4A4WA

Ligand binding domain of human ppar gamma in complex with amorfrutin b
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
275
structure length
263
Chain Sequence
QLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKSKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Characterization of Amorfrutins Bound to the Peroxisome Proliferator-Activated Receptor Gamma.
pubmed doi rcsb
molecule keywords PEROXISOME PROLIFERATOR-ACTIVATED RECEPTOR GAMMA
molecule tags Receptor
source organism Homo sapiens
total genus 105
structure length 263
sequence length 275
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 4a4wA00
3ADTA 1EREA 2YATA 4NB6A 2Q8SA 3OSWA 3P88A 1XQCA 3V49A 4OKBA 3T03A 5DXPA 2IOKA 2Q5SA 3A9EB 1U3QA 1FM9A 3QT0A 5GIDA 3RLJA 1PDUA 4TV1B 3P0UA 3ADWA 3SP6A 2IHQA 1PQ6A 4J26A 4MG7A 3VTBA 1T63A 3W5RA 5I4VA 4OC7A 1T73A 1NYXA 4UDBA 3AN4A 3H0AA 2QGWA 1S0ZA 4IWCA 1A52A 1MZNA 4MG8B 2ZMHA 2EWPA 2J14A 1X76A 3LBDA 3SZ1A 2R6YA 3RLLA 4RFWA 2PIXA 5IXKA 1ERRA 2ZMJA 2B23A 2I0GA 4HEEX 2NV7A 4KZJA 4JYHA 4RZFA 3HO0A 5EJVA 1DKFA 1QKUA 4EM9A 1T76A 4OFUA 4QM0A 2ZFXA 1FM9D 3OS8A 5AK2A 4OZTU 3OMPA 4S0TA 3TY0A 3WJ4A 5APKA 3G8IA 1Y0SA 2GL8A 5DXKA 5SYZA 4UDDA 5KCEA 4UDCA 4ZNWA 2OCFA 3W0HA 3UUAB 3AZ3A 3RY9A 5FQVA 1R20A 2Q5GA 2VV3A 3H0AD 3OOKA 3GBKA 4LBDA 5L11A 2GWXA 5DWEA 3X36A 4OILA 4FHHA 5DZ3A 3VRVA 3DY6A 3K23A 2NXXA 2ZK0A 4MGAA 4OEZA 2Q1VA 2ZMIA 3R5MA 5DXGA 1GWXA 3FALB 4OKWA 3M7RA 5DLRA 5KCUA 4ITEA 5HJPB 5AWKA 2HB7A 1KKQA 4J24A 1X7BA 3L3ZA 4F9MA 3AX8A 1DB1A 5DRMA 2QZOA 4K7AA 1M7WA 2GPOA 2JF9A 4IVWA 3F7DA 4ZI1A 1R20D 3AUQA 3P8XA 1NQ2A 3IXPD 4PPSA 4XUMA 3KMGA 5JJMB 4ZNTA 4IA7A 2QA8A 1T7MA 3K8SA 2BJ4B 1XAPA 1FCZA 2HASA 2PINA 2Z4BA 1UOMA 4IA3A 5EHJA 3DZUA 3ERTA 4IUIA 5KR9A 5AZVA 3L1BA 2PIOA 2I4ZA 4J5XC 3UU7B 2AMBA 2LBDA 5K13A 5GICA 3OSAA 3A2JA 3ZQTA 4ZNSA 2AYRA 2YLPA 1S19A 1YMTA 2GPPA 2A3IA 1XVPB 1SKXA 2W8YA 4A4VA 2POBA 1Z95A 2HAMA 1T65A 3OS9A 1YYEA 4Q0AC 2ZASA 4LTWA 5DY8A 3PCUA 2Q7IA 3ERDA 1Z5XE 5GT4A 4N73A 1GS4A 4M8HA 3VTCA 4UDAA 3FC6A 2Q6JA 3WT5A 2XYXA 3D6DA 3GYUA 3N00A 2YJDA 3R8AA 4ZN9A 5DWJA 2AA5A 1PCGA 3DZUD 2XYWA 3ET1A 3UVVB 4DM8A 4DM6A 1YOKA 3CQVA 5KCCA 4MG5A 3VJHA 3W0CA 4E4KA 1FCYA 4RUOX 5KCWA 3ADUA 4MGDB 4OJBA 5E0XA 4IV4A 5DMFA 5DKGA 4TUZB 5DV3A 3D5FA 1X7JA 2HBHA 2PIRA 5DWIA 1K4WA 5DX3B 1ZAFA 2OVMA 3WFGA 2AXAA 2ATHA 2VSRA 4OFRA 2E2RA 3CS4A 4RWVA 2GP7A 1X7EA 1YA3A 1ZH7A 5AAVA 3ZR7A 3V9YA 2G5OA 3A3ZX 5KRHA 2QE4A 3SP9A 5ETHA 1NQ7A 5AVLA 2QPYA 2P7AA 2QXSA 5G3JA 1NDEA 2QTUA 3PO9A 1SQNA 2PIQA 3CS6A 2B1ZA 4MG9A 1QKMA 3GWSX 3W0YA 5DXEA 3OLLA 1OVLA 2HWQA 4G1ZA 5EITA 3V4AA 4OJ4A 3CS8A 4XI3A 3OMQA 5G44A 1NQ1A 2PJLA 4MG9B 2QXMA 2ZK6A 3B65A 4RZEA 5L7GA 1RDTD 3UUDA 3W5PA 3NOAA 2JFAB 4IA2A 1XV9B 2AB2A 2AA2A 3TKMA 5KRJA 1R1KD 5DKSA 3KMZA 1EXAA 4ITFA 1K7LA 1YUCA 5DXBA 3ZRAA 2I4PA 2YLOA 4J5WC 3D24A 1FBYA 5G46A 1Y9RA 4MGCA 3GD2A 1H9UA 4OK1A 3W5QA 1M13A 4Q50A 5DYBA 4CI4A 5L7EA 4MGBA 1GWRA 4PXMA 3VT3A 1QKNA 4L96A 4OLMA 5CJ6A 5DXMA 5AVIA 3W5TA 4A2JA 4IS8A 2NPAA 3JZBA 2I4JA 3TKCA 4MGBB 5DTVA 1G2NA 1U3RA 2QABA 4MG7B 5FQTA 3G8OA 2POGA 1R6GA 3A40X 4OIUA 1SR7A 2QR9A 1T79A 5G42A 4RE8A 4QE8A 1MVCA 3KDTA 5DL4A 1YJEA 3VT8A 4A4WA 4DOSA 2ZNQA 1XP1A 3B66A 1RJKA 5DK9A 2ZK2A 1E3GA 3ADSA 3Q95A 1S9PA 4MG6A 3O1EA 1E3KA 4P6WA 2QGTA 3F5CA 1NRLA 2G44A 1DKFB 4NQAB 1RKGA 1XNXA 4N5GA 4IW6A 4PVUA 4IQRA 2ZK5A 4P6XA 2ZNOA 4CSJA 3WGPA 3JZCA 4DQMA 3IXPA 5DZHA 1YIMA 2R40A 3GWXA 2QMVA 3MNEA 4XLDA 2QNVA 4WPFA 2ZXZA 2J7YA 3OOFA 4MDDA 5DXRA 5G43A 4LSJA 3V3QA 2P7GA 3EYBA 1NHZA 1Z5XU 4REFA 5DI7A 2O4JA 4XHDA 2J4AA 4PPPA 1S9QA 5FQRA 4KZMA 4O8FA 5KRAA 5IAWA 4MGAB 3UP0A 3R2AA 2ZY0A 1NAVA 3LMPA 3W0JA 1N83A 3ADVA 5EC9A 2Q7KA 5APJA 3FUGA 3OS8C 1BSXA 4NIEA 1XP6A 3D90A 3ZRBA 1OSHA 3L0EA 4XT9A 2P15A 3AN3A 2BAWA 3VT9A 4K4JA 4BCRA 3WFFA 3CJWA 4ZO1B 1LV2A 2QZOB 2Q6RA 4IV2A 4JAZA 4Q13A 3MNOA 5HZCA 2R40D 1XZXX 3B1MA 4POHA 3HODA 3KYTA 5E1CA 4QJRA 5DUGA 1YOWA 4LNWA 1T5ZA 5G45A 3ET0A 1PZLA 3VT5A 1UHLA 2QA8B 3E7CA 2GTKA 2P4YA 2ZBSA 1I38A 4JGVA 4N8RA 4ZN7A 2AMAA 1U3SA 3G0WA 4APUA 3HLVA 4ZNHA 4PF3A 4RMCA 5JI0D 5C4UA 2QW4A 3PLZA 4NUFA 2YFEA 3HM1A 3FS1A 2P1VA 2P1TA 3CDSA 4K6IA 5A86A 3B0WA 4OKTA 4RUPA 3L0LA 3VHVA 4KZIA 2PNUA 4ZO1X 5DRJA 3B5RA 5B5BA 4R06A 4OEYA 2VV4A 3VSOA 5E15A 4RUJA 5E14A 1T7TA 4OZRE 3OKHA 5F9BA 3WT6A 2O4RA 1XQ3A 2ACLA 2Q1HA 4XTAA 3OLFA 5H1EA 2ZL9A 2AWHA 3FC6B 4FNEA 4RMEA 3UP3A 2QH6A 5KRCA 3FURA 1FM6D 4DK8A 2G0HA 3GN8A 2HCDA 4LNXA 3AZ2A 4PLDA 2YLQA 1I7GA 3W0GA 1I37A 3A78A 3VT6A 3ILZA 1RK3A 3BC5A 2R6WA 5C4TA 1RDTA 3R8IA 1KV6A 3VJSA 5DZ0A 5AYGA 5ACCA 2H79A 2VV1A 3KFCA 4IWFA 4IU7A 4POJA 1R1KA 1M2ZA 2B1VA 2Z4JA 3WMHA 3IPUA 2HWRA 5KRFA 5KRLA 1G5YA 5FQSA 5AAVB 4ZOMA 3L03A 3OMMA 3PEQA 3VN2A 5KRKA 4HLWA 4RAKA 3FEJA 3E00A 4OGHA 3VJIA 5DU5A 3L0JA 4WLBA 2OAXA 1P93A 1XDKA 3BEJA 5DV8A 4G1DA 4YMQA 3CWDA 3TX7B 1HJ1A 4X1FA 2Q59A 3FXVA 1U9EA 3OGTA 1P8DA 1XJ7A 2Q70A 1OVLB 1PK5A 2P54A 5EI1A 1IE8A 5IZ0A 1ZEOA 3AUNA 3A2HA 4JYIA 2AX7A 5KYAA 5HYRA 3UUDB 2HB8A 5C4OA 2YJAB 3OZ0A 3B3KA 4OKXA 2V7CA 2PRGA 3KPZA 2AX6A 5DXBB 2OVHA 3E00D 5DX3A 5DVSA 5DZ1A 1XIUA 4DK7A 3P89A 5DWGA 2XHSA 3K22A 5B41A 3DT3A 2PIUA 3B0TA 3FLIA 2Q7LA 3O1DA 3OMKA 5HCVA 1FCXA 4YPQA 1WM0X 1TXIA 2OM9A 1Y0XX 2PIPL 2Q61A 1R5KA 2ZK1A 3IPQA 1XOWA 2HC4A 2QSEA 4OARA 4OEAA 5DVCA 1KNUA 2AA7A 4X1GA 5DV6A 5GIEA 5KROA 3CTBA 4S15A 3B0QA 5APHA 3A9EA 3V3EA 1PQCA 3FEIA 1G1UA 2ZK3A 3V9VA 4RMDA 4TV1A 1ZGYA 4N1YA 4FGYA 1GWQA 1Q4XA 4PRGA 5KRIA 3OZJA 2REWA 3RVFA 1UPVA 3UUCA 4DMAA 5LGAA 1EXXA 4WHFA 1SJ0A 1N46A 2XYJA 3AFRA 3Q95B 2I0JA 1ILGA 3ET3A 4OIVA 4MG8A 3F5CB 2ZK4A 2P1UA 2ZKCA 2YHDA 1K74A 1NAXA 1XP9A 2H77A 3HZFA 1IE9A 3R5NA 5DWLA 3WT7A 4QL8A 2Q5PA 4OEDA 2J7XA 1MV9A 5KRMA 4RZGA 4QK4A 3GZ9A 2ZVTA 2F4BA 2NW4A 2VV0A 3KWYA 3OAPA 4NY9A 4WVDA 3ADXA 3WJ5A 4Y29A 1NQ0A 2Q7JA 3VHUA 2ZLCA 1I7IA 1ILHA 4IW8A 2ZXMA 5DUHA 1LBDA 4G21A 4OZRU 2ZLAA 4PP5A 5G5WA 3UUAA 5M96A 5KCDA 1T7RA 4S14A 1ZKYA 3KBAA 2P7ZA 4XUHA 2PITA 5DUEA 5DSHA 1ZDUA 3VRWA 3W0IA 4B7WA 3OMOA 3X31A 5DKBA 4QE6A 2FSZA 5LWPA 1K74D 2QA6A 3VSPA 2AAXA 2NXXE 5EGVA 4ZJWA 3FALA 5DZIA 4JYGA 4PP3A 3BQDA 4J5XA 5HJPA 3VT7A 4G2IA 3VTDA 1HG4A 2FVJA 3VJTA 3G9EA 1NUOA 1UHLB 1RKHA 3RUTA 3KMRA 1FM6A 4PWLA 2HVCA 4ZJRA 2O9IA 3VRTA 1QKTA 2GIUA 5DKEA 5JJMA 1PQ9A 3CDPA 1XLSE 4EMAA 2V0VA 3ET2A 4JL4A 1XLSA 3VT4A 2BJ4A 1VJBA 2PIVA 2HARA 1UPWA 1X7RA 5DIGA 3V9TA 3RUUA 2AA6A 4R2UA 3H52A 2ZXNA 3UU7A 3NSPA 4OZTE 5DVVA 2B50A 3B67A 3NSQA 2VV4B 3PBAA 5C4SA 1G50A 5HYKA 2ZNNA 4OH6A 2ZNPA 1XVPA 1N4HA 1FD0A 3IPSA 2YLYA 1L2JA 2ACLB 4IA1A 4L98A 2AO6A 3U9QA 1YINA 2AX9A 1YP0A 1ZUCA 3KDUA 3A2IA 4FHIA 4ONIA 3GYTA 5FQPA 4CI5A 3X1IA 4E4QA 4REEA 3B0RA 4DORA 3VI8A 3WTQA 3E94A 2GPUA 1T74A 3B68A 3DCUA 3D57A 2Q60A 4PP6A 4R6SA 3R8DA 3UVVA 3VHWA 1OSVA 4YNKA 5DXQA 3AURA 2ABIA 1YY4A 2VSTA 1OT7A 3OSIA 2XKWA 4YT1A 2VV1B 3DR1A 2G0GA 2HFPA 2AX8A 1L2IA 2FAIA 3DCTA 4MGDA 3HQ5A 3PRGA 3R29A 4XAOA 1XB7A 2JJ3A 3IA6A 3DZYA 1A28A 3AZ1A 4TUZA 2OZ7A 5JY3A 3X1HA 3K6PA 3HC6A 1XNNA 4M8EA 4PLEA 4ZNUA 4OHAA 5DIDA 2AM9A 3S9SA 5KCTA 1X78A 5L7HA 5AAUA 3IMYA 5AZTA 3VRUA 3WWRA 1PRGA 4IVYA 3OKIA 5KYJA 1XDKB 2PKLA 3MNPA 5DIEA 2GPVA 3W0AA 4J5WA 2Q59B 2Q6SA 4G1YA 4E2JA 2PIWA 4S0SA 1T7FA 5ICKA 5DYDA 2IOGA 5E19A 4OH5A 5E7VA 4WQPA 4WHGA 1ZDTA 3CLDA 1XPCA 5DP0A 2VV2A 3OLSA 4G20A 5DMCA 2OUZA 3DZYD 5E0WA 1TFCA 1S0XA 5AWJA 5HJSA 5KD9A 2Q3YA 4FN9A 3L3XA 4ZNVA 5KCFA 4OJ9A 4G2HA 3HVLA 2JFAA 1XV9A 3HC5A
