;  1I38 A;  1OSH A;  3WT6 A;  1XB7 A;  2Z4B A;  3A2H A;  3D90 A;  4K7A A;  4S15 A;  4OFR A;  2B23 A;  3UU7 B;  2P15 A;  3OSW A;  2QR9 A;  2IOK A;  2O4R A;  2P7G A;  4OIU A;  5FQR A;  4E2J A;  2ZMI A;  5DSH A;  3V3E A;  4IQR A;  1N4H A;  4MG6 A;  1P93 A;  3WFG A;  3RVF A;  4OJB A;  2QGW A;  2I4J A;  4PXM A;  4TV1 A;  2Q5S A;  1SQN A;  1XAP A;  5IXK A;  4IA3 A;  3UP0 A;  1MZN A;  1G50 A;  1XP9 A;  2Q7L A;  4PF3 A;  5AZV A;  5KRM A;  1FM9 A;  1VJB A;  1FCX A;  4N5G A;  4OZT E;  4R6S A;  5DKB A;  2AX7 A;  3RLJ A;  2ZNP A;  1DKF A;  5G3J A;  4Q13 A;  1Y9R A;  5DXE A;  1FM6 D;  1S19 A;  2BJ4 A;  5GIC A;  2HAS A;  2R40 D;  2VV4 A;  2VV0 A;  3DR1 A;  3ET0 A;  3FAL B;  1Y0X X;  4CI5 A;  5JY3 A;  3AX8 A;  1A52 A;  4RZG A;  2FSZ A;  3FEJ A;  2Q5G A;  3WJ5 A;  5DRM A;  5HZC A;  3OLF A;  2J7X A;  3RLL A;  1UOM A;  2Q60 A;  2ZLC A;  2ZLA A;  3CS8 A;  4OZR U;  2YLP A;  3AZ1 A;  3A9E A;  5ACC A;  2GPP A;  2HBH A;  5DXP A;  1NQ0 A;  5M96 A;  3V9V A;  4ZN7 A;  3HM1 A;  3E00 A;  2HFP A;  1FD0 A;  2ZXZ A;  4ZJW A;  1SKX A;  3D6D A;  4JGV A;  2YLQ A;  4MGB A;  5DZ0 A;  3ADV A;  2Q1V A;  4RWV A;  5DK9 A;  5DV6 A;  1UPV A;  2PIQ A;  4RMC A;  5KRC A;  1FM9 D;  2OVM A;  2HCD A;  4FHI A;  4RUP A;  3WTQ A;  5G44 A;  4X1G A;  1PRG A;  3TKM A;  2ZNN A;  1KV6 A;  5EHJ A;  3X1I A;  1X7R A;  1BSX A;  2AB2 A;  4ZNH A;  3CS6 A;  2R6W A;  2PIT A;  4OKB A;  1ERR A;  5HJP A;  1XV9 A;  1QKN A;  3KPZ A;  3L0E A;  5FQT A;  1S9Q A;  5E19 A;  1T7R A;  2VV3 A;  2QZO A;  5C4S A;  2I0G A;  3RUT A;  2GP7 A;  1FCY A;  2GPV A;  5DV8 A;  5L7E A;  2FAI A;  4ITE A;  2XYX A;  3SP6 A;  2LBD A;  1WM0 X;  5AAU A;  5G5W A;  5JJM A;  5E1C A;  3D5F A;  4KZM A;  4MG5 A;  5DTV A;  5DWI A;  4HEE X;  4PRG A;  4PWL A;  1A28 A;  2G44 A;  3VT3 A;  1YY4 A;  3UUA B;  1N46 A;  4DOR A;  3P89 A;  2Q5P A;  1U3S A;  3HC5 A;  4MGD B;  4POJ A;  4OKW A;  1ZAF A;  2NXX A;  3OS8 A;  4LNW A;  4REF A;  3W0C A;  1NYX A;  5HYR A;  4DM8 A;  5KCT A;  3P0U A;  3PEQ A;  4IA1 A;  3FXV A;  1T73 A;  2OUZ A;  3V49 A;  3V9T A;  4WLB A;  3D57 A;  3DCU A;  4ITF A;  4KZJ A;  4JYG A;  4OEY A;  2OZ7 A;  1QKT A;  5L11 A;  3B3K A;  3W5P A;  1HG4 A;  4FNE A;  2VV2 A;  1NQ1 A;  3A2J A;  3VJH A;  1XDK A;  3E94 A;  5KCE A;  5G46 A;  4DOS A;  1YIM A;  5K13 A;  3IPS A;  4OZR E;  4MG7 A;  4OIV