4CI5A

Structural basis for gl479 a dual peroxisome proliferator-activated receptor gamma agonist
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
272
structure length
260
Chain Sequence
PESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Nuclear protein
molecule keywords PEROXISOME PROLIFERATOR-ACTIVATED RECEPTOR GAMMA
publication title Different binding and recognition modes of GL479, a dual agonist of Peroxisome Proliferator-Activated Receptor alpha / gamma.
pubmed doi rcsb
source organism Homo sapiens
total genus 98
structure length 260
sequence length 272
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 4ci5A00
1RDTA 4TV1B 4OFUA 1GS4A 5DKSA 1Y9RA 2GTKA 1PCGA 2AA5A 4IVWA 4TV1A 5H1EA 5AWJA 1E3KA 4XI3A 3V9VA 5C4SA 3VT9A 2HBHA 4RMCA 3ADTA 3O1DA 4L96A 2P4YA 3CS4A 4XT9A 2R6WA 3W0IA 5IAWA 2HB8A 3KMRA 5C4TA 1KV6A 2Z4JA 3AZ1A 4LTWA 5DIDA 2AO6A 4E4KA 4PP3A 1PDUA 3OZJA 4PRGA 4IWCA 1KKQA 3HM1A 2I4JA 1U3SA 3GYTA 3GD2A 3DZUD 4A2JA 1MV9A 3FXVA 1T7TA 1FD0A 3K6PA 4S0SA 3PRGA 5DUEA 5EC9A 3VT7A 1YUCA 2PINA 4MG8B 4DORA 1ILGA 1SKXA 3FUGA 4MG8A 1NQ7A 3MNOA 3VTBA 3ET2A 2NV7A 2P7ZA 3JZBA 2REWA 5G42A 3NSPA 3RLJA 5DUHA 1UHLB 4APUA 3HVLA 1T63A 1YMTA 2AYRA 2QA6A 5DZIA 1UHLA 4PWLA 3A2IA 2Q60A 5DYDA 5KCCA 4OARA 5L7EA 1R20A 2Q59B 1YY4A 5LWPA 4RZGA 5DZ0A 1OSVA 2Q59A 1DKFB 2ZK4A 3B65A 3L3ZA 5KRIA 3G9EA 2QABA 4OKBA 3NSQA 2I0JA 1DKFA 4OZRU 5I4VA 4G2HA 4E4QA 5G43A 5FQVA 4NY9A 4ZNHA 5KR9A 3K8SA 3B3KA 1A52A 4MGBB 2YATA 3CDPA 1I7GA 4MG7B 5DIGA 3OZ0A 2AMAA 4MG7A 2PKLA 4ZO1X 1ZEOA 5AZTA 3GZ9A 3AUQA 3N00A 1KNUA 3L03A 1RKHA 2XYWA 2XHSA 2ZMJA 1YA3A 1SQNA 3CS8A 3PLZA 5DKBA 3P8XA 1L2IA 4XUMA 2GPOA 1FM9A 1IE8A 3A40X 3Q95B 5DUGA 3R5NA 1XDKB 4P6WA 1ZAFA 1ZH7A 4Q0AC 3Q95A 5A86A 2I4PA 2OM9A 3PBAA 3W5QA 5KROA 1XDKA 1X76A 3ILZA 4OK1A 2Q1HA 3GBKA 3IPSA 4J5XC 1G1UA 1XP6A 3AUNA 4IA1A 4Q13A 5HCVA 3UUAB 1N46A 3P88A 3WFGA 2ZNQA 3EYBA 1OVLB 3OS8A 3UUAA 3BC5A 5DY8A 5SYZA 4M8EA 1OVLA 2Z4BA 2GWXA 2P7GA 3GYUA 4LBDA 2J4AA 3VSPA 3E7CA 3T03A 