chains in the Genus database with same CATH superfamily
3ADTA 1EREA 2YATA 4NB6A 2Q8SA 3OSWA 3P88A 1XQCA 3V49A 4OKBA 3T03A 5DXPA 2IOKA 2Q5SA 3A9EB 1U3QA 1FM9A 3QT0A 5GIDA 3RLJA 1PDUA 4TV1B 3P0UA 3ADWA 3SP6A 2IHQA 1PQ6A 4J26A 4MG7A 3VTBA 1T63A 3W5RA 5I4VA 4OC7A 1T73A 1NYXA 4UDBA 3AN4A 3H0AA 2QGWA 1S0ZA 4IWCA 1A52A 1MZNA 4MG8B 2ZMHA 2EWPA 2J14A 1X76A 3LBDA 3SZ1A 2R6YA 3RLLA 4RFWA 2PIXA 5IXKA 1ERRA 2ZMJA 2B23A 2I0GA 4HEEX 2NV7A 4KZJA 4JYHA 4RZFA 3HO0A 5EJVA 1DKFA 1QKUA 4EM9A 1T76A 4OFUA 4QM0A 2ZFXA 1FM9D 3OS8A 5AK2A 4OZTU 3OMPA 4S0TA 3TY0A 3WJ4A 5APKA 3G8IA 1Y0SA 2GL8A 5DXKA 5SYZA 4UDDA 5KCEA 4UDCA 4ZNWA 2OCFA 3W0HA 3UUAB 3AZ3A 3RY9A 5FQVA 1R20A 2Q5GA 2VV3A 3H0AD 3OOKA 3GBKA 4LBDA 5L11A 2GWXA 5DWEA 3X36A 4OILA 4FHHA 5DZ3A 3VRVA 3DY6A 3K23A 2NXXA 2ZK0A 4MGAA 4OEZA 2Q1VA 2ZMIA 3R5MA 5DXGA 1GWXA 3FALB 4OKWA 3M7RA 5DLRA 5KCUA 4ITEA 5HJPB 5AWKA 2HB7A 1KKQA 4J24A 1X7BA 3L3ZA 4F9MA 3AX8A 1DB1A 5DRMA 2QZOA 4K7AA 1M7WA 2GPOA 2JF9A 4IVWA 3F7DA 4ZI1A 1R20D 3AUQA 3P8XA 1NQ2A 3IXPD 4PPSA 4XUMA 3KMGA 5JJMB 4ZNTA 4IA7A 2QA8A 1T7MA 3K8SA 2BJ4B 1XAPA 1FCZA 2HASA 2PINA 2Z4BA 1UOMA 4IA3A 5EHJA 3DZUA 3ERTA 4IUIA 5KR9A 5AZVA 3L1BA 2PIOA 2I4ZA 4J5XC 3UU7B 2AMBA 2LBDA 5K13A 5GICA 3OSAA 3A2JA 3ZQTA 4ZNSA 2AYRA 2YLPA 1S19A 1YMTA 2GPPA 2A3IA 1XVPB 1SKXA 2W8YA 4A4VA 2POBA 1Z95A 2HAMA 1T65A 3OS9A 1YYEA 4Q0AC 2ZASA 4LTWA 5DY8A 3PCUA 2Q7IA 3ERDA 1Z5XE 5GT4A 4N73A 1GS4A 4M8HA 3VTCA 4UDAA 3FC6A 2Q6JA 3WT5A 2XYXA 3D6DA 3GYUA 3N00A 2YJDA 3R8AA 4ZN9A 5DWJA 2AA5A 1PCGA 3DZUD 2XYWA 3ET1A 3UVVB 4DM8A 4DM6A 1YOKA 3CQVA 5KCCA 4MG5A 3VJHA 3W0CA 4E4KA 1FCYA 4RUOX 5KCWA 3ADUA 4MGDB 4OJBA 5E0XA 4IV4A 5DMFA 5DKGA 4TUZB 5DV3A 3D5FA 1X7JA 2HBHA 2PIRA 5DWIA 1K4WA 5DX3B 1ZAFA 2OVMA 3WFGA 2AXAA 2ATHA 2VSRA 4OFRA 2E2RA 3CS4A 4RWVA 2GP7A 1X7EA 1YA3A 1ZH7A 5AAVA 3ZR7A 3V9YA 2G5OA 3A3ZX 5KRHA 2QE4A 3SP9A 5ETHA 1NQ7A 5AVLA 2QPYA 2P7AA 2QXSA 5G3JA 1NDEA 2QTUA 3PO9A 1SQNA 2PIQA 3CS6A 2B1ZA 4MG9A 1QKMA 3GWSX 3W0YA 5DXEA 3OLLA 1OVLA 2HWQA 4G1ZA 5EITA 3V4AA 4OJ4A 3CS8A 4XI3A 3OMQA 5G44A 1NQ1A 2PJLA 4MG9B 2QXMA 2ZK6A 3B65A 4RZEA 5L7GA 1RDTD 3UUDA 3W5PA 3NOAA 2JFAB 4IA2A 1XV9B 2AB2A 2AA2A 3TKMA 5KRJA 1R1KD 5DKSA 3KMZA 1EXAA 4ITFA 1K7LA 1YUCA 5DXBA 3ZRAA 2I4PA 2YLOA 4J5WC 3D24A 1FBYA 5G46A 1Y9RA 4MGCA 3GD2A 1H9UA 4OK1A 3W5QA 1M13A 4Q50A 5DYBA 4CI4A 5L7EA 4MGBA 1GWRA 4PXMA 3VT3A 1QKNA 4L96A 4OLMA 5CJ6A 5DXMA 5AVIA 3W5TA 4A2JA 4IS8A 2NPAA 3JZBA 2I4JA 3TKCA 4MGBB 5DTVA 1G2NA 1U3RA 2QABA 4MG7B 5FQTA 3G8OA 2POGA 1R6GA 3A40X 4OIUA 1SR7A 2QR9A 1T79A 5G42A 4RE8A 4QE8A 1MVCA 3KDTA 5DL4A 1YJEA 3VT8A 4A4WA 4DOSA 2ZNQA 1XP1A 3B66A 1RJKA 5DK9A 2ZK2A 1E3GA 3ADSA 3Q95A 1S9PA 4MG6A 3O1EA 1E3KA 4P6WA 2QGTA 3F5CA 1NRLA 2G44A 1DKFB 4NQAB 1RKGA 1XNXA 4N5GA 4IW6A 4PVUA 4IQRA 2ZK5A 4P6XA 2ZNOA 4CSJA 3WGPA 3JZCA 4DQMA 3IXPA 5DZHA 1YIMA 2R40A 3GWXA 2QMVA 3MNEA 4XLDA 2QNVA 4WPFA 2ZXZA 2J7YA 3OOFA 4MDDA 5DXRA 5G43A 4LSJA 3V3QA 2P7GA 3EYBA 1NHZA 1Z5XU 4REFA 5DI7A 2O4JA 4XHDA 2J4AA 4PPPA 1S9QA 5FQRA 4KZMA 4O8FA 5KRAA 5IAWA 4MGAB 3UP0A 3R2AA 2ZY0A 1NAVA 3LMPA 3W0JA 1N83A 3ADVA 5EC9A 2Q7KA 5APJA 3FUGA 3OS8C 1BSXA 4NIEA 1XP6A 3D90A 3ZRBA 1OSHA 3L0EA 4XT9A 2P15A 3AN3A 2BAWA 3VT9A 4K4JA 4BCRA 3WFFA 3CJWA 4ZO1B 1LV2A 2QZOB 2Q6RA 4IV2A 4JAZA 4Q13A 3MNOA 5HZCA 2R40D 1XZXX 3B1MA 4POHA 3HODA 3KYTA 5E1CA 4QJRA 5DUGA 1YOWA 4LNWA 1T5ZA 5G45A 3ET0A 1PZLA 3VT5A 1UHLA 2QA8B 3E7CA 2GTKA 2P4YA 2ZBSA 1I38A 4JGVA 4N8RA 4ZN7A 2AMAA 1U3SA 3G0WA 4APUA 3HLVA 4ZNHA 4PF3A 4RMCA 5JI0D 5C4UA 2QW4A 3PLZA 4NUFA 2YFEA 3HM1A 3FS1A 2P1VA 2P1TA 3CDSA 4K6IA 5A86A 3B0WA 4OKTA 4RUPA 3L0LA 3VHVA 4KZIA 2PNUA 4ZO1X 5DRJA 3B5RA 5B5BA 4R06A 4OEYA 2VV4A 3VSOA 5E15A 4RUJA 5E14A 1T7TA 4OZRE 3OKHA 5F9BA 3WT6A 2O4RA 1XQ3A 2ACLA 2Q1HA 4XTAA 3OLFA 5H1EA 2ZL9A 2AWHA 3FC6B 4FNEA 4RMEA 3UP3A 2QH6A 5KRCA 3FURA 1FM6D 4DK8A 2G0HA 3GN8A 2HCDA 4LNXA 3AZ2A 4PLDA 2YLQA 1I7GA 3W0GA 1I37A 3A78A 3VT6A 3ILZA 1RK3A 3BC5A 2R6WA 5C4TA 1RDTA 3R8IA 1KV6A 3VJSA 5DZ0A 5AYGA 5ACCA 2H79A 2VV1A 3KFCA 4IWFA 4IU7A 4POJA 1R1KA 1M2ZA 2B1VA 2Z4JA 3WMHA 3IPUA 2HWRA 5KRFA 5KRLA 1G5YA 5FQSA 5AAVB 4ZOMA 3L03A 3OMMA 3PEQA 3VN2A 5KRKA 4HLWA 4RAKA 3FEJA 3E00A 4OGHA 3VJIA 5DU5A 3L0JA 4WLBA 2OAXA 1P93A 1XDKA 3BEJA 5DV8A 4G1DA 4YMQA 3CWDA 3TX7B 1HJ1A 4X1FA 2Q59A 3FXVA 1U9EA 3OGTA 1P8DA 1XJ7A 2Q70A 1OVLB 1PK5A 2P54A 5EI1A 1IE8A 5IZ0A 1ZEOA 3AUNA 3A2HA 4JYIA 2AX7A 5KYAA 5HYRA 3UUDB 2HB8A 5C4OA 2YJAB 3OZ0A 3B3KA 4OKXA 2V7CA 2PRGA 3KPZA 2AX6A 5DXBB 2OVHA 3E00D 5DX3A 5DVSA 5DZ1A 1XIUA 4DK7A 3P89A 5DWGA 2XHSA 3K22A 5B41A 3DT3A 2PIUA 3B0TA 3FLIA 2Q7LA 3O1DA 3OMKA 5HCVA 1FCXA 4YPQA 1WM0X 1TXIA 2OM9A 1Y0XX 2PIPL 2Q61A 1R5KA 2ZK1A 3IPQA 1XOWA 2HC4A 2QSEA 4OARA 4OEAA 5DVCA 1KNUA 2AA7A 4X1GA 5DV6A 5GIEA 5KROA 3CTBA 4S15A 3B0QA 5APHA 3A9EA 3V3EA 1PQCA 3FEIA 1G1UA 2ZK3A 3V9VA 4RMDA 4TV1A 1ZGYA 4N1YA 4FGYA 1GWQA 1Q4XA 4PRGA 5KRIA 3OZJA 2REWA 3RVFA 1UPVA 3UUCA 4DMAA 5LGAA 1EXXA 4WHFA 1SJ0A 1N46A 2XYJA 3AFRA 3Q95B 2I0JA 1ILGA 3ET3A 4OIVA 4MG8A 3F5CB 2ZK4A 2P1UA 2ZKCA 2YHDA 1K74A 1NAXA 1XP9A 2H77A 3HZFA 1IE9A 3R5NA 5DWLA 3WT7A 4QL8A 2Q5PA 4OEDA 2J7XA 1MV9A 5KRMA 4RZGA 4QK4A 3GZ9A 2ZVTA 2F4BA 2NW4A 2VV0A 3KWYA 3OAPA 4NY9A 4WVDA 3ADXA 3WJ5A 4Y29A 1NQ0A 2Q7JA 3VHUA 2ZLCA 1I7IA 1ILHA 4IW8A 2ZXMA 5DUHA 1LBDA 4G21A 4OZRU 2ZLAA 4PP5A 5G5WA 3UUAA 5M96A 5KCDA 1T7RA 4S14A 1ZKYA 3KBAA 2P7ZA 4XUHA 2PITA 5DUEA 5DSHA 1ZDUA 3VRWA 3W0IA 4B7WA 3OMOA 3X31A 5DKBA 4QE6A 2FSZA 5LWPA 1K74D 2QA6A 3VSPA 2AAXA 2NXXE 5EGVA 4ZJWA 3FALA 5DZIA 4JYGA 