A;  1K7L A;  1ILG A;  3KDT A;  4Q50 A;  2H79 A;  3VHV A;  1M2Z A;  2IOG A;  3B0T A;  5DX3 A;  5E15 A;  3KMZ A;  4JYH A;  4J5W A;  2Q70 A;  4LNX A;  1XZX X;  2A3I A;  5KR9 A;  4FHH A;  1XJ7 A;  3VRU A;  5KRK A;  1R1K A;  2HAR A;  2ABI A;  2NXX E;  3B1M A;  5DXG A;  4IU7 A;  4IVY A;  3CDS A;  1U3R A;  3G9E A;  3OGT A;  5KCC A;  4LTW A;  4PLE A;  2QA8 A;  2Z4J A;  1GWR A;  3X36 A;  4G1D A;  2ZK4 A;  1Y0S A;  2AM9 A;  4TV1 B;  2Q59 A;  2QXS A;  3R8D A;  3MNP A;  3VT7 A;  3F7D A;  2QTU A;  3FC6 A;  2AA6 A;  3VJT A;  4ZO1 X;  5DVV A;  1DKF B;  1K74 D;  4TUZ A;  2HB8 A;  5ICK A;  3IXP A;  3Q95 A;  4CI4 A;  1ILH A;  2PIW A;  2QE4 A;  3KYT A;  2VV4 B;  2HB7 A;  4RZE A;  5AWK A;  2AA7 A;  3FS1 A;  3L1B A;  4XTA A;  4OJ4 A;  5ETH A;  1ERE A;  4MGA A;  5HCV A;  4OKX A;  3G0W A;  4RME A;  5AZT A;  1EXA A;  3R8I A;  3VRV A;  5DI7 A;  2O9I A;  1XVP A;  3UP3 A;  1R1K D;  5DVS A;  3VHU A;  3W0Y A;  1KNU A;  1T63 A;  4MG8 A;  1OT7 A;  4OH6 A;  4DQM A;  1XLS E;  3K22 A;  4WPF A;  3HVL A;  4E4K A;  1N83 A;  3K23 A;  3VT6 A;  2NW4 A;  2W8Y A;  2ACL B;  1ZGY A;  2ZMH A;  4PP6 A;  4YPQ A;  1GWX A;  5H1E A;  2Q1H A;  3W0H A;  2AYR A;  4MGB B;  3GD2 A;  3A3Z X;  3VTD A;  5LWP A;  3DY6 A;  3OZ0 A;  4PP5 A;  3WFF A;  2XYJ A;  3AUN A;  3FEI A;  3KFC A;  2PIP L;  1XQC A;  5GT4 A;  2ZKC A;  2GPO A;  1S9P A;  3ADT A;  3AZ3 A;  2YLY A;  5DZ3 A;  2V7C A;  5DZI A;  4RMD A;  2OVH A;  3IXP D;  3GWX A;  3W5R A;  3VRT A;  5HJP B;  2V0V A;  3H52 A;  4ZNT A;  1I7G A;  5AVI A;  2QZO B;  4LSJ A;  5GIE A;  1S0X A;  3OS8 C;  4S14 A;  2ZNO A;  1DB1 A;  1ZKY A;  3VTC A;  3DT3 A;  1NAX A;  1TXI A;  3FLI A;  4NIE A;  3ET1 A;  3A40 X;  5DU5 A;  5HJS A;  5KCU A;  3NOA A;  4IW8 A;  1Q4X A;  3V9Y A;  3GN8 A;  3B68 A;  3OSA A;  2JFA A;  2AAX A;  3KMG A;  2P1U A;  3BEJ A;  5DWL A;  1YJE A;  2PIO A;  2ZK1 A;  4QM0 A;  5FQP A;  4OK1 A;  4BCR A;  1QKU A;  1X78 A;  3HZF A;  3L0L A;  4ZOM A;  5DWJ A;  4M8E A;  1PQ6 A;  1T79 A;  2GWX A;  3PO9 A;  2NPA A;  1PQC A;  1X76 A;  5KCD A;  5G45 A;  5DYD A;  2P1T A;  2YJA B;  3FUG A;  2G0H A;  3V3Q A;  5KRI A;  4J5W C;  2Q7I A;  4IW6 A;  5DIG A;  2H77 A;  2J4A A;  1NHZ A;  4ZJR A;  4JAZ A;  4WQP A;  4P6X A;  2I4P A;  1XDK B;  2PKL A;  3B0W A;  3CJW A;  5C4U A;  3VN2 A;  1LV2 A;  3ET3 A;  3E7C A;  3GYT A;  