1T7FA 3WWRA 1E3GA 1NHZA 4IVYA 4REFA 1TFCA 2ZMIA 4IA2A 4RUOX 1M13A 4PPSA 1PRGA 5EHJA 3F5CB 2G44A 3D57A 3FEJA 1LBDA 1P93A 5K13A 3KMZA 4N8RA 3B0RA 3WFFA 2R40D 3HLVA 4G20A 4PPPA 4R06A 3W0GA 1XIUA 5G45A 4OZTU 3CDSA 3UVVA 2XYXA 2YJDA 3GWSX 3VRWA 3X1IA 5HYRA 2GPPA 4G2IA 1QKUA 1X7JA 2IOGA 4N5GA 5KCUA 1NDEA 2AXAA 5EI1A 1ZGYA 1U3RA 2ACLB 5HJSA 1XB7A 3R29A 1YIMA 2ACLA 5DZ1A 2QR9A 3L0JA 2PIPL 1XQCA 2W8YA 5L11A 2G0HA 2E2RA 1I37A 4FN9A 5DIEA 5DMCA 3KDUA 3OMKA 2PIWA 1K74D 5DWJA 3ET1A 3OSIA 5C4UA 2A3IA 3VHWA 2PIUA 5B5BA 1S0ZA 5ACCA 3A9EB 4JYHA 3WMHA 1DB1A 4RUPA 1XVPB 3W0YA 4YNKA 1XNNA 1HJ1A 3A9EA 1NUOA 1XVPA 4DOSA 1I38A 4XTAA 5DWGA 2Q7IA 2Q6RA 5AVIA 5DVSA 1XNXA 2POBA 3OKHA 4KZIA 3VSOA 4UDAA 4J24A 1ZDUA 1GWRA 3AFRA 3WT7A 1NAVA 2VV4A 2YHDA 5DK9A 3TY0A 3ZR7A 4OH6A 4RUJA 1IE9A 1T76A 2PJLA 4MG6A 1XQ3A 1L2JA 3OMPA 1T74A 3ADWA 3AN4A 1GWQA 1SR7A 3IXPD 4JL4A 3VT4A 4JAZA 3HODA 3H52A 4IV2A 2ZLAA 2AWHA 3A2HA 4HEEX 4KZJA 4R6SA 4RMDA 1LV2A 4J26A 5GICA 4J5WC 2Q61A 1T7MA 2HASA 2QW4A 2JJ3A 2VV2A 3CQVA 5AYGA 2AA7A 1R1KA 5DTVA 1T7RA 1K7LA 2P1TA 5LGAA 2Q7LA 3KWYA 4G1DA 4OJ9A 1XP1A 1FM6A 4ZJRA 1T5ZA 2B1ZA 4OZRE 4BCRA 2Q1VA 3DCUA 3HZFA 3OOFA 5JY3A 4M8HA 5IZ0A 4DMAA 2Q6SA 3S9SA 3WT5A 3D24A 3CLDA 1P8DA 2Q5PA 5HYKA 4MGAB 4PLDA 4ZOMA 3W5PA 4OIUA 4Y29A 5DWIA 1RK3A 4MGAA 2GL8A 3R8DA 5DV8A 2P1VA 3F7DA 3ZRAA 4ITEA 3E00D 2P7AA 4RE8A 3VRUA 3D90A 2PNUA 1T65A 2IHQA 3VTDA 2ZLCA 1MVCA 4IWFA 3H0AA 2VV1B 2ZXMA 4QM0A 3DT3A 4PVUA 2VV1A 2JF9A 4A4VA 2ZMHA 1K4WA 5APKA 4XLDA 5DXPA 3ERDA 1Z95A 3CTBA 5KRHA 2G0GA 4IW8A 2AX7A 1U9EA 2O4RA 4WHFA 1PQ6A 5KRMA 3OKIA 3OSAA 5IXKA 5KRKA 2YLYA 1R6GA 3E94A 1XJ7A 2QGWA 3ET3A 3AURA 5FQPA 1RJKA 1SJ0A 2PITA 2QH6A 2GP7A 1WM0X 5M96A 2ABIA 1H9UA 5DXKA 5KRAA 2V7CA 4IU7A 2Q70A 4ZO1B 2GPUA 5E7VA 5ETHA 4ONIA 2NXXE 1NQ2A 2POGA 3R8AA 1XLSE 4RMEA 3G8OA 2AA2A 3B5RA 5KCDA 1PZLA 2V0VA 5DRJA 2ZK0A 2ZNOA 4WVDA 4A4WA 4OJBA 4IA7A 3IA6A 3U9QA 1T73A 2B1VA 3SP9A 3UU7B 3VT5A 3VT8A 4DM6A 2AX8A 1YYEA 3DZYA 3UU7A 1UPWA 2QTUA 4K4JA 4B7WA 1FCXA 