4PP3A 3BQDA 4J5XA 5HJPA 3VT7A 4G2IA 3VTDA 1HG4A 2FVJA 3VJTA 3G9EA 1NUOA 1UHLB 1RKHA 3RUTA 3KMRA 1FM6A 4PWLA 2HVCA 4ZJRA 2O9IA 3VRTA 1QKTA 2GIUA 5DKEA 5JJMA 1PQ9A 3CDPA 1XLSE 4EMAA 2V0VA 3ET2A 4JL4A 1XLSA 3VT4A 2BJ4A 1VJBA 2PIVA 2HARA 1UPWA 1X7RA 5DIGA 3V9TA 3RUUA 2AA6A 4R2UA 3H52A 2ZXNA 3UU7A 3NSPA 4OZTE 5DVVA 2B50A 3B67A 3NSQA 2VV4B 3PBAA 5C4SA 1G50A 5HYKA 2ZNNA 4OH6A 2ZNPA 1XVPA 1N4HA 1FD0A 3IPSA 2YLYA 1L2JA 2ACLB 4IA1A 4L98A 2AO6A 3U9QA 1YINA 2AX9A 1YP0A 1ZUCA 3KDUA 3A2IA 4FHIA 4ONIA 3GYTA 5FQPA 4CI5A 3X1IA 4E4QA 4REEA 3B0RA 4DORA 3VI8A 3WTQA 3E94A 2GPUA 1T74A 3B68A 3DCUA 3D57A 2Q60A 4PP6A 4R6SA 3R8DA 3UVVA 3VHWA 1OSVA 4YNKA 5DXQA 3AURA 2ABIA 1YY4A 2VSTA 1OT7A 3OSIA 2XKWA 4YT1A 2VV1B 3DR1A 2G0GA 2HFPA 2AX8A 1L2IA 2FAIA 3DCTA 4MGDA 3HQ5A 3PRGA 3R29A 4XAOA 1XB7A 2JJ3A 3IA6A 3DZYA 1A28A 3AZ1A 4TUZA 2OZ7A 5JY3A 3X1HA 3K6PA 3HC6A 1XNNA 4M8EA 4PLEA 4ZNUA 4OHAA 5DIDA 2AM9A 3S9SA 5KCTA 1X78A 5L7HA 5AAUA 3IMYA 5AZTA 3VRUA 3WWRA 1PRGA 4IVYA 3OKIA 5KYJA 1XDKB 2PKLA 3MNPA 5DIEA 2GPVA 3W0AA 4J5WA 2Q59B 2Q6SA 4G1YA 4E2JA 2PIWA 4S0SA 1T7FA 5ICKA 5DYDA 2IOGA 5E19A 4OH5A 5E7VA 4WQPA 4WHGA 1ZDTA 3CLDA 1XPCA 5DP0A 2VV2A 3OLSA 4G20A 5DMCA 2OUZA 3DZYD 5E0WA 1TFCA 1S0XA 5AWJA 5HJSA 5KD9A 2Q3YA 4FN9A 3L3XA 4ZNVA 5KCFA 4OJ9A 4G2HA 3HVLA 2JFAA 1XV9A 3HC5A
chains in the Genus database with same CATH topology
3ADTA 1EREA 2YATA 4NB6A 2Q8SA 3OSWA 3P88A 1XQCA 3V49A 4OKBA 3T03A 5DXPA 2IOKA 2Q5SA 3A9EB 1U3QA 1FM9A 3QT0A 5GIDA 3RLJA 1PDUA 4TV1B 3P0UA 3ADWA 3SP6A 2IHQA 1PQ6A 4J26A 4MG7A 3VTBA 1T63A 3W5RA 5I4VA 4OC7A 1T73A 1NYXA 4UDBA 3AN4A 3H0AA 2QGWA 1S0ZA 4IWCA 1A52A 1MZNA 4MG8B 2ZMHA 2EWPA 2J14A 1X76A 3LBDA 3SZ1A 2R6YA 3RLLA 4RFWA 2PIXA 5IXKA 1ERRA 2ZMJA 2B23A 2I0GA 4HEEX 2NV7A 4KZJA 4JYHA 4RZFA 3HO0A 5EJVA 1DKFA 1QKUA 4EM9A 1T76A 4OFUA 4QM0A 2ZFXA 1FM9D 3OS8A 5AK2A 4OZTU 3OMPA 4S0TA 3TY0A 3WJ4A 5APKA 3G8IA 1Y0SA 2GL8A 5DXKA 5SYZA 4UDDA 5KCEA 4UDCA 4ZNWA 2OCFA 3W0HA 3UUAB 3AZ3A 3RY9A 5FQVA 1R20A 2Q5GA 2VV3A 3H0AD 3OOKA 3GBKA 4LBDA 5L11A 2GWXA 5DWEA 3X36A 4OILA 4FHHA 5DZ3A 3VRVA 3DY6A 3K23A 2NXXA 2ZK0A 4MGAA 4OEZA 2Q1VA 2ZMIA 3R5MA 5DXGA 1GWXA 3FALB 4OKWA 3M7RA 5DLRA 5KCUA 4ITEA 5HJPB 5AWKA 2HB7A 1KKQA 4J24A 1X7BA 3L3ZA 4F9MA 3AX8A 1DB1A 5DRMA 2QZOA 4K7AA 1M7WA 2GPOA 2JF9A 4IVWA 3F7DA 4ZI1A 1R20D 3AUQA 3P8XA 1NQ2A 3IXPD 4PPSA 4XUMA 3KMGA 5JJMB 4ZNTA 4IA7A 2QA8A 1T7MA 3K8SA 2BJ4B 1XAPA 1FCZA 2HASA 2PINA 2Z4BA 1UOMA 4IA3A 5EHJA 3DZUA 3ERTA 4IUIA 5KR9A 5AZVA 3L1BA 2PIOA 2I4ZA 4J5XC 3UU7B 2AMBA 2LBDA 5K13A 5GICA 3OSAA 3A2JA 3ZQTA 4ZNSA 2AYRA 2YLPA 1S19A 1YMTA 2GPPA 2A3IA 1XVPB 1SKXA 2W8YA 4A4VA 2POBA 1Z95A 2HAMA 1T65A 3OS9A 1YYEA 4Q0AC 2ZASA 4LTWA 5DY8A 3PCUA 2Q7IA 3ERDA 1Z5XE 5GT4A 4N73A 1GS4A 4M8HA 3VTCA 4UDAA 3FC6A 2Q6JA 3WT5A 2XYXA 3D6DA 3GYUA 3N00A 2YJDA 3R8AA 4ZN9A 5DWJA 2AA5A 1PCGA 3DZUD 2XYWA 3ET1A 3UVVB 4DM8A 4DM6A 1YOKA 3CQVA 5KCCA 4MG5A 3VJHA 3W0CA 4E4KA 1FCYA 4RUOX 5KCWA 3ADUA 4MGDB 4OJBA 5E0XA 4IV4A 5DMFA 5DKGA 4TUZB 5DV3A 3D5FA 1X7JA 2HBHA 2PIRA 5DWIA 1K4WA 5DX3B 1ZAFA 2OVMA 3WFGA 2AXAA 2ATHA 2VSRA 4OFRA 2E2RA 3CS4A 4RWVA 2GP7A 1X7EA 1YA3A 1ZH7A 5AAVA 3ZR7A 3V9YA 2G5OA 3A3ZX 5KRHA 2QE4A 3SP9A 5ETHA 1NQ7A 5AVLA 2QPYA 2P7AA 2QXSA 5G3JA 1NDEA 2QTUA 3PO9A 1SQNA 2PIQA 3CS6A 2B1ZA 4MG9A 1QKMA 3GWSX 3W0YA 5DXEA 3OLLA 1OVLA 2HWQA 4G1ZA 5EITA 3V4AA 4OJ4A 3CS8A 4XI3A 3OMQA 5G44A 1NQ1A 2PJLA 4MG9B 2QXMA 2ZK6A 3B65A 4RZEA 5L7GA 1RDTD 3UUDA 3W5PA 3NOAA 2JFAB 4IA2A 1XV9B 2AB2A 2AA2A 3TKMA 5KRJA 1R1KD 5DKSA 3KMZA 1EXAA 4ITFA 1K7LA 1YUCA 5DXBA 3ZRAA 2I4PA 2YLOA 4J5WC 3D24A 1FBYA 5G46A 1Y9RA 4MGCA 3GD2A 1H9UA 4OK1A 3W5QA 1M13A 4Q50A 5DYBA 4CI4A 5L7EA 4MGBA 1GWRA 4PXMA 3VT3A 1QKNA 4L96A 4OLMA 5CJ6A 5DXMA 5AVIA 3W5TA 4A2JA 4IS8A 2NPAA 3JZBA 2I4JA 3TKCA 4MGBB 5DTVA 1G2NA 1U3RA 2QABA 4MG7B 5FQTA 3G8OA 2POGA 1R6GA 3A40X 4OIUA 1SR7A 2QR9A 1T79A 5G42A 4RE8A 4QE8A 1MVCA 3KDTA 5DL4A 1YJEA 3VT8A 4A4WA 4DOSA 2ZNQA 1XP1A 3B66A 1RJKA 5DK9A 2ZK2A 1E3GA 3ADSA 3Q95A 1S9PA 4MG6A 3O1EA 1E3KA 4P6WA 2QGTA 3F5CA 1NRLA 2G44A 1DKFB 4NQAB 1RKGA 1XNXA 4N5GA 4IW6A 4PVUA 4IQRA 2ZK5A 4P6XA 2ZNOA 4CSJA 3WGPA 3JZCA 4DQMA 3IXPA 5DZHA 1YIMA 2R40A 3GWXA 2QMVA 3MNEA 4XLDA 2QNVA 4WPFA 2ZXZA 2J7YA 3OOFA 4MDDA 5DXRA 5G43A 4LSJA 3V3QA 2P7GA 3EYBA 1NHZA 1Z5XU 4REFA 5DI7A 2O4JA 4XHDA 2J4AA 4PPPA 1S9QA 5FQRA 4KZMA 4O8FA 5KRAA 5IAWA 4MGAB 3UP0A 3R2AA 2ZY0A 1NAVA 3LMPA 3W0JA 1N83A 3ADVA 5EC9A 2Q7KA 5APJA 3FUGA 3OS8C 1BSXA 4NIEA 1XP6A 3D90A 3ZRBA 1OSHA 3L0EA 4XT9A 2P15A 3AN3A 2BAWA 3VT9A 4K4JA 4BCRA 3WFFA 3CJWA 4ZO1B 1LV2A 2QZOB 2Q6RA 4IV2A 4JAZA 4Q13A 3MNOA 5HZCA 2R40D 1XZXX 3B1MA 4POHA 3HODA 3KYTA 5E1CA 4QJRA 5DUGA 1YOWA 4LNWA 1T5ZA 5G45A 3ET0A 1PZLA 3VT5A 1UHLA 2QA8B 3E7CA 2GTKA 2P4YA 2ZBSA 1I38A 4JGVA 4N8RA 4ZN7A 2AMAA 1U3SA 3G0WA 4APUA 3HLVA 4ZNHA 4PF3A 4RMCA 5JI0D 5C4UA 2QW4A 3PLZA 4NUFA 2YFEA 3HM1A 3FS1A 2P1VA 2P1TA 3CDSA 4K6IA 5A86A 3B0WA 4OKTA 4RUPA 3L0LA 3VHVA 4KZIA 2PNUA 4ZO1X 5DRJA 3B5RA 5B5BA 4R06A 4OEYA 2VV4A 3VSOA 5E15A 4RUJA 5E14A 1T7TA 4OZRE 3OKHA 5F9BA 3WT6A 2O4RA 1XQ3A 2ACLA 2Q1HA 4XTAA 3OLFA 5H1EA 2ZL9A 2AWHA 3FC6B 4FNEA 4RMEA 3UP3A 2QH6A 5KRCA 3FURA 1FM6D 4DK8A 2G0HA 3GN8A 2HCDA 4LNXA 3AZ2A 4PLDA 2YLQA 1I7GA 3W0GA 1I37A 3A78A 3VT6A 3ILZA 1RK3A 3BC5A 2R6WA 5C4TA 1RDTA 3R8IA 1KV6A 3VJSA 5DZ0A 5AYGA 5ACCA 2H79A 2VV1A 3KFCA 4IWFA 4IU7A 4POJA 1R1KA 1M2ZA 2B1VA 2Z4JA 3WMHA 3IPUA 2HWRA 5KRFA 5KRLA 1G5YA 5FQSA 5AAVB 4ZOMA 3L03A 3OMMA 3PEQA 3VN2A 5KRKA 4HLWA 4RAKA 3FEJA 3E00A 4OGHA 3VJIA 5DU5A 3L0JA 4WLBA 2OAXA 1P93A 1XDKA 3BEJA 5DV8A 4G1DA 4YMQA 3CWDA 3TX7B 1HJ1A 4X1FA 2Q59A 3FXVA 1U9EA 3OGTA 1P8DA 1XJ7A 2Q70A 1OVLB 1PK5A 2P54A 5EI1A 1IE8A 5IZ0A 1ZEOA 3AUNA 3A2HA 4JYIA 2AX7A 5KYAA 5HYRA 3UUDB 2HB8A 5C4OA 2YJAB 3OZ0A 3B3KA 4OKXA 2V7CA 2PRGA 3KPZA 2AX6A 5DXBB 2OVHA 3E00D 5DX3A 5DVSA 5DZ1A 1XIUA 4DK7A 3P89A 5DWGA 2XHSA 3K22A 5B41A 3DT3A 2PIUA 3B0TA 3FLIA 2Q7LA 3O1DA 3OMKA 5HCVA 1FCXA 4YPQA 1WM0X 1TXIA 2OM9A 1Y0XX 2PIPL 2Q61A 1R5KA 2ZK1A 3IPQA 1XOWA 2HC4A 2QSEA 4OARA 4OEAA 5DVCA 1KNUA 2AA7A 4X1GA 5DV6A 5GIEA 5KROA 3CTBA 4S15A 3B0QA 5APHA 3A9EA 3V3EA 1PQCA 3FEIA 1G1UA 2ZK3A 3V9VA 4RMDA 4TV1A 1ZGYA 4N1YA 4FGYA 1GWQA 1Q4XA 4PRGA 5KRIA 3OZJA 2REWA 3RVFA 1UPVA 3UUCA 4DMAA 5LGAA 1EXXA 4WHFA 1SJ0A 1N46A 2XYJA 3AFRA 3Q95B 2I0JA 1ILGA 3ET3A 4OIVA 4MG8A 3F5CB 2ZK4A 2P1UA 2ZKCA 2YHDA 1K74A 1NAXA 1XP9A 2H77A 3HZFA 1IE9A 3R5NA 5DWLA 3WT7A 4QL8A 2Q5PA 4OEDA 2J7XA 1MV9A 5KRMA 4RZGA 4QK4A 3GZ9A 2ZVTA 2F4BA 