4J24 A;  4OEA A;  3OOF A;  3O1D A;  4S0T A;  4ZNV A;  1XQ3 A;  3OAP A;  4OKT A;  2OCF A;  3N00 A;  2VV1 A;  4MG7 B;  4ZN9 A;  1FBY A;  5DL4 A;  2OM9 A;  3FAL A;  2ZK3 A;  2QMV A;  3HQ5 A;  4IV4 A;  4G21 A;  4L96 A;  3E00 D;  1T65 A;  3OS9 A;  3HC6 A;  2AWH A;  5DIE A;  1H9U A;  2ZK2 A;  3IA6 A;  3R8A A;  5KD9 A;  3UUD B;  2QH6 A;  4F9M A;  3ADW A;  1Z5X U;  3JZB A;  4APU A;  1KKQ A;  3CS4 A;  5DKG A;  3OMK A;  5DZH A;  2YHD A;  1T76 A;  4DMA A;  4PLD A;  5AVL A;  1MVC A;  3LMP A;  5L7H A;  5DXK A;  5C4O A;  2P4Y A;  1GWQ A;  3V4A A;  3GYU A;  3LBD A;  3K6P A;  4OEZ A;  3SP9 A;  3L0J A;  5KRL A;  2OAX A;  5DUE A;  3VHW A;  4OC7 A;  5DY8 A;  4MDD A;  4N73 A;  2YAT A;  3W5T A;  1ZDU A;  3CDP A;  4CSJ A;  1X7B A;  3B67 A;  5EI1 A;  5I4V A;  4WHG A;  4G2I A;  1YUC A;  3B5R A;  3NSP A;  4RUO X;  3UUC A;  1XPC A;  2Q59 B;  5DUG A;  4YNK A;  3L3Z A;  5A86 A;  2REW A;  1I7I A;  2J14 A;  3FC6 B;  5E0W A;  2PIU A;  2G5O A;  4G20 A;  5DKE A;  1YIN A;  3WJ4 A;  4NUF A;  3VJI A;  1XP6 A;  3ADX A;  2QSE A;  5DXR A;  3W0J A;  2XYW A;  3Q95 B;  2QA6 A;  4UDD A;  3U9Q A;  3W0A A;  2IHQ A;  1OVL A;  2NV7 A;  1YOK A;  1G1U A;  3OZJ A;  3OLL A;  4X1F A;  4ZNU A;  5KYA A;  5DID A;  4NB6 A;  4XUM A;  5AAV A;  3DZY A;  1U3Q A;  1I37 A;  3AN3 A;  1NQ2 A;  4MGA B;  1RDT A;  4RUJ A;  4EM9 A;  1PCG A;  5DVC A;  2GL8 A;  3JZC A;  5DRJ A;  5F9B A;  5KRJ A;  1XLS A;  1XVP B;  2YJD A;  4RZF A;  1K4W A;  1PZL A;  1Z95 A;  3F5C A;  1R6G A;  4MG8 B;  5EC9 A;  3SZ1 A;  3UUA A;  3VT4 A;  4RAK A;  3VSO A;  3CQV A;  4FGY A;  4RE8 A;  4MGD A;  5KCF A;  1U9E A;  3PBA A;  2AA5 A;  2B1Z A;  3P8X A;  1RJK A;  5APK A;  1HJ1 A;  1NAV A;  4OH5 A;  4Q0A C;  4REE A;  1TFC A;  2GIU A;  4EMA A;  2BAW A;  4OHA A;  2QAB A;  1UHL A;  2BJ4 B;  4UDC A;  2P1V A;  1NQ7 A;  3OMP A;  1ZUC A;  5DKS A;  4R06 A;  3UVV A;  4IV2 A;  1R20 A;  5DV3 A;  4IWC A;  2ZVT A;  4G1Y A;  5DXB A;  1L2J A;  1NUO A;  3KWY A;  3ET2 A;  3BC5 A;  5E14 A;  1MV9 A;  1Z5X E;  3AFR A;  5LGA A;  1FM6 A;  3HOD A;  3OMO A;  1PQ9 A;  4IVW A;  2JJ3 A;  5EJV A;  5AYG A;  2B1V A;  4YT1 A;  4UDA A;  4MG9 A;  3A9E B;  3PCU A;  4J5X C;  5E0X A;  3WT5 A;  3DZY D;  4NQA B;  3A2I A;  3O1E A;  1RDT D;  1YOW A;  2ZXM A;  5FQV A;  1PDU A;  3EYB A;  3DCT A;  3ZRA A;  5IAW A;  1ZDT A;  2P54 A;  