2NPAA 3FALB 3OOKA 3P0UA 4X1GA 3UP3A 3X36A 4WQPA 4ZI1A 3ZRBA 2H79A 1T79A 3A3ZX 3FALA 4MDDA 4MGCA 5AWKA 3VHVA 2O4JA 3VRVA 4REEA 3FS1A 2P15A 4S14A 5DWLA 5DZHA 2G5OA 3WJ4A 1XAPA 4IQRA 4R2UA 5EGVA 5E15A 2I0GA 2QXSA 2ZK6A 4CSJA 2Q3YA 4DQMA 3KYTA 1M2ZA 2EWPA 3VJTA 4IS8A 4ZNWA 2ZK2A 4OH5A 5KYJA 5DVVA 1N4HA 3FEIA 2ZNPA 5E19A 3KBAA 2VV0A 3R8IA 3UVVB 5KRCA 1ILHA 5DU5A 1GWXA 2ZXZA 1FCZA 5AAVB 4F9MA 5JJMB 5DXEA 3V3EA 1X7EA 4IV4A 4OHAA 5AAVA 1XZXX 2QA8A 5FQRA 5JJMA 3BEJA 5DKGA 2ZVTA 3VN2A 3OAPA 4IW6A 1R20D 2J7YA 3ERTA 2Q8SA 2LBDA 4WLBA 1A28A 2Q7JA 4ZJWA 4N73A 1G2NA 4QK4A 1QKTA 5G44A 3DZUA 3B0QA 3D5FA 1EREA 5GIDA 2FSZA 2HCDA 4OEAA 4ITFA 5DXGA 5FQTA 2XKWA 5DX3A 3TKCA 1XPCA 4OGHA 4JGVA 3AN3A 3OMOA 1NYXA 3OS8C 4FGYA 5DMFA 2OZ7A 5DXRA 2ZNNA 4G1YA 5DL4A 4QJRA 1QKNA 3X31A 4NQAB 3AX8A 4MG9B 4POHA 4YT1A 4CI5A 5KCEA 2VV4B 3UP0A 5G5WA 4MG9A 4RZFA 3HQ5A 4ZNSA 4RFWA 4S15A 1Y0XX 4S0TA 5KCWA 4DK7A 1FM9D 2HVCA 4X1FA 4LSJA 1XV9B 4L98A 1X7RA 2NXXA 2PIQA 1HG4A 2FAIA 5DV6A 1ERRA 5E14A 2P54A 1XLSA 1XV9A 4JYGA 4Q50A 3W0AA 2OCFA 3VTCA 5HJPB 1I7IA 1YOWA 4XAOA 2BJ4B 5DRMA 3FC6B 5HJPA 3B66A 2BJ4A 1EXAA 1YJEA 2GIUA 4IUIA 3HC5A 3A78A 3QT0A 3FC6A 5DKEA 3G8IA 4E2JA 4CI4A 4WHGA 2VV3A 3KDTA 1R5KA 3SP6A 3RUUA 1U3QA 4OILA 3VJHA 3WGPA 1G5YA 3IMYA 3B0WA 3IPUA 4JYIA 3V4AA 3B1MA 1PQ9A 1G50A 5GIEA 3L3XA 3FURA 1ZUCA 3HO0A 3MNEA 3LMPA 5L7GA 2VSRA 1N83A 2ZL9A 4MG5A 3W5RA 2O9IA 2AA6A 4OKWA 5DYBA 3ET0A 5DSHA 3P89A 2QSEA 3ADVA 1Q4XA 1QKMA 4LNXA 3ADSA 4UDBA 2GPVA 2J7XA 1UOMA 4MGDB 3G0WA 2AM9A 4MGDA 4N1YA 2QXMA 4G21A 3K22A 1Z5XU 3WT6A 1BSXA 3DCTA 4NUFA 5APJA 2ZFXA 5KCFA 4KZMA 4TUZB 1S0XA 1MZNA 2YJAB 2VSTA 4K7AA 5EJVA 3RVFA 5APHA 3VJIA 3OGTA 4ZN9A 4TUZA 2ZKCA 3VT3A 5DP0A 2AX9A 3WJ5A 3UUDB 3RY9A 1X78A 2JFAB 2R40A 3K23A 2HB7A 4J5XA 3JZCA 5AVLA 3UUDA 2QNVA 2JFAA 1TXIA 3LBDA 4FHIA 5DLRA 3IPQA 5E0WA 2IOKA 3B68A 2FVJA 2PRGA 2YLPA 2XYJA 5JI0D 2ZY0A 3OLSA 2ZASA 4P6XA 2HAMA 2AMBA 5AAUA 4YPQA 2AB2A 1OT7A 3W0JA 1RKGA 3UUCA 3VJSA 4OKXA 2ZK1A 3R2AA 4HLWA 4PP6A 1RDTD 