2NW4A 2VV0A 3KWYA 3OAPA 4NY9A 4WVDA 3ADXA 3WJ5A 4Y29A 1NQ0A 2Q7JA 3VHUA 2ZLCA 1I7IA 1ILHA 4IW8A 2ZXMA 5DUHA 1LBDA 4G21A 4OZRU 2ZLAA 4PP5A 5G5WA 3UUAA 5M96A 5KCDA 1T7RA 4S14A 1ZKYA 3KBAA 2P7ZA 4XUHA 2PITA 5DUEA 5DSHA 1ZDUA 3VRWA 3W0IA 4B7WA 3OMOA 3X31A 5DKBA 4QE6A 2FSZA 5LWPA 1K74D 2QA6A 3VSPA 2AAXA 2NXXE 5EGVA 4ZJWA 3FALA 5DZIA 4JYGA 4PP3A 3BQDA 4J5XA 5HJPA 3VT7A 4G2IA 3VTDA 1HG4A 2FVJA 3VJTA 3G9EA 1NUOA 1UHLB 1RKHA 3RUTA 3KMRA 1FM6A 4PWLA 2HVCA 4ZJRA 2O9IA 3VRTA 1QKTA 2GIUA 5DKEA 5JJMA 1PQ9A 3CDPA 1XLSE 4EMAA 2V0VA 3ET2A 4JL4A 1XLSA 3VT4A 2BJ4A 1VJBA 2PIVA 2HARA 1UPWA 1X7RA 5DIGA 3V9TA 3RUUA 2AA6A 4R2UA 3H52A 2ZXNA 3UU7A 3NSPA 4OZTE 5DVVA 2B50A 3B67A 3NSQA 2VV4B 3PBAA 5C4SA 1G50A 5HYKA 2ZNNA 4OH6A 2ZNPA 1XVPA 1N4HA 1FD0A 3IPSA 2YLYA 1L2JA 2ACLB 4IA1A 4L98A 2AO6A 3U9QA 1YINA 2AX9A 1YP0A 1ZUCA 3KDUA 3A2IA 4FHIA 4ONIA 3GYTA 5FQPA 4CI5A 3X1IA 4E4QA 4REEA 3B0RA 4DORA 3VI8A 3WTQA 3E94A 2GPUA 1T74A 3B68A 3DCUA 3D57A 2Q60A 4PP6A 4R6SA 3R8DA 3UVVA 3VHWA 1OSVA 4YNKA 5DXQA 3AURA 2ABIA 1YY4A 2VSTA 1OT7A 3OSIA 2XKWA 4YT1A 2VV1B 3DR1A 2G0GA 2HFPA 2AX8A 1L2IA 2FAIA 3DCTA 4MGDA 3HQ5A 3PRGA 3R29A 4XAOA 1XB7A 2JJ3A 3IA6A 3DZYA 1A28A 3AZ1A 4TUZA 2OZ7A 5JY3A 3X1HA 3K6PA 3HC6A 1XNNA 4M8EA 4PLEA 4ZNUA 4OHAA 5DIDA 2AM9A 3S9SA 5KCTA 1X78A 5L7HA 5AAUA 3IMYA 5AZTA 3VRUA 3WWRA 1PRGA 4IVYA 3OKIA 5KYJA 1XDKB 2PKLA 3MNPA 5DIEA 2GPVA 3W0AA 4J5WA 2Q59B 2Q6SA 4G1YA 4E2JA 2PIWA 4S0SA 1T7FA 5ICKA 5DYDA 2IOGA 5E19A 4OH5A 5E7VA 4WQPA 4WHGA 1ZDTA 3CLDA 1XPCA 5DP0A 2VV2A 3OLSA 4G20A 5DMCA 2OUZA 3DZYD 5E0WA 1TFCA 1S0XA 5AWJA 5HJSA 5KD9A 2Q3YA 4FN9A 3L3XA 4ZNVA 5KCFA 4OJ9A 4G2HA 3HVLA 2JFAA 1XV9A 3HC5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ADT A;  1ERE A;  2YAT A;  4NB6 A;  2Q8S A;  3OSW A;  3P88 A;  1XQC A;  3V49 A;  4OKB A;  3T03 A;  5DXP A;  2IOK A;  2Q5S A;  3A9E B;  1U3Q A;  1FM9 A;  3QT0 A;  5GID A;  3RLJ A;  1PDU A;  4TV1 B;  3P0U A;  3ADW A;  3SP6 A;  2IHQ A;  1PQ6 A;  4J26 A;  4MG7 A;  3VTB A;  1T63 A;  3W5R A;  5I4V A;  4OC7 A;  1T73 A;  1NYX A;  4UDB A;  3AN4 A;  3H0A A;  2QGW A;  1S0Z A;  4IWC A;  1A52 A;  1MZN A;  4MG8 B;  2ZMH A;  2EWP A;  2J14 A;  1X76 A;  3LBD A;  3SZ1 A;  2R6Y A;  3RLL A;  4RFW A;  2PIX A;  5IXK A;  1ERR A;  2ZMJ A;  2B23 A;  2I0G A;  4HEE X;  2NV7 A;  4KZJ A;  4JYH A;  4RZF A;  3HO0 A;  5EJV A;  1DKF A;  1QKU A;  4EM9 A;  1T76 A;  4OFU A;  4QM0 A;  2ZFX A;  1FM9 D;  3OS8 A;  5AK2 A;  4OZT U;  3OMP A;  4S0T A;  3TY0 A;  3WJ4 A;  5APK A;  3G8I A;  1Y0S A;  2GL8 A;  5DXK A;  5SYZ A;  4UDD A;  5KCE A;  4UDC A;  4ZNW A;  2OCF A;  3W0H A;  3UUA B;  3AZ3 A;  3RY9 A;  5FQV A;  1R20 A;  2Q5G A;  2VV3 A;  3H0A D;  3OOK A;  3GBK A;  4LBD A;  5L11 A;  2GWX A;  5DWE A;  3X36 A;  4OIL A;  4FHH A;  5DZ3 A;  3VRV A;  3DY6 A;  3K23 A;  2NXX A;  2ZK0 A;  4MGA A;  4OEZ A;  2Q1V A;  2ZMI A;  3R5M A;  5DXG A;  1GWX A;  3FAL B;  4OKW A;  3M7R A;  5DLR A;  5KCU A;  4ITE A;  5HJP B;  5AWK A;  2HB7 A;  1KKQ A;  4J24 A;  1X7B A;  3L3Z A;  4F9M A;  3AX8 A;  1DB1 A;  5DRM A;  2QZO A;  4K7A A;  1M7W A;  2GPO A;  2JF9 A;  4IVW A;  3F7D A;  4ZI1 A;  1R20 D;  3AUQ A;  3P8X A;  1NQ2 A;  3IXP D;  4PPS A;  4XUM A;  3KMG A;  5JJM B;  4ZNT A;  4IA7 A;  2QA8 A;  1T7M A;  3K8S A;  2BJ4 B;  1XAP A;  1FCZ A;  2HAS A;  2PIN A;  2Z4B A;  1UOM A;  4IA3 A;  5EHJ A;  3DZU A;  3ERT A;  4IUI A;  5KR9 A;  5AZV A;  3L1B A;  2PIO A;  2I4Z A;  4J5X C;  3UU7 B;  2AMB A;  2LBD A;  5K13 A;  5GIC A;  3OSA A;  3A2J A;  3ZQT A;  4ZNS A;  2AYR A;  2YLP A;  1S19 A;  1YMT A;  2GPP A;  2A3I A;  1XVP B;  1SKX A;  2W8Y A;  4A4V A;  2POB A;  1Z95 A;  2HAM A;  1T65 A;  3OS9 A;  1YYE A;  4Q0A C;  2ZAS A;  4LTW A;  5DY8 A;  3PCU A;  2Q7I A;  3ERD A;  1Z5X E;  5GT4 A;  4N73 A;  1GS4 A;  4M8H A;  3VTC A;  4UDA A;  3FC6 A;  2Q6J A;  3WT5 A;  2XYX A;  3D6D A;  3GYU A;  3N00 A;  2YJD A;  3R8A A;  4ZN9 A;  5DWJ A;  2AA5 A;  1PCG A;  3DZU D;  2XYW A;  3ET1 A;  3UVV B;  4DM8 A;  4DM6 A;  1YOK A;  3CQV A;  5KCC A;  4MG5 A;  3VJH A;  3W0C A;  4E4K A;  1FCY A;  4RUO X;  5KCW A;  3ADU A;  4MGD B;  4OJB A;  5E0X A;  4IV4 A;  5DMF A;  5DKG A;  4TUZ B;  5DV3 A;  3D5F A;  1X7J A;  2HBH A;  2PIR A;  5DWI A;  1K4W A;  5DX3 B;  1ZAF A;  2OVM A;  3WFG A;  2AXA A;  2ATH A;  2VSR A;  4OFR A;  2E2R A;  3CS4 A;  4RWV A;  2GP7 A;  1X7E A;  1YA3 A;  1ZH7 A;  5AAV A;  3ZR7 A;  3V9Y A;  2G5O A;  3A3Z X;  5KRH A;  2QE4 A;  3SP9 A;  5ETH A;  1NQ7 A;  5AVL A;  2QPY A;  2P7A A;  2QXS A;  5G3J A;  1NDE A;  2QTU A;  3PO9 A;  1SQN A;  2PIQ A;  3CS6 A;  2B1Z A;  4MG9 A;  1QKM A;  3GWS X;  3W0Y A;  5DXE A;  3OLL A;  1OVL A;  2HWQ A;  4G1Z A;  5EIT A;  3V4A A;  4OJ4 A;  3CS8 A;  4XI3 A;  3OMQ A;  5G44 A;  1NQ1 A;  2PJL A;  4MG9 B;  2QXM A;  2ZK6 A;  3B65 A;  4RZE A;  5L7G A;  1RDT D;  3UUD A;  3W5P A;  3NOA A;  2JFA B;  4IA2 A;  1XV9 B;  2AB2 A;  2AA2 A;  3TKM A;  5KRJ A;  1R1K D;  5DKS A;  3KMZ A;  1EXA A;  4ITF A;  1K7L A;  1YUC A;  5DXB A;  3ZRA A;  2I4P A;  2YLO A;  4J5W C;  3D24 A;  1FBY A;  5G46 A;  1Y9R A;  4MGC A;  3GD2 A;  1H9U A;  4OK1 A;  3W5Q A;  1M13 A;  4Q50 A;  5DYB A;  4CI4 A;  5L7E A;  4MGB A;  1GWR A;  4PXM A;  3VT3 A;  1QKN A;  4L96 A;  4OLM A;  5CJ6 A;  5DXM A;  5AVI A;  3W5T A;  4A2J A;  4IS8 A;  2NPA A;  3JZB A;  2I4J A;  3TKC A;  4MGB B;  5DTV A;  1G2N A;  1U3R A;  2QAB A;  4MG7 B;  5FQT A;  3G8O A;  2POG A;  1R6G A;  3A40 X;  4OIU A;  1SR7 A;  2QR9 A;  1T79 A;  5G42 A;  4RE8 A;  4QE8 A;  1MVC A;  3KDT A;  5DL4 A;  1YJE A;  3VT8 A;  4A4W A;  4DOS A;  2ZNQ A;  1XP1 A;  3B66 A;  1RJK A;  5DK9 A;  2ZK2 A;  1E3G A;  3ADS A;  3Q95 A;  1S9P A;  4MG6 A;  3O1E A;  1E3K A;  4P6W A;  2QGT A;  3F5C A;  1NRL A;  2G44 A;  1DKF B;  4NQA B;  1RKG A;  1XNX A;  4N5G A;  4IW6 A;  4PVU A;  4IQR A;  2ZK5 A;  4P6X A;  2ZNO A;  4CSJ A;  3WGP A;  3JZC A;  4DQM A;  3IXP A;  5DZH A;  1YIM A;  2R40 A;  3GWX A;  2QMV A;  3MNE A;  4XLD A;  2QNV A;  4WPF A;  2ZXZ A;  2J7Y A;  3OOF A;  4MDD A;  5DXR A;  5G43 A;  4LSJ A;  3V3Q A;  2P7G A;  3EYB A;  1NHZ A;  1Z5X U;  4REF A;  5DI7 A;  2O4J A;  4XHD A;  2J4A A;  4PPP A;  1S9Q A;  5FQR A;  4KZM A;  4O8F A;  5KRA A;  5IAW A;  4MGA B;  3UP0 A;  3R2A A;  2ZY0 A;  1NAV A;  3LMP A;  3W0J A;  1N83 A;  3ADV A;  5EC9 A;  2Q7K A;  5APJ A;  3FUG A;  3OS8 C;  1BSX A;  4NIE A;  1XP6 A;  3D90 A;  3ZRB A;  1OSH A;  3L0E A;  4XT9 A;  2P15 A;  3AN3 A;  2BAW A;  3VT9 A;  4K4J A;  4BCR A;  3WFF A;  