3MNE A;  5DP0 A;  5AK2 A;  5EIT A;  5DYB A;  4XI3 A;  1X7J A;  3X1H A;  2HAM A;  2I4Z A;  2JFA B;  1M13 A;  1UPW A;  2ZNQ A;  1IE9 A;  4XT9 A;  3R5M A;  1FCZ A;  5B41 A;  2AMA A;  5JI0 D;  5DMF A;  3ADU A;  5C4T A;  1X7E A;  5DWG A;  5DZ1 A;  5EGV A;  2AA2 A;  2VST A;  4JYI A;  5KRO A;  5G42 A;  3T03 A;  1T7F A;  3HLV A;  3QT0 A;  3R2A A;  4A2J A;  1XOW A;  1XV9 B;  2POB A;  3AN4 A;  2HVC A;  1G5Y A;  4N1Y A;  4OIL A;  3VJS A;  4ZI1 A;  2YFE A;  4P6W A;  2R6Y A;  1R20 D;  2AX9 A;  3P88 A;  2AMB A;  5DMC A;  4DM6 A;  3ADS A;  3OOK A;  4RFW A;  4HLW A;  3VI8 A;  3OMM A;  2VV1 B;  3UU7 A;  4DK7 A;  1YMT A;  2GPU A;  2F4B A;  3OKI A;  4PVU A;  3CTB A;  3VT8 A;  4J5X A;  2FVJ A;  2Q7K A;  3M7R A;  1E3G A;  1R5K A;  2XHS A;  3K8S A;  4XUH A;  4B7W A;  4XAO A;  2O4J A;  3BQD A;  5SYZ A;  3ZQT A;  4OJ9 A;  3L03 A;  2AX8 A;  3KMR A;  5IZ0 A;  2ACL A;  4JL4 A;  3ERT A;  3WMH A;  5APJ A;  1OSV A;  2Q61 A;  3W5Q A;  4ZNW A;  4M8H A;  4NY9 A;  4QJR A;  3HO0 A;  4IA7 A;  1RKH A;  4N8R A;  2EWP A;  1M7W A;  3H0A A;  1PK5 A;  2ZL9 A;  4IS8 A;  4XHD A;  5DLR A;  2PIR A;  2E2R A;  2Q6S A;  1RKG A;  2HWR A;  2ATH A;  2P7Z A;  4J26 A;  1XIU A;  4Y29 A;  4O8F A;  5DXQ A;  1LBD A;  5HYK A;  5KRA A;  1G2N A;  2PNU A;  2ZAS A;  2QXM A;  2ZK0 A;  3AUQ A;  4S0S A;  5DX3 B;  2ZY0 A;  2JF9 A;  2VSR A;  5DWE A;  4K4J A;  5L7G A;  3S9S A;  3G8I A;  2PIN A;  4K6I A;  4A4V A;  3L3X A;  4KZI A;  1S0Z A;  2QPY A;  1ZEO A; 
#chains in the Genus database with same CATH homology
 4IA2 A;  1P8D A;  3WWR A;  1OVL B;  3IPU A;  3OLS A;  5JJM B;  1YA3 A;  2I0J A;  5AAV B;  4YMQ A;  3DZU A;  4IWF A;  3B0R A;  4OLM A;  4WHF A;  3GZ9 A;  3VT9 A;  4OFU A;  2ZK6 A;  3B65 A;  4E4Q A;  1E3K A;  2QA8 B;  4A4W A;  2PIV A;  2HWQ A;  3OSI A;  3F5C B;  5KYJ A;  4QE6 A;  4MGC A;  1XNN A;  3R29 A;  5DUH A;  2PIX A;  2QGT A;  1GS4 A;  2ZXN A;  5KRF A;  5FQS A;  2Q6R A;  4XLD A;  3W0I A;  3X31 A;  1QKM A;  2POG A;  4ZO1 B;  2AO6 A;  1T7T A;  5KRH A;  3R5N A;  4FN9 A;  4OAR A;  1SR7 A;  3H0A D;  3B66 A;  3AUR A;  2QW4 A;  3CWD A;  5E7V A;  4TUZ B;  1XP1 A;  4UDB A;  2G0G A;  5KCW A;  4R2U A;  1YYE A;  3AZ2 A;  1UHL B;  3MNO A;  3ILZ A;  3VRW A;  2GTK A;  2Q8S A;  3TX7 B;  1T7M A;  3UVV B;  2XKW A;  4OZT U;  5DXB B;  2B50 A;  2PJL A;  1SJ0 A;  2Q6J