2Q5GA 5FQSA 1Y0SA 4QE6A 3V9YA 2ZK3A 3OLLA 3AZ3A 2HFPA 5DI7A 1K74A 5G3JA 5AZVA 1YINA 5HZCA 2Q6JA 3SZ1A 3L1BA 4OZTE 3CJWA 3CWDA 3GWXA 4MGBA 5AK2A 3DY6A 2OVHA 4ZNVA 2HWRA 3PEQA 5ICKA 5E0XA 5E1CA 1R1KD 2QE4A 1S9QA 4K6IA 2I4ZA 2ZXNA 3B67A 3V49A 5C4OA 4PXMA 2B23A 2PIRA 4OC7A 4PF3A 3NOAA 5DXBB 5DXMA 4OFRA 4OEYA 1FM6D 2QMVA 4OEDA 4NIEA 4OEZA 4LNWA 5DVCA 5DXBA 4EM9A 3ADUA 2PIXA 2HWQA 3IXPA 1M7WA 4ZNUA 3D6DA 3KFCA 2QGTA 2HARA 4XUHA 3VRTA 2OAXA 3OSWA 3R5MA 2PIOA 3FLIA 4PP5A 4UDDA 2QA8B 1VJBA 3TKMA 3OS9A 5G46A 3H0AD 4EMAA 4DM8A 5KRFA 4POJA 5KRJA 4QE8A 5KYAA 5L7HA 5F9BA 2YLQA 4XHDA 5DX3B 4FNEA 5KCTA 4OJ4A 2BAWA 3KPZA 3L0EA 3PCUA 3F5CA 1XP9A 1NQ1A 1YP0A 1ZKYA 3O1EA 4G1ZA 4RWVA 2J14A 3RLLA 3W0HA 3WTQA 4ZNTA 3CS6A 3KMGA 5DV3A 2P1UA 2OVMA 1PK5A 1X7BA 2Q5SA 4O8FA 3BQDA 4RZEA 3W5TA 4J5WA 1S9PA 3E00A 3W0CA 1OSHA 3VI8A 3RUTA 4OKTA 2ATHA 1ZDTA 2YLOA 1FCYA 4NB6A 3VT6A 1EXXA 3TX7B 1XOWA 1PQCA 3OMMA 4ZN7A 5CJ6A 2B50A 5KRLA 4OIVA 2F4BA 5KD9A 3ADXA 2QZOB 2YFEA 3OMQA 4PLEA 5GT4A 2ZK5A 3A2JA 3V9TA 2QZOA 2PIVA 4OLMA 2H77A 4DK8A 2ZBSA 3M7RA 3DR1A 1S19A 3L0LA 1NRLA 2AX6A 5DWEA 3GN8A 2NW4A 3DZYD 5B41A 1UPVA 4YMQA 1NQ0A 2OUZA 3HC6A 4IA3A 4RAKA 3MNPA 3VHUA 3PO9A 5DXQA 4WPFA 1FBYA 2R6YA 1NAXA 2Q7KA 5EITA 4QL8A 3ZQTA 1Z5XE 2QPYA 4FHHA 3V3QA 3OLFA 5DZ3A 3X1HA 2AAXA 3B0TA 3AZ2A 4UDCA 2HC4A 1YOKA
chains in the Genus database with same CATH superfamily
1RDTA 4TV1B 4OFUA 1GS4A 5DKSA 1Y9RA 2GTKA 1PCGA 2AA5A 4IVWA 4TV1A 5H1EA 5AWJA 1E3KA 4XI3A 3V9VA 5C4SA 3VT9A 2HBHA 4RMCA 3ADTA 3O1DA 4L96A 2P4YA 3CS4A 4XT9A 2R6WA 3W0IA 5IAWA 2HB8A 3KMRA 5C4TA 1KV6A 2Z4JA 3AZ1A 4LTWA 5DIDA 2AO6A 4E4KA 4PP3A 1PDUA 3OZJA 4PRGA 4IWCA 1KKQA 3HM1A 2I4JA 1U3SA 3GYTA 3GD2A 3DZUD 4A2JA 1MV9A 3FXVA 1T7TA 1FD0A 3K6PA 4S0SA 3PRGA 5DUEA 5EC9A 3VT7A 1YUCA 2PINA 4MG8B 4DORA 1ILGA 1SKXA 3FUGA 4MG8A 1NQ7A 3MNOA 3VTBA 3ET2A 2NV7A 2P7ZA 3JZBA 2REWA 5G42A 3NSPA 3RLJA 5DUHA 1UHLB 4APUA 3HVLA 1T63A 1YMTA 2AYRA 2QA6A 5DZIA 1UHLA 4PWLA 3A2IA 2Q60A 5DYDA 5KCCA 4OARA 5L7EA 1R20A 