3CJW A;  4ZO1 B;  1LV2 A;  2QZO B;  2Q6R A;  4IV2 A;  4JAZ A;  4Q13 A;  3MNO A;  5HZC A;  2R40 D;  1XZX X;  3B1M A;  4POH A;  3HOD A;  3KYT A;  5E1C A;  4QJR A;  5DUG A;  1YOW A;  4LNW A;  1T5Z A;  5G45 A;  3ET0 A;  1PZL A;  3VT5 A;  1UHL A;  2QA8 B;  3E7C A;  2GTK A;  2P4Y A;  2ZBS A;  1I38 A;  4JGV A;  4N8R A;  4ZN7 A;  2AMA A;  1U3S A;  3G0W A;  4APU A;  3HLV A;  4ZNH A;  4PF3 A;  4RMC A;  5JI0 D;  5C4U A;  2QW4 A;  3PLZ A;  4NUF A;  2YFE A;  3HM1 A;  3FS1 A;  2P1V A;  2P1T A;  3CDS A;  4K6I A;  5A86 A;  3B0W A;  4OKT A;  4RUP A;  3L0L A;  3VHV A;  4KZI A;  2PNU A;  4ZO1 X;  5DRJ A;  3B5R A;  5B5B A;  4R06 A;  4OEY A;  2VV4 A;  3VSO A;  5E15 A;  4RUJ A;  5E14 A;  1T7T A;  4OZR E;  3OKH A;  5F9B A;  3WT6 A;  2O4R A;  1XQ3 A;  2ACL A;  2Q1H A;  4XTA A;  3OLF A;  5H1E A;  2ZL9 A;  2AWH A;  3FC6 B;  4FNE A;  4RME A;  3UP3 A;  2QH6 A;  5KRC A;  3FUR A;  1FM6 D;  4DK8 A;  2G0H A;  3GN8 A;  2HCD A;  4LNX A;  3AZ2 A;  4PLD A;  2YLQ A;  1I7G A;  3W0G A;  1I37 A;  3A78 A;  3VT6 A;  3ILZ A;  1RK3 A;  3BC5 A;  2R6W A;  5C4T A;  1RDT A;  3R8I A;  1KV6 A;  3VJS A;  5DZ0 A;  5AYG A;  5ACC A;  2H79 A;  2VV1 A;  3KFC A;  4IWF A;  4IU7 A;  4POJ A;  1R1K A;  1M2Z A;  2B1V A;  2Z4J A;  3WMH A;  3IPU A;  2HWR A;  5KRF A;  5KRL A;  1G5Y A;  5FQS A;  5AAV B;  4ZOM A;  3L03 A;  3OMM A;  3PEQ A;  3VN2 A;  5KRK A;  4HLW A;  4RAK A;  3FEJ A;  3E00 A;  4OGH A;  3VJI A;  5DU5 A;  3L0J A;  4WLB A;  2OAX A;  1P93 A;  1XDK A;  3BEJ A;  5DV8 A;  4G1D A;  4YMQ A;  3CWD A;  3TX7 B;  1HJ1 A;  4X1F A;  2Q59 A;  3FXV A;  1U9E A;  3OGT A;  1P8D A;  1XJ7 A;  2Q70 A;  1OVL B;  1PK5 A;  2P54 A;  5EI1 A;  1IE8 A;  5IZ0 A;  1ZEO A;  3AUN A;  3A2H A;  4JYI A;  2AX7 A;  5KYA A;  5HYR A;  3UUD B;  2HB8 A;  5C4O A;  2YJA B;  3OZ0 A;  3B3K A;  4OKX A;  2V7C A;  2PRG A;  3KPZ A;  2AX6 A;  5DXB B;  2OVH A;  3E00 D;  5DX3 A;  5DVS A;  5DZ1 A;  1XIU A;  4DK7 A;  3P89 A;  5DWG A;  2XHS A;  3K22 A;  5B41 A;  3DT3 A;  2PIU A;  3B0T A;  3FLI A;  2Q7L A;  3O1D A;  3OMK A;  5HCV A;  1FCX A;  4YPQ A;  1WM0 X;  1TXI A;  2OM9 A;  1Y0X X;  2PIP L;  2Q61 A;  1R5K A;  2ZK1 A;  3IPQ A;  1XOW A;  2HC4 A;  2QSE A;  4OAR A;  4OEA A;  5DVC A;  1KNU A;  2AA7 A;  4X1G A;  5DV6 A;  5GIE A;  5KRO A;  3CTB A;  4S15 A;  3B0Q A;  5APH A;  3A9E A;  3V3E A;  1PQC A;  3FEI A;  1G1U A;  2ZK3 A;  3V9V A;  4RMD A;  4TV1 A;  1ZGY A;  4N1Y A;  4FGY A;  1GWQ A;  1Q4X A;  4PRG A;  5KRI A;  3OZJ A;  2REW A;  3RVF A;  1UPV A;  3UUC A;  4DMA A;  5LGA A;  1EXX A;  4WHF A;  1SJ0 A;  1N46 A;  2XYJ A;  3AFR A;  3Q95 B;  2I0J A;  1ILG A;  3ET3 A;  4OIV A;  4MG8 A;  3F5C B;  2ZK4 A;  2P1U A;  2ZKC A;  2YHD A;  1K74 A;  1NAX A;  1XP9 A;  2H77 A;  3HZF A;  1IE9 A;  3R5N A;  5DWL A;  3WT7 A;  4QL8 A;  2Q5P A;  4OED A;  2J7X A;  1MV9 A;  5KRM A;  4RZG A;  4QK4 A;  3GZ9 A;  2ZVT A;  2F4B A;  2NW4 A;  2VV0 A;  3KWY A;  3OAP A;  4NY9 A;  4WVD A;  3ADX A;  3WJ5 A;  4Y29 A;  1NQ0 A;  2Q7J A;  3VHU A;  2ZLC A;  1I7I A;  1ILH A;  4IW8 A;  2ZXM A;  5DUH A;  1LBD A;  4G21 A;  4OZR U;  2ZLA A;  4PP5 A;  5G5W A;  3UUA A;  5M96 A;  5KCD A;  1T7R A;  4S14 A;  1ZKY A;  3KBA A;  2P7Z A;  4XUH A;  2PIT A;  5DUE A;  5DSH A;  1ZDU A;  3VRW A;  3W0I A;  4B7W A;  3OMO A;  3X31 A;  5DKB A;  4QE6 A;  2FSZ A;  5LWP A;  1K74 D;  2QA6 A;  3VSP A;  2AAX A;  2NXX E;  5EGV A;  4ZJW A;  3FAL A;  5DZI A;  4JYG A;  4PP3 A;  3BQD A;  4J5X A;  5HJP A;  3VT7 A;  4G2I A;  3VTD A;  1HG4 A;  2FVJ A;  3VJT A;  3G9E A;  1NUO A;  1UHL B;  1RKH A;  3RUT A;  3KMR A;  1FM6 A;  4PWL A;  2HVC A;  4ZJR A;  2O9I A;  3VRT A;  1QKT A;  2GIU A;  5DKE A;  5JJM A;  1PQ9 A;  3CDP A;  1XLS E;  4EMA A;  2V0V A;  3ET2 A;  4JL4 A;  1XLS A;  3VT4 A;  2BJ4 A;  1VJB A;  2PIV A;  2HAR A;  1UPW A;  1X7R A;  5DIG A;  3V9T A;  3RUU A;  2AA6 A;  4R2U A;  3H52 A;  2ZXN A;  3UU7 A;  3NSP A;  4OZT E;  5DVV A;  2B50 A;  3B67 A;  3NSQ A;  2VV4 B;  3PBA A;  5C4S A;  1G50 A;  5HYK A;  2ZNN A;  4OH6 A;  2ZNP A;  1XVP A;  1N4H A;  1FD0 A;  3IPS A;  2YLY A;  1L2J A;  2ACL B;  4IA1 A;  4L98 A;  2AO6 A;  3U9Q A;  1YIN A;  2AX9 A;  1YP0 A;  1ZUC A;  3KDU A;  3A2I A;  4FHI A;  4ONI A;  3GYT A;  5FQP A;  4CI5 A;  3X1I A;  4E4Q A;  4REE A;  3B0R A;  4DOR A;  3VI8 A;  3WTQ A;  3E94 A;  2GPU A;  1T74 A;  3B68 A;  3DCU A;  3D57 A;  2Q60 A;  4PP6 A;  4R6S A;  3R8D A;  3UVV A;  3VHW A;  1OSV A;  4YNK A;  5DXQ A;  3AUR A;  2ABI A;  1YY4 A;  2VST A;  1OT7 A;  3OSI A;  2XKW A;  4YT1 A;  2VV1 B;  3DR1 A;  2G0G A;  2HFP A;  2AX8 A;  1L2I A;  2FAI A;  3DCT A;  4MGD A;  3HQ5 A;  3PRG A;  3R29 A;  4XAO A;  1XB7 A;  2JJ3 A;  3IA6 A;  3DZY A;  1A28 A;  3AZ1 A;  4TUZ A;  2OZ7 A;  5JY3 A;  3X1H A;  3K6P A;  3HC6 A;  1XNN A;  4M8E A;  4PLE A;  4ZNU A;  4OHA A;  5DID A;  2AM9 A;  3S9S A;  5KCT A;  1X78 A;  5L7H A;  5AAU A;  3IMY A;  5AZT A;  3VRU A;  3WWR A;  1PRG A;  4IVY A;  3OKI A;  5KYJ A;  1XDK B;  2PKL A;  3MNP A;  5DIE A;  2GPV A;  3W0A A;  4J5W A;  2Q59 B;  2Q6S A;  4G1Y A;  4E2J A;  2PIW A;  4S0S A;  1T7F A;  5ICK A;  5DYD A;  2IOG A;  5E19 A;  4OH5 A;  5E7V A;  4WQP A;  4WHG A;  1ZDT A;  3CLD A;  1XPC A;  5DP0 A;  2VV2 A;  3OLS A;  4G20 A;  5DMC A;  2OUZ A;  3DZY D;  5E0W A;  1TFC A;  1S0X A;  5AWJ A;  5HJS A;  5KD9 A;  2Q3Y A;  4FN9 A;  3L3X A;  4ZNV A;  5KCF A;  4OJ9 A;  4G2H A;  3HVL A;  2JFA A;  1XV9 A;  3HC5 A; 
#chains in the Genus database with same CATH topology
 3ADT A;  1ERE A;  2YAT A;  4NB6 A;  2Q8S A;  3OSW A;  3P88 A;  1XQC A;  3V49 A;  4OKB A;  3T03 A;  5DXP A;  2IOK A;  2Q5S A;  3A9E B;  1U3Q A;  1FM9 A;  3QT0 A;  5GID A;  3RLJ A;  1PDU A;  4TV1 B;  3P0U A;  3ADW A;  3SP6 A;  2IHQ A;  1PQ6 A;  4J26 A;  4MG7 A;  3VTB A;  1T63 A;  3W5R A;  5I4V A;  4OC7 A;  1T73 A;  1NYX A;  4UDB A;  3AN4 A;  3H0A A;  2QGW A;  1S0Z A;  4IWC A;  1A52 A;  1MZN A;  4MG8 B;  2ZMH A;  2EWP A;  2J14 A;  1X76 A;  3LBD A;  3SZ1 A;  2R6Y A;  3RLL A;  4RFW A;  2PIX A;  5IXK A;  1ERR A;  2ZMJ A;  2B23 A;  2I0G A;  4HEE X;  2NV7 A;  4KZJ A;  4JYH A;  4RZF A;  3HO0 A;  5EJV A;  1DKF A;  1QKU A;  4EM9 A;  1T76 A;  4OFU A;  4QM0 A;  2ZFX A;  1FM9 D;  3OS8 A;  5AK2 A;  4OZT U;  3OMP A;  4S0T A;  3TY0 A;  3WJ4 A;  5APK A;  3G8I A;  1Y0S A;  2GL8 A;  5DXK A;  5SYZ A;  4UDD A;  5KCE A;  4UDC A;  4ZNW A;  2OCF A;  3W0H A;  3UUA B;  3AZ3 A;  3RY9 A;  5FQV A;  1R20 A;  2Q5G A;  2VV3 A;  3H0A D;  3OOK A;  3GBK A;  4LBD A;  5L11 A;  