A;  3IMY A;  5APH A;  1K74 A;  3PLZ A;  3RY9 A;  3UUD A;  3W0G A;  3CLD A;  1IE8 A;  2ZMJ A;  3GWS X;  3A78 A;  1ZH7 A;  3FUR A;  3KBA A;  3OKH A;  4MG9 B;  2Q7J A;  4OGH A;  3DZU D;  4LBD A;  2YLO A;  2PRG A;  4ZNS A;  3GBK A;  4WVD A;  3VSP A;  1L2I A;  2ZK5 A;  4DK8 A;  3OMQ A;  1T74 A;  2ZFX A;  2HC4 A;  3WT7 A;  4PPS A;  5G43 A;  4PPP A;  2AXA A;  3TKC A;  3VTB A;  2J7Y A;  3RUU A;  4QK4 A;  5DXM A;  3ZRB A;  4QE8 A;  1XNX A;  1RK3 A;  1NDE A;  3D24 A;  3PRG A;  4G2H A;  4ONI A;  4PP3 A;  4POH A;  5CJ6 A;  4IUI A;  2ZBS A;  3B0Q A;  1NRL A;  3TY0 A;  2P7A A;  4G1Z A;  3NSQ A;  3VT5 A;  3KDU A;  4OED A;  2AX6 A;  2R40 A;  3G8O A;  3IPQ A;  4L98 A;  2QNV A;  3ERD A;  5GID A;  5AWJ A;  3WGP A;  5B5B A;  4QL8 A;  1YP0 A;  1T5Z A;  1EXX A;  3ZR7 A;  2Q3Y A;  1I38 A;  1OSH A;  3WT6 A;  1XB7 A;  2Z4B A;  3A2H A;  3D90 A;  4K7A A;  4S15 A;  4OFR A;  2B23 A;  3UU7 B;  2P15 A;  3OSW A;  2QR9 A;  2IOK A;  2O4R A;  2P7G A;  4OIU A;  5FQR A;  4E2J A;  2ZMI A;  5DSH A;  3V3E A;  4IQR A;  1N4H A;  4MG6 A;  1P93 A;  3WFG A;  3RVF A;  4OJB A;  2QGW A;  2I4J A;  4PXM A;  4TV1 A;  2Q5S A;  1SQN A;  1XAP A;  5IXK A;  4IA3 A;  3UP0 A;  1MZN A;  1G50 A;  1XP9 A;  2Q7L A;  4PF3 A;  5AZV A;  5KRM A;  1FM9 A;  1VJB A;  1FCX A;  4N5G A;  4OZT E;  4R6S A;  5DKB A;  2AX7 A;  3RLJ A;  2ZNP A;  1DKF A;  5G3J A;  4Q13 A;  1Y9R A;  5DXE A;  1FM6 D;  1S19 A;  2BJ4 A;  5GIC A;  2HAS A;  2R40 D;  2VV4 A;  2VV0 A;  3DR1 A;  3ET0 A;  3FAL B;  1Y0X X;  4CI5 A;  5JY3 A;  3AX8 A;  1A52 A;  4RZG A;  2FSZ A;  3FEJ A;  2Q5G A;  3WJ5 A;  5DRM A;  5HZC A;  3OLF A;  2J7X A;  3RLL A;  1UOM A;  2Q60 A;  2ZLC A;  2ZLA A;  3CS8 A;  4OZR U;  2YLP A;  3AZ1 A;  3A9E A;  5ACC A;  2GPP A;  2HBH A;  5DXP A;  1NQ0 A;  5M96 A;  3V9V A;  4ZN7 A;  3HM1 A;  3E00 A;  2HFP A;  1FD0 A;  2ZXZ A;  4ZJW A;  1SKX A;  3D6D A;  4JGV A;  2YLQ A;  4MGB A;  5DZ0 A;  3ADV A;  2Q1V A;  4RWV A;  5DK9 A;  5DV6 A;  1UPV A;  2PIQ A;  4RMC A;  5KRC A;  1FM9 D;  2OVM A;  2HCD A;  4FHI A;  4RUP A;  3WTQ A;  5G44 A;  4X1G A;  1PRG A;  3TKM A;  2ZNN A;  1KV6 A;  5EHJ A;  3X1I A;  1X7R A;  1BSX A;  2AB2 A;  4ZNH A;  3CS6 A;  2R6W A;  2PIT A;  4OKB A;  1ERR A;  5HJP A;  1XV9 A;  1QKN A;  3KPZ A;  3L0E A;  5FQT A;  1S9Q A;  5E19 A;  1T7R A;  2VV3 A;  2QZO A;  5C4S A;  2I0G