2Q59B 1YY4A 5LWPA 4RZGA 5DZ0A 1OSVA 2Q59A 1DKFB 2ZK4A 3B65A 3L3ZA 5KRIA 3G9EA 2QABA 4OKBA 3NSQA 2I0JA 1DKFA 4OZRU 5I4VA 4G2HA 4E4QA 5G43A 5FQVA 4NY9A 4ZNHA 5KR9A 3K8SA 3B3KA 1A52A 4MGBB 2YATA 3CDPA 1I7GA 4MG7B 5DIGA 3OZ0A 2AMAA 4MG7A 2PKLA 4ZO1X 1ZEOA 5AZTA 3GZ9A 3AUQA 3N00A 1KNUA 3L03A 1RKHA 2XYWA 2XHSA 2ZMJA 1YA3A 1SQNA 3CS8A 3PLZA 5DKBA 3P8XA 1L2IA 4XUMA 2GPOA 1FM9A 1IE8A 3A40X 3Q95B 5DUGA 3R5NA 1XDKB 4P6WA 1ZAFA 1ZH7A 4Q0AC 3Q95A 5A86A 2I4PA 2OM9A 3PBAA 3W5QA 5KROA 1XDKA 1X76A 3ILZA 4OK1A 2Q1HA 3GBKA 3IPSA 4J5XC 1G1UA 1XP6A 3AUNA 4IA1A 4Q13A 5HCVA 3UUAB 1N46A 3P88A 3WFGA 2ZNQA 3EYBA 1OVLB 3OS8A 3UUAA 3BC5A 5DY8A 5SYZA 4M8EA 1OVLA 2Z4BA 2GWXA 2P7GA 3GYUA 4LBDA 2J4AA 3VSPA 3E7CA 3T03A 1T7FA 3WWRA 1E3GA 1NHZA 4IVYA 4REFA 1TFCA 2ZMIA 4IA2A 4RUOX 1M13A 4PPSA 1PRGA 5EHJA 3F5CB 2G44A 3D57A 3FEJA 1LBDA 1P93A 5K13A 3KMZA 4N8RA 3B0RA 3WFFA 2R40D 3HLVA 4G20A 4PPPA 4R06A 3W0GA 1XIUA 5G45A 4OZTU 3CDSA 3UVVA 2XYXA 2YJDA 3GWSX 3VRWA 3X1IA 5HYRA 2GPPA 4G2IA 1QKUA 1X7JA 2IOGA 4N5GA 5KCUA 1NDEA 2AXAA 5EI1A 1ZGYA 1U3RA 2ACLB 5HJSA 1XB7A 3R29A 1YIMA 2ACLA 5DZ1A 2QR9A 3L0JA 2PIPL 1XQCA 2W8YA 5L11A 2G0HA 2E2RA 1I37A 4FN9A 5DIEA 5DMCA 3KDUA 3OMKA 2PIWA 1K74D 5DWJA 3ET1A 3OSIA 5C4UA 2A3IA 3VHWA 2PIUA 5B5BA 1S0ZA 5ACCA 3A9EB 4JYHA 3WMHA 1DB1A 4RUPA 1XVPB 3W0YA 4YNKA 1XNNA 1HJ1A 3A9EA 1NUOA 1XVPA 4DOSA 1I38A 4XTAA 5DWGA 2Q7IA 2Q6RA 5AVIA 5DVSA 1XNXA 2POBA 3OKHA 4KZIA 3VSOA 4UDAA 4J24A 1ZDUA 1GWRA 3AFRA 3WT7A 1NAVA 2VV4A 2YHDA 5DK9A 3TY0A 3ZR7A 4OH6A 4RUJA 1IE9A 1T76A 2PJLA 4MG6A 1XQ3A 1L2JA 3OMPA 1T74A 3ADWA 3AN4A 1GWQA 1SR7A 3IXPD 4JL4A 3VT4A 4JAZA 3HODA 3H52A 4IV2A 2ZLAA 2AWHA 3A2HA 4HEEX 4KZJA 4R6SA 4RMDA 1LV2A 4J26A 5GICA 4J5WC 2Q61A 1T7MA 2HASA 2QW4A 2JJ3A 2VV2A 3CQVA 5AYGA 2AA7A 1R1KA 5DTVA 1T7RA 1K7LA 2P1TA 5LGAA 2Q7LA 3KWYA 4G1DA 4OJ9A 1XP1A 1FM6A 4ZJRA 1T5ZA 2B1ZA 4OZRE 4BCRA 2Q1VA 3DCUA 3HZFA 3OOFA 5JY3A 4M8HA 5IZ0A 4DMAA 2Q6SA 3S9SA 3WT5A 3D24A 3CLDA 1P8DA 2Q5PA 5HYKA 4MGAB 4PLDA 4ZOMA 3W5PA 4OIUA 4Y29A 