2GWX A;  5DWE A;  3X36 A;  4OIL A;  4FHH A;  5DZ3 A;  3VRV A;  3DY6 A;  3K23 A;  2NXX A;  2ZK0 A;  4MGA A;  4OEZ A;  2Q1V A;  2ZMI A;  3R5M A;  5DXG A;  1GWX A;  3FAL B;  4OKW A;  3M7R A;  5DLR A;  5KCU A;  4ITE A;  5HJP B;  5AWK A;  2HB7 A;  1KKQ A;  4J24 A;  1X7B A;  3L3Z A;  4F9M A;  3AX8 A;  1DB1 A;  5DRM A;  2QZO A;  4K7A A;  1M7W A;  2GPO A;  2JF9 A;  4IVW A;  3F7D A;  4ZI1 A;  1R20 D;  3AUQ A;  3P8X A;  1NQ2 A;  3IXP D;  4PPS A;  4XUM A;  3KMG A;  5JJM B;  4ZNT A;  4IA7 A;  2QA8 A;  1T7M A;  3K8S A;  2BJ4 B;  1XAP A;  1FCZ A;  2HAS A;  2PIN A;  2Z4B A;  1UOM A;  4IA3 A;  5EHJ A;  3DZU A;  3ERT A;  4IUI A;  5KR9 A;  5AZV A;  3L1B A;  2PIO A;  2I4Z A;  4J5X C;  3UU7 B;  2AMB A;  2LBD A;  5K13 A;  5GIC A;  3OSA A;  3A2J A;  3ZQT A;  4ZNS A;  2AYR A;  2YLP A;  1S19 A;  1YMT A;  2GPP A;  2A3I A;  1XVP B;  1SKX A;  2W8Y A;  4A4V A;  2POB A;  1Z95 A;  2HAM A;  1T65 A;  3OS9 A;  1YYE A;  4Q0A C;  2ZAS A;  4LTW A;  5DY8 A;  3PCU A;  2Q7I A;  3ERD A;  1Z5X E;  5GT4 A;  4N73 A;  1GS4 A;  4M8H A;  3VTC A;  4UDA A;  3FC6 A;  2Q6J A;  3WT5 A;  2XYX A;  3D6D A;  3GYU A;  3N00 A;  2YJD A;  3R8A A;  4ZN9 A;  5DWJ A;  2AA5 A;  1PCG A;  3DZU D;  2XYW A;  3ET1 A;  3UVV B;  4DM8 A;  4DM6 A;  1YOK A;  3CQV A;  5KCC A;  4MG5 A;  3VJH A;  3W0C A;  4E4K A;  1FCY A;  4RUO X;  5KCW A;  3ADU A;  4MGD B;  4OJB A;  5E0X A;  4IV4 A;  5DMF A;  5DKG A;  4TUZ B;  5DV3 A;  3D5F A;  1X7J A;  2HBH A;  2PIR A;  5DWI A;  1K4W A;  5DX3 B;  1ZAF A;  2OVM A;  3WFG A;  2AXA A;  2ATH A;  2VSR A;  4OFR A;  2E2R A;  3CS4 A;  4RWV A;  2GP7 A;  1X7E A;  1YA3 A;  1ZH7 A;  5AAV A;  3ZR7 A;  3V9Y A;  2G5O A;  3A3Z X;  5KRH A;  2QE4 A;  3SP9 A;  5ETH A;  1NQ7 A;  5AVL A;  2QPY A;  2P7A A;  2QXS A;  5G3J A;  1NDE A;  2QTU A;  3PO9 A;  1SQN A;  2PIQ A;  3CS6 A;  2B1Z A;  4MG9 A;  1QKM A;  3GWS X;  3W0Y A;  5DXE A;  3OLL A;  1OVL A;  2HWQ A;  4G1Z A;  5EIT A;  3V4A A;  4OJ4 A;  3CS8 A;  4XI3 A;  3OMQ A;  5G44 A;  1NQ1 A;  2PJL A;  4MG9 B;  2QXM A;  2ZK6 A;  3B65 A;  4RZE A;  5L7G A;  1RDT D;  3UUD A;  3W5P A;  3NOA A;  2JFA B;  4IA2 A;  1XV9 B;  2AB2 A;  2AA2 A;  3TKM A;  5KRJ A;  1R1K D;  5DKS A;  3KMZ A;  1EXA A;  4ITF A;  1K7L A;  1YUC A;  5DXB A;  3ZRA A;  2I4P A;  2YLO A;  4J5W C;  3D24 A;  1FBY A;  5G46 A;  1Y9R A;  4MGC A;  3GD2 A;  1H9U A;  4OK1 A;  3W5Q A;  1M13 A;  4Q50 A;  5DYB A;  4CI4 A;  5L7E A;  4MGB A;  1GWR A;  4PXM A;  3VT3 A;  1QKN A;  4L96 A;  4OLM A;  5CJ6 A;  5DXM A;  5AVI A;  3W5T A;  4A2J A;  4IS8 A;  2NPA A;  3JZB A;  2I4J A;  3TKC A;  4MGB B;  5DTV A;  1G2N A;  1U3R A;  2QAB A;  4MG7 B;  5FQT A;  3G8O A;  2POG A;  1R6G A;  3A40 X;  4OIU A;  1SR7 A;  2QR9 A;  1T79 A;  5G42 A;  4RE8 A;  4QE8 A;  1MVC A;  3KDT A;  5DL4 A;  1YJE A;  3VT8 A;  4A4W A;  4DOS A;  2ZNQ A;  1XP1 A;  3B66 A;  1RJK A;  5DK9 A;  2ZK2 A;  1E3G A;  3ADS A;  3Q95 A;  1S9P A;  4MG6 A;  3O1E A;  1E3K A;  4P6W A;  2QGT A;  3F5C A;  1NRL A;  2G44 A;  1DKF B;  4NQA B;  1RKG A;  1XNX A;  4N5G A;  4IW6 A;  4PVU A;  4IQR A;  2ZK5 A;  4P6X A;  2ZNO A;  4CSJ A;  3WGP A;  3JZC A;  4DQM A;  3IXP A;  5DZH A;  1YIM A;  2R40 A;  3GWX A;  2QMV A;  3MNE A;  4XLD A;  2QNV A;  4WPF A;  2ZXZ A;  2J7Y A;  3OOF A;  4MDD A;  5DXR A;  5G43 A;  4LSJ A;  3V3Q A;  2P7G A;  3EYB A;  1NHZ A;  1Z5X U;  4REF A;  5DI7 A;  2O4J A;  4XHD A;  2J4A A;  4PPP A;  1S9Q A;  5FQR A;  4KZM A;  4O8F A;  5KRA A;  5IAW A;  4MGA B;  3UP0 A;  3R2A A;  2ZY0 A;  1NAV A;  3LMP A;  3W0J A;  1N83 A;  3ADV A;  5EC9 A;  2Q7K A;  5APJ A;  3FUG A;  3OS8 C;  1BSX A;  4NIE A;  1XP6 A;  3D90 A;  3ZRB A;  1OSH A;  3L0E A;  4XT9 A;  2P15 A;  3AN3 A;  2BAW A;  3VT9 A;  4K4J A;  4BCR A;  3WFF A;  3CJW A;  4ZO1 B;  1LV2 A;  2QZO B;  2Q6R A;  4IV2 A;  4JAZ A;  4Q13 A;  3MNO A;  5HZC A;  2R40 D;  1XZX X;  3B1M A;  4POH A;  3HOD A;  3KYT A;  5E1C A;  4QJR A;  5DUG A;  1YOW A;  4LNW A;  1T5Z A;  5G45 A;  3ET0 A;  1PZL A;  3VT5 A;  1UHL A;  2QA8 B;  3E7C A;  2GTK A;  2P4Y A;  2ZBS A;  1I38 A;  4JGV A;  4N8R A;  4ZN7 A;  2AMA A;  1U3S A;  3G0W A;  4APU A;  3HLV A;  4ZNH A;  4PF3 A;  4RMC A;  5JI0 D;  5C4U A;  2QW4 A;  3PLZ A;  4NUF A;  2YFE A;  3HM1 A;  3FS1 A;  2P1V A;  2P1T A;  3CDS A;  4K6I A;  5A86 A;  3B0W A;  4OKT A;  4RUP A;  3L0L A;  3VHV A;  4KZI A;  2PNU A;  4ZO1 X;  5DRJ A;  3B5R A;  5B5B A;  4R06 A;  4OEY A;  2VV4 A;  3VSO A;  5E15 A;  4RUJ A;  5E14 A;  1T7T A;  4OZR E;  3OKH A;  5F9B A;  3WT6 A;  2O4R A;  1XQ3 A;  2ACL A;  2Q1H A;  4XTA A;  3OLF A;  5H1E A;  2ZL9 A;  2AWH A;  3FC6 B;  4FNE A;  4RME A;  3UP3 A;  2QH6 A;  5KRC A;  3FUR A;  1FM6 D;  4DK8 A;  2G0H A;  3GN8 A;  2HCD A;  4LNX A;  3AZ2 A;  4PLD A;  2YLQ A;  1I7G A;  3W0G A;  1I37 A;  3A78 A;  3VT6 A;  3ILZ A;  1RK3 A;  3BC5 A;  2R6W A;  5C4T A;  1RDT A;  3R8I A;  1KV6 A;  3VJS A;  5DZ0 A;  5AYG A;  5ACC A;  2H79 A;  2VV1 A;  3KFC A;  4IWF A;  4IU7 A;  4POJ A;  1R1K A;  1M2Z A;  2B1V A;  2Z4J A;  3WMH A;  3IPU A;  2HWR A;  5KRF A;  5KRL A;  1G5Y A;  5FQS A;  5AAV B;  4ZOM A;  3L03 A;  3OMM A;  3PEQ A;  3VN2 A;  5KRK A;  4HLW A;  4RAK A;  3FEJ A;  3E00 A;  4OGH A;  3VJI A;  5DU5 A;  3L0J A;  4WLB A;  2OAX A;  1P93 A;  1XDK A;  3BEJ A;  5DV8 A;  4G1D A;  4YMQ A;  3CWD A;  3TX7 B;  1HJ1 A;  4X1F A;  2Q59 A;  3FXV A;  1U9E A;  3OGT A;  1P8D A;  1XJ7 A;  2Q70 A;  1OVL B;  1PK5 A;  2P54 A;  5EI1 A;  1IE8 A;  5IZ0 A;  1ZEO A;  3AUN A;  3A2H A;  4JYI A;  2AX7 A;  5KYA A;  5HYR A;  3UUD B;  2HB8 A;  5C4O A;  2YJA B;  3OZ0 A;  3B3K A;  4OKX A;  2V7C A;  2PRG A;  3KPZ A;  2AX6 A;  5DXB B;  2OVH A;  3E00 D;  5DX3 A;  5DVS A;  5DZ1 A;  1XIU A;  4DK7 A;  3P89 A;  5DWG A;  2XHS A;  3K22 A;  5B41 A;  3DT3 A;  2PIU A;  3B0T A;  3FLI A;  2Q7L A;  3O1D A;  3OMK A;  5HCV A;  1FCX A;  4YPQ A;  1WM0 X;  1TXI A;  2OM9 A;  1Y0X X;  2PIP L;  2Q61 A;  1R5K A;  2ZK1 A;  3IPQ A;  1XOW A;  2HC4 A;  2QSE A;  4OAR A;  4OEA A;  5DVC A;  1KNU A;  2AA7 A;  4X1G A;  5DV6 A;  5GIE A;  5KRO A;  3CTB A;  4S15 A;  3B0Q A;  5APH A;  3A9E A;  3V3E A;  1PQC A;  3FEI A;  1G1U A;  2ZK3 A;  3V9V A;  4RMD A;  4TV1 A;  1ZGY A;  4N1Y A;  4FGY A;  1GWQ A;  1Q4X A;  4PRG A;  5KRI A;  3OZJ A;  2REW A;  3RVF A;  1UPV A;  3UUC A;  4DMA A;  5LGA A;  1EXX A;  4WHF A;  1SJ0 A;  1N46 A;  2XYJ A;  3AFR A;  3Q95 B;  2I0J A;  1ILG A;  3ET3 A;  4OIV A;  4MG8 A;  3F5C B;  2ZK4 A;  2P1U A;  2ZKC A;  2YHD A;  1K74 A;  1NAX A;  1XP9 A;  