A;  3RUT A;  2GP7 A;  1FCY A;  2GPV A;  5DV8 A;  5L7E A;  2FAI A;  4ITE A;  2XYX A;  3SP6 A;  2LBD A;  1WM0 X;  5AAU A;  5G5W A;  5JJM A;  5E1C A;  3D5F A;  4KZM A;  4MG5 A;  5DTV A;  5DWI A;  4HEE X;  4PRG A;  4PWL A;  1A28 A;  2G44 A;  3VT3 A;  1YY4 A;  3UUA B;  1N46 A;  4DOR A;  3P89 A;  2Q5P A;  1U3S A;  3HC5 A;  4MGD B;  4POJ A;  4OKW A;  1ZAF A;  2NXX A;  3OS8 A;  4LNW A;  4REF A;  3W0C A;  1NYX A;  5HYR A;  4DM8 A;  5KCT A;  3P0U A;  3PEQ A;  4IA1 A;  3FXV A;  1T73 A;  2OUZ A;  3V49 A;  3V9T A;  4WLB A;  3D57 A;  3DCU A;  4ITF A;  4KZJ A;  4JYG A;  4OEY A;  2OZ7 A;  1QKT A;  5L11 A;  3B3K A;  3W5P A;  1HG4 A;  4FNE A;  2VV2 A;  1NQ1 A;  3A2J A;  3VJH A;  1XDK A;  3E94 A;  5KCE A;  5G46 A;  4DOS A;  1YIM A;  5K13 A;  3IPS A;  4OZR E;  4MG7 A;  4OIV A;  1K7L A;  1ILG A;  3KDT A;  4Q50 A;  2H79 A;  3VHV A;  1M2Z A;  2IOG A;  3B0T A;  5DX3 A;  5E15 A;  3KMZ A;  4JYH A;  4J5W A;  2Q70 A;  4LNX A;  1XZX X;  2A3I A;  5KR9 A;  4FHH A;  1XJ7 A;  3VRU A;  5KRK A;  1R1K A;  2HAR A;  2ABI A;  2NXX E;  3B1M A;  5DXG A;  4IU7 A;  4IVY A;  3CDS A;  1U3R A;  3G9E A;  3OGT A;  5KCC A;  4LTW A;  4PLE A;  2QA8 A;  2Z4J A;  1GWR A;  3X36 A;  4G1D A;  2ZK4 A;  1Y0S A;  2AM9 A;  4TV1 B;  2Q59 A;  2QXS A;  3R8D A;  3MNP A;  3VT7 A;  3F7D A;  2QTU A;  3FC6 A;  2AA6 A;  3VJT A;  4ZO1 X;  5DVV A;  1DKF B;  1K74 D;  4TUZ A;  2HB8 A;  5ICK A;  3IXP A;  3Q95 A;  4CI4 A;  1ILH A;  2PIW A;  2QE4 A;  3KYT A;  2VV4 B;  2HB7 A;  4RZE A;  5AWK A;  2AA7 A;  3FS1 A;  3L1B A;  4XTA A;  4OJ4 A;  5ETH A;  1ERE A;  4MGA A;  5HCV A;  4OKX A;  3G0W A;  4RME A;  5AZT A;  1EXA A;  3R8I A;  3VRV A;  5DI7 A;  2O9I A;  1XVP A;  3UP3 A;  1R1K D;  5DVS A;  3VHU A;  3W0Y A;  1KNU A;  1T63 A;  4MG8 A;  1OT7 A;  4OH6 A;  4DQM A;  1XLS E;  3K22 A;  4WPF A;  3HVL A;  4E4K A;  1N83 A;  3K23 A;  3VT6 A;  2NW4 A;  2W8Y A;  2ACL B;  1ZGY A;  2ZMH A;  4PP6 A;  4YPQ A;  1GWX A;  5H1E A;  2Q1H A;  3W0H A;  2AYR A;  4MGB B;  3GD2 A;  3A3Z X;  3VTD A;  5LWP A;  3DY6 A;  3OZ0 A;  4PP5 A;  3WFF A;  2XYJ A;  3AUN A;  3FEI A;  3KFC A;  2PIP L;  1XQC A;  5GT4 A;  2ZKC A;  2GPO A;  1S9P A;  3ADT A;  3AZ3 A;  2YLY A;  5DZ3 A;  2V7C A;  5DZI A;  4RMD A;  2OVH A;  3IXP D;  3GWX A;  3W5R A;  3VRT A;  5HJP B;  2V0V A;  3H52 A;  4ZNT A;  1I7G A;  5AVI A;  