5DWIA 1RK3A 4MGAA 2GL8A 3R8DA 5DV8A 2P1VA 3F7DA 3ZRAA 4ITEA 3E00D 2P7AA 4RE8A 3VRUA 3D90A 2PNUA 1T65A 2IHQA 3VTDA 2ZLCA 1MVCA 4IWFA 3H0AA 2VV1B 2ZXMA 4QM0A 3DT3A 4PVUA 2VV1A 2JF9A 4A4VA 2ZMHA 1K4WA 5APKA 4XLDA 5DXPA 3ERDA 1Z95A 3CTBA 5KRHA 2G0GA 4IW8A 2AX7A 1U9EA 2O4RA 4WHFA 1PQ6A 5KRMA 3OKIA 3OSAA 5IXKA 5KRKA 2YLYA 1R6GA 3E94A 1XJ7A 2QGWA 3ET3A 3AURA 5FQPA 1RJKA 1SJ0A 2PITA 2QH6A 2GP7A 1WM0X 5M96A 2ABIA 1H9UA 5DXKA 5KRAA 2V7CA 4IU7A 2Q70A 4ZO1B 2GPUA 5E7VA 5ETHA 4ONIA 2NXXE 1NQ2A 2POGA 3R8AA 1XLSE 4RMEA 3G8OA 2AA2A 3B5RA 5KCDA 1PZLA 2V0VA 5DRJA 2ZK0A 2ZNOA 4WVDA 4A4WA 4OJBA 4IA7A 3IA6A 3U9QA 1T73A 2B1VA 3SP9A 3UU7B 3VT5A 3VT8A 4DM6A 2AX8A 1YYEA 3DZYA 3UU7A 1UPWA 2QTUA 4K4JA 4B7WA 1FCXA 2NPAA 3FALB 3OOKA 3P0UA 4X1GA 3UP3A 3X36A 4WQPA 4ZI1A 3ZRBA 2H79A 1T79A 3A3ZX 3FALA 4MDDA 4MGCA 5AWKA 3VHVA 2O4JA 3VRVA 4REEA 3FS1A 2P15A 4S14A 5DWLA 5DZHA 2G5OA 3WJ4A 1XAPA 4IQRA 4R2UA 5EGVA 5E15A 2I0GA 2QXSA 2ZK6A 4CSJA 2Q3YA 4DQMA 3KYTA 1M2ZA 2EWPA 3VJTA 4IS8A 4ZNWA 2ZK2A 4OH5A 5KYJA 5DVVA 1N4HA 3FEIA 2ZNPA 5E19A 3KBAA 2VV0A 3R8IA 3UVVB 5KRCA 1ILHA 5DU5A 1GWXA 2ZXZA 1FCZA 5AAVB 4F9MA 5JJMB 5DXEA 3V3EA 1X7EA 4IV4A 4OHAA 5AAVA 1XZXX 2QA8A 5FQRA 5JJMA 3BEJA 5DKGA 2ZVTA 3VN2A 3OAPA 4IW6A 1R20D 2J7YA 3ERTA 2Q8SA 2LBDA 4WLBA 1A28A 2Q7JA 4ZJWA 4N73A 1G2NA 4QK4A 1QKTA 5G44A 3DZUA 3B0QA 3D5FA 1EREA 5GIDA 2FSZA 2HCDA 4OEAA 4ITFA 5DXGA 5FQTA 2XKWA 5DX3A 3TKCA 1XPCA 4OGHA 4JGVA 3AN3A 3OMOA 1NYXA 3OS8C 4FGYA 5DMFA 2OZ7A 5DXRA 2ZNNA 4G1YA 5DL4A 4QJRA 1QKNA 3X31A 4NQAB 3AX8A 4MG9B 4POHA 4YT1A 4CI5A 5KCEA 2VV4B 3UP0A 5G5WA 4MG9A 4RZFA 3HQ5A 4ZNSA 4RFWA 4S15A 1Y0XX 4S0TA 5KCWA 4DK7A 1FM9D 2HVCA 4X1FA 4LSJA 1XV9B 4L98A 1X7RA 2NXXA 2PIQA 1HG4A 2FAIA 5DV6A 1ERRA 5E14A 2P54A 1XLSA 1XV9A 4JYGA 4Q50A 3W0AA 2OCFA 3VTCA 5HJPB 1I7IA 1YOWA 4XAOA 2BJ4B 5DRMA 3FC6B 5HJPA 3B66A 2BJ4A 1EXAA 1YJEA 2GIUA 4IUIA 3HC5A 3A78A 3QT0A 3FC6A 5DKEA 3G8IA 4E2JA 4CI4A 4WHGA 2VV3A 3KDTA 1R5KA 3SP6A 3RUUA 1U3QA 4OILA 3VJHA 3WGPA 1G5YA 3IMYA 3B0WA 3IPUA 