2H77 A;  3HZF A;  1IE9 A;  3R5N A;  5DWL A;  3WT7 A;  4QL8 A;  2Q5P A;  4OED A;  2J7X A;  1MV9 A;  5KRM A;  4RZG A;  4QK4 A;  3GZ9 A;  2ZVT A;  2F4B A;  2NW4 A;  2VV0 A;  3KWY A;  3OAP A;  4NY9 A;  4WVD A;  3ADX A;  3WJ5 A;  4Y29 A;  1NQ0 A;  2Q7J A;  3VHU A;  2ZLC A;  1I7I A;  1ILH A;  4IW8 A;  2ZXM A;  5DUH A;  1LBD A;  4G21 A;  4OZR U;  2ZLA A;  4PP5 A;  5G5W A;  3UUA A;  5M96 A;  5KCD A;  1T7R A;  4S14 A;  1ZKY A;  3KBA A;  2P7Z A;  4XUH A;  2PIT A;  5DUE A;  5DSH A;  1ZDU A;  3VRW A;  3W0I A;  4B7W A;  3OMO A;  3X31 A;  5DKB A;  4QE6 A;  2FSZ A;  5LWP A;  1K74 D;  2QA6 A;  3VSP A;  2AAX A;  2NXX E;  5EGV A;  4ZJW A;  3FAL A;  5DZI A;  4JYG A;  4PP3 A;  3BQD A;  4J5X A;  5HJP A;  3VT7 A;  4G2I A;  3VTD A;  1HG4 A;  2FVJ A;  3VJT A;  3G9E A;  1NUO A;  1UHL B;  1RKH A;  3RUT A;  3KMR A;  1FM6 A;  4PWL A;  2HVC A;  4ZJR A;  2O9I A;  3VRT A;  1QKT A;  2GIU A;  5DKE A;  5JJM A;  1PQ9 A;  3CDP A;  1XLS E;  4EMA A;  2V0V A;  3ET2 A;  4JL4 A;  1XLS A;  3VT4 A;  2BJ4 A;  1VJB A;  2PIV A;  2HAR A;  1UPW A;  1X7R A;  5DIG A;  3V9T A;  3RUU A;  2AA6 A;  4R2U A;  3H52 A;  2ZXN A;  3UU7 A;  3NSP A;  4OZT E;  5DVV A;  2B50 A;  3B67 A;  3NSQ A;  2VV4 B;  3PBA A;  5C4S A;  1G50 A;  5HYK A;  2ZNN A;  4OH6 A;  2ZNP A;  1XVP A;  1N4H A;  1FD0 A;  3IPS A;  2YLY A;  1L2J A;  2ACL B;  4IA1 A;  4L98 A;  2AO6 A;  3U9Q A;  1YIN A;  2AX9 A;  1YP0 A;  1ZUC A;  3KDU A;  3A2I A;  4FHI A;  4ONI A;  3GYT A;  5FQP A;  4CI5 A;  3X1I A;  4E4Q A;  4REE A;  3B0R A;  4DOR A;  3VI8 A;  3WTQ A;  3E94 A;  2GPU A;  1T74 A;  3B68 A;  3DCU A;  3D57 A;  2Q60 A;  4PP6 A;  4R6S A;  3R8D A;  3UVV A;  3VHW A;  1OSV A;  4YNK A;  5DXQ A;  3AUR A;  2ABI A;  1YY4 A;  2VST A;  1OT7 A;  3OSI A;  2XKW A;  4YT1 A;  2VV1 B;  3DR1 A;  2G0G A;  2HFP A;  2AX8 A;  1L2I A;  2FAI A;  3DCT A;  4MGD A;  3HQ5 A;  3PRG A;  3R29 A;  4XAO A;  1XB7 A;  2JJ3 A;  3IA6 A;  3DZY A;  1A28 A;  3AZ1 A;  4TUZ A;  2OZ7 A;  5JY3 A;  3X1H A;  3K6P A;  3HC6 A;  1XNN A;  4M8E A;  4PLE A;  4ZNU A;  4OHA A;  5DID A;  2AM9 A;  3S9S A;  5KCT A;  1X78 A;  5L7H A;  5AAU A;  3IMY A;  5AZT A;  3VRU A;  3WWR A;  1PRG A;  4IVY A;  3OKI A;  5KYJ A;  1XDK B;  2PKL A;  3MNP A;  5DIE A;  2GPV A;  3W0A A;  4J5W A;  2Q59 B;  2Q6S A;  4G1Y A;  4E2J A;  2PIW A;  4S0S A;  1T7F A;  5ICK A;  5DYD A;  2IOG A;  5E19 A;  4OH5 A;  5E7V A;  4WQP A;  4WHG A;  1ZDT A;  3CLD A;  1XPC A;  5DP0 A;  2VV2 A;  3OLS A;  4G20 A;  5DMC A;  2OUZ A;  3DZY D;  5E0W A;  1TFC A;  1S0X A;  5AWJ A;  5HJS A;  5KD9 A;  2Q3Y A;  4FN9 A;  3L3X A;  4ZNV A;  5KCF A;  4OJ9 A;  4G2H A;  3HVL A;  2JFA A;  1XV9 A;  3HC5 A; 
#chains in the Genus database with same CATH homology
 3ADT A;  1ERE A;  2YAT A;  4NB6 A;  2Q8S A;  3OSW A;  3P88 A;  1XQC A;  3V49 A;  4OKB A;  3T03 A;  5DXP A;  2IOK A;  2Q5S A;  3A9E B;  1U3Q A;  1FM9 A;  3QT0 A;  5GID A;  3RLJ A;  1PDU A;  4TV1 B;  3P0U A;  3ADW A;  3SP6 A;  2IHQ A;  1PQ6 A;  4J26 A;  4MG7 A;  3VTB A;  1T63 A;  3W5R A;  5I4V A;  4OC7 A;  1T73 A;  1NYX A;  4UDB A;  3AN4 A;  3H0A A;  2QGW A;  1S0Z A;  4IWC A;  1A52 A;  1MZN A;  4MG8 B;  2ZMH A;  2EWP A;  2J14 A;  1X76 A;  3LBD A;  3SZ1 A;  2R6Y A;  3RLL A;  4RFW A;  2PIX A;  5IXK A;  1ERR A;  2ZMJ A;  2B23 A;  2I0G A;  4HEE X;  2NV7 A;  4KZJ A;  4JYH A;  4RZF A;  3HO0 A;  5EJV A;  1DKF A;  1QKU A;  4EM9 A;  1T76 A;  4OFU A;  4QM0 A;  2ZFX A;  1FM9 D;  3OS8 A;  5AK2 A;  4OZT U;  3OMP A;  4S0T A;  3TY0 A;  3WJ4 A;  5APK A;  3G8I A;  1Y0S A;  2GL8 A;  5DXK A;  5SYZ A;  4UDD A;  5KCE A;  4UDC A;  4ZNW A;  2OCF A;  3W0H A;  3UUA B;  3AZ3 A;  3RY9 A;  5FQV A;  1R20 A;  2Q5G A;  2VV3 A;  3H0A D;  3OOK A;  3GBK A;  4LBD A;  5L11 A;  2GWX A;  5DWE A;  3X36 A;  4OIL A;  4FHH A;  5DZ3 A;  3VRV A;  3DY6 A;  3K23 A;  2NXX A;  2ZK0 A;  4MGA A;  4OEZ A;  2Q1V A;  2ZMI A;  3R5M A;  5DXG A;  1GWX A;  3FAL B;  4OKW A;  3M7R A;  5DLR A;  5KCU A;  4ITE A;  5HJP B;  5AWK A;  2HB7 A;  1KKQ A;  4J24 A;  1X7B A;  3L3Z A;  4F9M A;  3AX8 A;  1DB1 A;  5DRM A;  2QZO A;  4K7A A;  1M7W A;  2GPO A;  2JF9 A;  4IVW A;  3F7D A;  4ZI1 A;  1R20 D;  3AUQ A;  3P8X A;  1NQ2 A;  3IXP D;  4PPS A;  4XUM A;  3KMG A;  5JJM B;  4ZNT A;  4IA7 A;  2QA8 A;  1T7M A;  3K8S A;  2BJ4 B;  1XAP A;  1FCZ A;  2HAS A;  2PIN A;  2Z4B A;  1UOM A;  4IA3 A;  5EHJ A;  3DZU A;  3ERT A;  4IUI A;  5KR9 A;  5AZV A;  3L1B A;  2PIO A;  2I4Z A;  4J5X C;  3UU7 B;  2AMB A;  2LBD A;  5K13 A;  5GIC A;  3OSA A;  3A2J A;  3ZQT A;  4ZNS A;  2AYR A;  2YLP A;  1S19 A;  1YMT A;  2GPP A;  2A3I A;  1XVP B;  1SKX A;  2W8Y A;  4A4V A;  2POB A;  1Z95 A;  2HAM A;  1T65 A;  3OS9 A;  1YYE A;  4Q0A C;  2ZAS A;  4LTW A;  5DY8 A;  3PCU A;  2Q7I A;  3ERD A;  1Z5X E;  5GT4 A;  4N73 A;  1GS4 A;  4M8H A;  3VTC A;  4UDA A;  3FC6 A;  2Q6J A;  3WT5 A;  2XYX A;  3D6D A;  3GYU A;  3N00 A;  2YJD A;  3R8A A;  4ZN9 A;  5DWJ A;  2AA5 A;  1PCG A;  3DZU D;  2XYW A;  3ET1 A;  3UVV B;  4DM8 A;  4DM6 A;  1YOK A;  3CQV A;  5KCC A;  4MG5 A;  3VJH A;  3W0C A;  4E4K A;  1FCY A;  4RUO X;  5KCW A;  3ADU A;  4MGD B;  4OJB A;  5E0X A;  4IV4 A;  5DMF A;  5DKG A;  4TUZ B;  5DV3 A;  3D5F A;  1X7J A;  2HBH A;  2PIR A;  5DWI A;  1K4W A;  5DX3 B;  1ZAF A;  2OVM A;  3WFG A;  2AXA A;  2ATH A;  2VSR A;  4OFR A;  2E2R A;  3CS4 A;  4RWV A;  2GP7 A;  1X7E A;  1YA3 A;  1ZH7 A;  5AAV A;  3ZR7 A;  3V9Y A;  2G5O A;  3A3Z X;  5KRH A;  2QE4 A;  3SP9 A;  5ETH A;  1NQ7 A;  5AVL A;  2QPY A;  2P7A A;  2QXS A;  5G3J A;  1NDE A;  2QTU A;  3PO9 A;  1SQN A;  2PIQ A;  3CS6 A;  2B1Z A;  4MG9 A;  1QKM A;  3GWS X;  3W0Y A;  5DXE A;  3OLL A;  1OVL A;  2HWQ A;  4G1Z A;  5EIT A;  3V4A A;  4OJ4 A;  3CS8 A;  4XI3 A;  3OMQ A;  5G44 A;  1NQ1 A;  2PJL A;  4MG9 B;  2QXM A;  2ZK6 A;  3B65 A;  4RZE A;  5L7G A;  1RDT D;  3UUD A;  3W5P A;  3NOA A;  2JFA B;  4IA2 A;  1XV9 B;  2AB2 A;  2AA2 A;  3TKM A;  5KRJ A;  1R1K D;  5DKS A;  3KMZ A;  1EXA A;  4ITF A;  1K7L A;  1YUC A;  5DXB A;  3ZRA A;  2I4P A;  2YLO A;  4J5W C;  3D24 A;  1FBY A;  5G46 A;  1Y9R A;  4MGC A;  3GD2 A;  1H9U A;  4OK1 A;  3W5Q A;  1M13 A;  4Q50 A;  5DYB A;  4CI4 A;  5L7E A;  4MGB A;  1GWR A;  4PXM A;  3VT3 A;  1QKN A;  4L96 A;  4OLM A;  5CJ6 A;  5DXM A;  5AVI A;  3W5T A;  4A2J A;  4IS8 A;  2NPA A;  3JZB A;  2I4J A;  3TKC A;  4MGB B;  5DTV A;  1G2N A;  1U3R A;  2QAB A;  4MG7 B;  5FQT A;  3G8O A;  2POG A;  1R6G A;  3A40 X;  4OIU A;  1SR7 A;  2QR9 A;  1T79 