2QZO B;  4LSJ A;  5GIE A;  1S0X A;  3OS8 C;  4S14 A;  2ZNO A;  1DB1 A;  1ZKY A;  3VTC A;  3DT3 A;  1NAX A;  1TXI A;  3FLI A;  4NIE A;  3ET1 A;  3A40 X;  5DU5 A;  5HJS A;  5KCU A;  3NOA A;  4IW8 A;  1Q4X A;  3V9Y A;  3GN8 A;  3B68 A;  3OSA A;  2JFA A;  2AAX A;  3KMG A;  2P1U A;  3BEJ A;  5DWL A;  1YJE A;  2PIO A;  2ZK1 A;  4QM0 A;  5FQP A;  4OK1 A;  4BCR A;  1QKU A;  1X78 A;  3HZF A;  3L0L A;  4ZOM A;  5DWJ A;  4M8E A;  1PQ6 A;  1T79 A;  2GWX A;  3PO9 A;  2NPA A;  1PQC A;  1X76 A;  5KCD A;  5G45 A;  5DYD A;  2P1T A;  2YJA B;  3FUG A;  2G0H A;  3V3Q A;  5KRI A;  4J5W C;  2Q7I A;  4IW6 A;  5DIG A;  2H77 A;  2J4A A;  1NHZ A;  4ZJR A;  4JAZ A;  4WQP A;  4P6X A;  2I4P A;  1XDK B;  2PKL A;  3B0W A;  3CJW A;  5C4U A;  3VN2 A;  1LV2 A;  3ET3 A;  3E7C A;  3GYT A;  4J24 A;  4OEA A;  3OOF A;  3O1D A;  4S0T A;  4ZNV A;  1XQ3 A;  3OAP A;  4OKT A;  2OCF A;  3N00 A;  2VV1 A;  4MG7 B;  4ZN9 A;  1FBY A;  5DL4 A;  2OM9 A;  3FAL A;  2ZK3 A;  2QMV A;  3HQ5 A;  4IV4 A;  4G21 A;  4L96 A;  3E00 D;  1T65 A;  3OS9 A;  3HC6 A;  2AWH A;  5DIE A;  1H9U A;  2ZK2 A;  3IA6 A;  3R8A A;  5KD9 A;  3UUD B;  2QH6 A;  4F9M A;  3ADW A;  1Z5X U;  3JZB A;  4APU A;  1KKQ A;  3CS4 A;  5DKG A;  3OMK A;  5DZH A;  2YHD A;  1T76 A;  4DMA A;  4PLD A;  5AVL A;  1MVC A;  3LMP A;  5L7H A;  5DXK A;  5C4O A;  2P4Y A;  1GWQ A;  3V4A A;  3GYU A;  3LBD A;  3K6P A;  4OEZ A;  3SP9 A;  3L0J A;  5KRL A;  2OAX A;  5DUE A;  3VHW A;  4OC7 A;  5DY8 A;  4MDD A;  4N73 A;  2YAT A;  3W5T A;  1ZDU A;  3CDP A;  4CSJ A;  1X7B A;  3B67 A;  5EI1 A;  5I4V A;  4WHG A;  4G2I A;  1YUC A;  3B5R A;  3NSP A;  4RUO X;  3UUC A;  1XPC A;  2Q59 B;  5DUG A;  4YNK A;  3L3Z A;  5A86 A;  2REW A;  1I7I A;  2J14 A;  3FC6 B;  5E0W A;  2PIU A;  2G5O A;  4G20 A;  5DKE A;  1YIN A;  3WJ4 A;  4NUF A;  3VJI A;  1XP6 A;  3ADX A;  2QSE A;  5DXR A;  3W0J A;  2XYW A;  3Q95 B;  2QA6 A;  4UDD A;  3U9Q A;  3W0A A;  2IHQ A;  1OVL A;  2NV7 A;  1YOK A;  1G1U A;  3OZJ A;  3OLL A;  4X1F A;  4ZNU A;  5KYA A;  5DID A;  4NB6 A;  4XUM A;  5AAV A;  3DZY A;  1U3Q A;  1I37 A;  3AN3 A;  1NQ2 A;  4MGA B;  1RDT A;  4RUJ A;  4EM9 A;  1PCG A;  5DVC A;  2GL8 A;  3JZC A;  5DRJ A;  5F9B A;  5KRJ A;  1XLS A;  1XVP B;  2YJD A;  4RZF A;  1K4W A;  1PZL A;  1Z95 A;  3F5C A;  1R6G A;  4MG8 B;  5EC9 A;  3SZ1 A;  3UUA A;  