4JYIA 3V4AA 3B1MA 1PQ9A 1G50A 5GIEA 3L3XA 3FURA 1ZUCA 3HO0A 3MNEA 3LMPA 5L7GA 2VSRA 1N83A 2ZL9A 4MG5A 3W5RA 2O9IA 2AA6A 4OKWA 5DYBA 3ET0A 5DSHA 3P89A 2QSEA 3ADVA 1Q4XA 1QKMA 4LNXA 3ADSA 4UDBA 2GPVA 2J7XA 1UOMA 4MGDB 3G0WA 2AM9A 4MGDA 4N1YA 2QXMA 4G21A 3K22A 1Z5XU 3WT6A 1BSXA 3DCTA 4NUFA 5APJA 2ZFXA 5KCFA 4KZMA 4TUZB 1S0XA 1MZNA 2YJAB 2VSTA 4K7AA 5EJVA 3RVFA 5APHA 3VJIA 3OGTA 4ZN9A 4TUZA 2ZKCA 3VT3A 5DP0A 2AX9A 3WJ5A 3UUDB 3RY9A 1X78A 2JFAB 2R40A 3K23A 2HB7A 4J5XA 3JZCA 5AVLA 3UUDA 2QNVA 2JFAA 1TXIA 3LBDA 4FHIA 5DLRA 3IPQA 5E0WA 2IOKA 3B68A 2FVJA 2PRGA 2YLPA 2XYJA 5JI0D 2ZY0A 3OLSA 2ZASA 4P6XA 2HAMA 2AMBA 5AAUA 4YPQA 2AB2A 1OT7A 3W0JA 1RKGA 3UUCA 3VJSA 4OKXA 2ZK1A 3R2AA 4HLWA 4PP6A 1RDTD 2Q5GA 5FQSA 1Y0SA 4QE6A 3V9YA 2ZK3A 3OLLA 3AZ3A 2HFPA 5DI7A 1K74A 5G3JA 5AZVA 1YINA 5HZCA 2Q6JA 3SZ1A 3L1BA 4OZTE 3CJWA 3CWDA 3GWXA 4MGBA 5AK2A 3DY6A 2OVHA 4ZNVA 2HWRA 3PEQA 5ICKA 5E0XA 5E1CA 1R1KD 2QE4A 1S9QA 4K6IA 2I4ZA 2ZXNA 3B67A 3V49A 5C4OA 4PXMA 2B23A 2PIRA 4OC7A 4PF3A 3NOAA 5DXBB 5DXMA 4OFRA 4OEYA 1FM6D 2QMVA 4OEDA 4NIEA 4OEZA 4LNWA 5DVCA 5DXBA 4EM9A 3ADUA 2PIXA 2HWQA 3IXPA 1M7WA 4ZNUA 3D6DA 3KFCA 2QGTA 2HARA 4XUHA 3VRTA 2OAXA 3OSWA 3R5MA 2PIOA 3FLIA 4PP5A 4UDDA 2QA8B 1VJBA 3TKMA 3OS9A 5G46A 3H0AD 4EMAA 4DM8A 5KRFA 4POJA 5KRJA 4QE8A 5KYAA 5L7HA 5F9BA 2YLQA 4XHDA 5DX3B 4FNEA 5KCTA 4OJ4A 2BAWA 3KPZA 3L0EA 3PCUA 3F5CA 1XP9A 1NQ1A 1YP0A 1ZKYA 3O1EA 4G1ZA 4RWVA 2J14A 3RLLA 3W0HA 3WTQA 4ZNTA 3CS6A 3KMGA 5DV3A 2P1UA 2OVMA 1PK5A 1X7BA 2Q5SA 4O8FA 3BQDA 4RZEA 3W5TA 4J5WA 1S9PA 3E00A 3W0CA 1OSHA 3VI8A 3RUTA 4OKTA 2ATHA 1ZDTA 2YLOA 1FCYA 4NB6A 3VT6A 1EXXA 3TX7B 1XOWA 1PQCA 3OMMA 4ZN7A 5CJ6A 2B50A 5KRLA 4OIVA 2F4BA 5KD9A 3ADXA 2QZOB 2YFEA 3OMQA 4PLEA 5GT4A 2ZK5A 3A2JA 3V9TA 2QZOA 2PIVA 4OLMA 2H77A 4DK8A 2ZBSA 3M7RA 3DR1A 1S19A 3L0LA 1NRLA 2AX6A 5DWEA 3GN8A 2NW4A 3DZYD 5B41A 1UPVA 4YMQA 1NQ0A 2OUZA 3HC6A 4IA3A 4RAKA 3MNPA 3VHUA 3PO9A 5DXQA 4WPFA 1FBYA 2R6YA 1NAXA 2Q7KA 5EITA 4QL8A 3ZQTA 1Z5XE 2QPYA 4FHHA 3V3QA 3OLFA 5DZ3A 3X1HA 2AAXA 3B0TA 3AZ2A 4UDCA 2HC4A 1YOKA