A;  5G42 A;  4RE8 A;  4QE8 A;  1MVC A;  3KDT A;  5DL4 A;  1YJE A;  3VT8 A;  4A4W A;  4DOS A;  2ZNQ A;  1XP1 A;  3B66 A;  1RJK A;  5DK9 A;  2ZK2 A;  1E3G A;  3ADS A;  3Q95 A;  1S9P A;  4MG6 A;  3O1E A;  1E3K A;  4P6W A;  2QGT A;  3F5C A;  1NRL A;  2G44 A;  1DKF B;  4NQA B;  1RKG A;  1XNX A;  4N5G A;  4IW6 A;  4PVU A;  4IQR A;  2ZK5 A;  4P6X A;  2ZNO A;  4CSJ A;  3WGP A;  3JZC A;  4DQM A;  3IXP A;  5DZH A;  1YIM A;  2R40 A;  3GWX A;  2QMV A;  3MNE A;  4XLD A;  2QNV A;  4WPF A;  2ZXZ A;  2J7Y A;  3OOF A;  4MDD A;  5DXR A;  5G43 A;  4LSJ A;  3V3Q A;  2P7G A;  3EYB A;  1NHZ A;  1Z5X U;  4REF A;  5DI7 A;  2O4J A;  4XHD A;  2J4A A;  4PPP A;  1S9Q A;  5FQR A;  4KZM A;  4O8F A;  5KRA A;  5IAW A;  4MGA B;  3UP0 A;  3R2A A;  2ZY0 A;  1NAV A;  3LMP A;  3W0J A;  1N83 A;  3ADV A;  5EC9 A;  2Q7K A;  5APJ A;  3FUG A;  3OS8 C;  1BSX A;  4NIE A;  1XP6 A;  3D90 A;  3ZRB A;  1OSH A;  3L0E A;  4XT9 A;  2P15 A;  3AN3 A;  2BAW A;  3VT9 A;  4K4J A;  4BCR A;  3WFF A;  3CJW A;  4ZO1 B;  1LV2 A;  2QZO B;  2Q6R A;  4IV2 A;  4JAZ A;  4Q13 A;  3MNO A;  5HZC A;  2R40 D;  1XZX X;  3B1M A;  4POH A;  3HOD A;  3KYT A;  5E1C A;  4QJR A;  5DUG A;  1YOW A;  4LNW A;  1T5Z A;  5G45 A;  3ET0 A;  1PZL A;  3VT5 A;  1UHL A;  2QA8 B;  3E7C A;  2GTK A;  2P4Y A;  2ZBS A;  1I38 A;  4JGV A;  4N8R A;  4ZN7 A;  2AMA A;  1U3S A;  3G0W A;  4APU A;  3HLV A;  4ZNH A;  4PF3 A;  4RMC A;  5JI0 D;  5C4U A;  2QW4 A;  3PLZ A;  4NUF A;  2YFE A;  3HM1 A;  3FS1 A;  2P1V A;  2P1T A;  3CDS A;  4K6I A;  5A86 A;  3B0W A;  4OKT A;  4RUP A;  3L0L A;  3VHV A;  4KZI A;  2PNU A;  4ZO1 X;  5DRJ A;  3B5R A;  5B5B A;  4R06 A;  4OEY A;  2VV4 A;  3VSO A;  5E15 A;  4RUJ A;  5E14 A;  1T7T A;  4OZR E;  3OKH A;  5F9B A;  3WT6 A;  2O4R A;  1XQ3 A;  2ACL A;  2Q1H A;  4XTA A;  3OLF A;  5H1E A;  2ZL9 A;  2AWH A;  3FC6 B;  4FNE A;  4RME A;  3UP3 A;  2QH6 A;  5KRC A;  3FUR A;  1FM6 D;  4DK8 A;  2G0H A;  3GN8 A;  2HCD A;  4LNX A;  3AZ2 A;  4PLD A;  2YLQ A;  1I7G A;  3W0G A;  1I37 A;  3A78 A;  3VT6 A;  3ILZ A;  1RK3 A;  3BC5 A;  2R6W A;  5C4T A;  1RDT A;  3R8I A;  1KV6 A;  3VJS A;  5DZ0 A;  5AYG A;  5ACC A;  2H79 A;  2VV1 A;  3KFC A;  4IWF A;  4IU7 A;  4POJ A;  1R1K A;  1M2Z A;  2B1V A;  2Z4J A;  3WMH A;  3IPU A;  2HWR A;  5KRF A;  5KRL A;  1G5Y A;  5FQS A;  5AAV B;  4ZOM A;  3L03 A;  3OMM A;  3PEQ A;  3VN2 A;  5KRK A;  4HLW A;  4RAK A;  3FEJ A;  3E00 A;  4OGH A;  3VJI A;  5DU5 A;  3L0J A;  4WLB A;  2OAX A;  1P93 A;  1XDK A;  3BEJ A;  5DV8 A;  4G1D A;  4YMQ A;  3CWD A;  3TX7 B;  1HJ1 A;  4X1F A;  2Q59 A;  3FXV A;  1U9E A;  3OGT A;  1P8D A;  1XJ7 A;  2Q70 A;  1OVL B;  1PK5 A;  2P54 A;  5EI1 A;  1IE8 A;  5IZ0 A;  1ZEO A;  3AUN A;  3A2H A;  4JYI A;  2AX7 A;  5KYA A;  5HYR A;  3UUD B;  2HB8 A;  5C4O A;  2YJA B;  3OZ0 A;  3B3K A;  4OKX A;  2V7C A;  2PRG A;  3KPZ A;  2AX6 A;  5DXB B;  2OVH A;  3E00 D;  5DX3 A;  5DVS A;  5DZ1 A;  1XIU A;  4DK7 A;  3P89 A;  5DWG A;  2XHS A;  3K22 A;  5B41 A;  3DT3 A;  2PIU A;  3B0T A;  3FLI A;  2Q7L A;  3O1D A;  3OMK A;  5HCV A;  1FCX A;  4YPQ A;  1WM0 X;  1TXI A;  2OM9 A;  1Y0X X;  2PIP L;  2Q61 A;  1R5K A;  2ZK1 A;  3IPQ A;  1XOW A;  2HC4 A;  2QSE A;  4OAR A;  4OEA A;  5DVC A;  1KNU A;  2AA7 A;  4X1G A;  5DV6 A;  5GIE A;  5KRO A;  3CTB A;  4S15 A;  3B0Q A;  5APH A;  3A9E A;  3V3E A;  1PQC A;  3FEI A;  1G1U A;  2ZK3 A;  3V9V A;  4RMD A;  4TV1 A;  1ZGY A;  4N1Y A;  4FGY A;  1GWQ A;  1Q4X A;  4PRG A;  5KRI A;  3OZJ A;  2REW A;  3RVF A;  1UPV A;  3UUC A;  4DMA A;  5LGA A;  1EXX A;  4WHF A;  1SJ0 A;  1N46 A;  2XYJ A;  3AFR A;  3Q95 B;  2I0J A;  1ILG A;  3ET3 A;  4OIV A;  4MG8 A;  3F5C B;  2ZK4 A;  2P1U A;  2ZKC A;  2YHD A;  1K74 A;  1NAX A;  1XP9 A;  2H77 A;  3HZF A;  1IE9 A;  3R5N A;  5DWL A;  3WT7 A;  4QL8 A;  2Q5P A;  4OED A;  2J7X A;  1MV9 A;  5KRM A;  4RZG A;  4QK4 A;  3GZ9 A;  2ZVT A;  2F4B A;  2NW4 A;  2VV0 A;  3KWY A;  3OAP A;  4NY9 A;  4WVD A;  3ADX A;  3WJ5 A;  4Y29 A;  1NQ0 A;  2Q7J A;  3VHU A;  2ZLC A;  1I7I A;  1ILH A;  4IW8 A;  2ZXM A;  5DUH A;  1LBD A;  4G21 A;  4OZR U;  2ZLA A;  4PP5 A;  5G5W A;  3UUA A;  5M96 A;  5KCD A;  1T7R A;  4S14 A;  1ZKY A;  3KBA A;  2P7Z A;  4XUH A;  2PIT A;  5DUE A;  5DSH A;  1ZDU A;  3VRW A;  3W0I A;  4B7W A;  3OMO A;  3X31 A;  5DKB A;  4QE6 A;  2FSZ A;  5LWP A;  1K74 D;  2QA6 A;  3VSP A;  2AAX A;  2NXX E;  5EGV A;  4ZJW A;  3FAL A;  5DZI A;  4JYG A;  4PP3 A;  3BQD A;  4J5X A;  5HJP A;  3VT7 A;  4G2I A;  3VTD A;  1HG4 A;  2FVJ A;  3VJT A;  3G9E A;  1NUO A;  1UHL B;  1RKH A;  3RUT A;  3KMR A;  1FM6 A;  4PWL A;  2HVC A;  4ZJR A;  2O9I A;  3VRT A;  1QKT A;  2GIU A;  5DKE A;  5JJM A;  1PQ9 A;  3CDP A;  1XLS E;  4EMA A;  2V0V A;  3ET2 A;  4JL4 A;  1XLS A;  3VT4 A;  2BJ4 A;  1VJB A;  2PIV A;  2HAR A;  1UPW A;  1X7R A;  5DIG A;  3V9T A;  3RUU A;  2AA6 A;  4R2U A;  3H52 A;  2ZXN A;  3UU7 A;  3NSP A;  4OZT E;  5DVV A;  2B50 A;  3B67 A;  3NSQ A;  2VV4 B;  3PBA A;  5C4S A;  1G50 A;  5HYK A;  2ZNN A;  4OH6 A;  2ZNP A;  1XVP A;  1N4H A;  1FD0 A;  3IPS A;  2YLY A;  1L2J A;  2ACL B;  4IA1 A;  4L98 A;  2AO6 A;  3U9Q A;  1YIN A;  2AX9 A;  1YP0 A;  1ZUC A;  3KDU A;  3A2I A;  4FHI A;  4ONI A;  3GYT A;  5FQP A;  4CI5 A;  3X1I A;  4E4Q A;  4REE A;  3B0R A;  4DOR A;  3VI8 A;  3WTQ A;  3E94 A;  2GPU A;  1T74 A;  3B68 A;  3DCU A;  3D57 A;  2Q60 A;  4PP6 A;  4R6S A;  3R8D A;  3UVV A;  3VHW A;  1OSV A;  4YNK A;  5DXQ A;  3AUR A;  2ABI A;  1YY4 A;  2VST A;  1OT7 A;  3OSI A;  2XKW A;  4YT1 A;  2VV1 B;  3DR1 A;  2G0G A;  2HFP A;  2AX8 A;  1L2I A;  2FAI A;  3DCT A;  4MGD A;  3HQ5 A;  3PRG A;  3R29 A;  4XAO A;  1XB7 A;  2JJ3 A;  3IA6 A;  3DZY A;  1A28 A;  3AZ1 A;  4TUZ A;  2OZ7 A;  5JY3 A;  3X1H A;  3K6P A;  3HC6 A;  1XNN A;  4M8E A;  4PLE A;  4ZNU A;  4OHA A;  5DID A;  2AM9 A;  3S9S A;  5KCT A;  1X78 A;  5L7H A;  5AAU A;  3IMY A;  5AZT A;  3VRU A;  3WWR A;  1PRG A;  4IVY A;  3OKI A;  5KYJ A;  1XDK B;  2PKL A;  3MNP A;  5DIE A;  2GPV A;  3W0A A;  4J5W A;  2Q59 B;  2Q6S A;  4G1Y A;  4E2J A;  2PIW A;  4S0S A;  1T7F A;  5ICK A;  5DYD A;  2IOG A;  5E19 A;  4OH5 A;  5E7V A;  4WQP A;  4WHG A;  1ZDT A;  3CLD A;  1XPC A;  5DP0 A;  2VV2 A;  3OLS A;  4G20 A;  5DMC A;  2OUZ A;  3DZY D;  5E0W A;  1TFC A;  1S0X A;  5AWJ A;  5HJS A;  5KD9 A;  2Q3Y A;  4FN9 A;  3L3X A;  4ZNV A;  5KCF A;  4OJ9 A;  4G2H A;  3HVL A;  2JFA A;  1XV9 A;  3HC5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...