3VT4 A;  4RAK A;  3VSO A;  3CQV A;  4FGY A;  4RE8 A;  4MGD A;  5KCF A;  1U9E A;  3PBA A;  2AA5 A;  2B1Z A;  3P8X A;  1RJK A;  5APK A;  1HJ1 A;  1NAV A;  4OH5 A;  4Q0A C;  4REE A;  1TFC A;  2GIU A;  4EMA A;  2BAW A;  4OHA A;  2QAB A;  1UHL A;  2BJ4 B;  4UDC A;  2P1V A;  1NQ7 A;  3OMP A;  1ZUC A;  5DKS A;  4R06 A;  3UVV A;  4IV2 A;  1R20 A;  5DV3 A;  4IWC A;  2ZVT A;  4G1Y A;  5DXB A;  1L2J A;  1NUO A;  3KWY A;  3ET2 A;  3BC5 A;  5E14 A;  1MV9 A;  1Z5X E;  3AFR A;  5LGA A;  1FM6 A;  3HOD A;  3OMO A;  1PQ9 A;  4IVW A;  2JJ3 A;  5EJV A;  5AYG A;  2B1V A;  4YT1 A;  4UDA A;  4MG9 A;  3A9E B;  3PCU A;  4J5X C;  5E0X A;  3WT5 A;  3DZY D;  4NQA B;  3A2I A;  3O1E A;  1RDT D;  1YOW A;  2ZXM A;  5FQV A;  1PDU A;  3EYB A;  3DCT A;  3ZRA A;  5IAW A;  1ZDT A;  2P54 A;  3MNE A;  5DP0 A;  5AK2 A;  5EIT A;  5DYB A;  4XI3 A;  1X7J A;  3X1H A;  2HAM A;  2I4Z A;  2JFA B;  1M13 A;  1UPW A;  2ZNQ A;  1IE9 A;  4XT9 A;  3R5M A;  1FCZ A;  5B41 A;  2AMA A;  5JI0 D;  5DMF A;  3ADU A;  5C4T A;  1X7E A;  5DWG A;  5DZ1 A;  5EGV A;  2AA2 A;  2VST A;  4JYI A;  5KRO A;  5G42 A;  3T03 A;  1T7F A;  3HLV A;  3QT0 A;  3R2A A;  4A2J A;  1XOW A;  1XV9 B;  2POB A;  3AN4 A;  2HVC A;  1G5Y A;  4N1Y A;  4OIL A;  3VJS A;  4ZI1 A;  2YFE A;  4P6W A;  2R6Y A;  1R20 D;  2AX9 A;  3P88 A;  2AMB A;  5DMC A;  4DM6 A;  3ADS A;  3OOK A;  4RFW A;  4HLW A;  3VI8 A;  3OMM A;  2VV1 B;  3UU7 A;  4DK7 A;  1YMT A;  2GPU A;  2F4B A;  3OKI A;  4PVU A;  3CTB A;  3VT8 A;  4J5X A;  2FVJ A;  2Q7K A;  3M7R A;  1E3G A;  1R5K A;  2XHS A;  3K8S A;  4XUH A;  4B7W A;  4XAO A;  2O4J A;  3BQD A;  5SYZ A;  3ZQT A;  4OJ9 A;  3L03 A;  2AX8 A;  3KMR A;  5IZ0 A;  2ACL A;  4JL4 A;  3ERT A;  3WMH A;  5APJ A;  1OSV A;  2Q61 A;  3W5Q A;  4ZNW A;  4M8H A;  4NY9 A;  4QJR A;  3HO0 A;  4IA7 A;  1RKH A;  4N8R A;  2EWP A;  1M7W A;  3H0A A;  1PK5 A;  2ZL9 A;  4IS8 A;  4XHD A;  5DLR A;  2PIR A;  2E2R A;  2Q6S A;  1RKG A;  2HWR A;  2ATH A;  2P7Z A;  4J26 A;  1XIU A;  4Y29 A;  4O8F A;  5DXQ A;  1LBD A;  5HYK A;  5KRA A;  1G2N A;  2PNU A;  2ZAS A;  2QXM A;  2ZK0 A;  3AUQ A;  4S0S A;  5DX3 B;  2ZY0 A;  2JF9 A;  2VSR A;  5DWE A;  4K4J A;  5L7G A;  3S9S A;  3G8I A;  2PIN A;  4K6I A;  4A4V A;  3L3X A;  4KZI A;  1S0Z A;  2QPY A;  1ZEO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...