chains in the Genus database with same CATH topology
1RDTA 4TV1B 4OFUA 1GS4A 5DKSA 1Y9RA 2GTKA 1PCGA 2AA5A 4IVWA 4TV1A 5H1EA 5AWJA 1E3KA 4XI3A 3V9VA 5C4SA 3VT9A 2HBHA 4RMCA 3ADTA 3O1DA 4L96A 2P4YA 3CS4A 4XT9A 2R6WA 3W0IA 5IAWA 2HB8A 3KMRA 5C4TA 1KV6A 2Z4JA 3AZ1A 4LTWA 5DIDA 2AO6A 4E4KA 4PP3A 1PDUA 3OZJA 4PRGA 4IWCA 1KKQA 3HM1A 2I4JA 1U3SA 3GYTA 3GD2A 3DZUD 4A2JA 1MV9A 3FXVA 1T7TA 1FD0A 3K6PA 4S0SA 3PRGA 5DUEA 5EC9A 3VT7A 1YUCA 2PINA 4MG8B 4DORA 1ILGA 1SKXA 3FUGA 4MG8A 1NQ7A 3MNOA 3VTBA 3ET2A 2NV7A 2P7ZA 3JZBA 2REWA 5G42A 3NSPA 3RLJA 5DUHA 1UHLB 4APUA 3HVLA 1T63A 1YMTA 2AYRA 2QA6A 5DZIA 1UHLA 4PWLA 3A2IA 2Q60A 5DYDA 5KCCA 4OARA 5L7EA 1R20A 2Q59B 1YY4A 5LWPA 4RZGA 5DZ0A 1OSVA 2Q59A 1DKFB 2ZK4A 3B65A 3L3ZA 5KRIA 3G9EA 2QABA 4OKBA 3NSQA 2I0JA 1DKFA 4OZRU 5I4VA 4G2HA 4E4QA 5G43A 5FQVA 4NY9A 4ZNHA 5KR9A 3K8SA 3B3KA 1A52A 4MGBB 2YATA 3CDPA 1I7GA 4MG7B 5DIGA 3OZ0A 2AMAA 4MG7A 2PKLA 4ZO1X 1ZEOA 5AZTA 3GZ9A 3AUQA 3N00A 1KNUA 3L03A 1RKHA 2XYWA 2XHSA 2ZMJA 1YA3A 1SQNA 3CS8A 3PLZA 5DKBA 3P8XA 1L2IA 4XUMA 2GPOA 1FM9A 1IE8A 3A40X 3Q95B 5DUGA 3R5NA 1XDKB 4P6WA 1ZAFA 1ZH7A 4Q0AC 3Q95A 5A86A 2I4PA 2OM9A 3PBAA 3W5QA 5KROA 1XDKA 1X76A 3ILZA 4OK1A 2Q1HA 3GBKA 3IPSA 4J5XC 1G1UA 1XP6A 3AUNA 4IA1A 4Q13A 5HCVA 3UUAB 1N46A 3P88A 3WFGA 2ZNQA 3EYBA 1OVLB 3OS8A 3UUAA 3BC5A 5DY8A 5SYZA 4M8EA 1OVLA 2Z4BA 2GWXA 2P7GA 3GYUA 4LBDA 2J4AA 3VSPA 3E7CA 3T03A 1T7FA 3WWRA 1E3GA 1NHZA 4IVYA 4REFA 1TFCA 2ZMIA 4IA2A 4RUOX 1M13A 4PPSA 1PRGA 5EHJA 3F5CB 2G44A 3D57A 3FEJA 1LBDA 1P93A 5K13A 3KMZA 4N8RA 3B0RA 3WFFA 2R40D 3HLVA 4G20A 4PPPA 4R06A 3W0GA 1XIUA 5G45A 4OZTU 3CDSA 3UVVA 2XYXA 2YJDA 3GWSX 3VRWA 3X1IA 5HYRA 2GPPA 4G2IA 1QKUA 1X7JA 2IOGA 4N5GA 5KCUA 1NDEA 2AXAA 5EI1A 1ZGYA 1U3RA 2ACLB 5HJSA 1XB7A 3R29A 1YIMA 2ACLA 5DZ1A 2QR9A 3L0JA 2PIPL 1XQCA 2W8YA 5L11A 2G0HA 2E2RA 1I37A 4FN9A 5DIEA 5DMCA 3KDUA 3OMKA 2PIWA 1K74D 5DWJA 3ET1A 3OSIA 5C4UA 2A3IA 3VHWA 2PIUA 5B5BA 1S0ZA 5ACCA 3A9EB 4JYHA 3WMHA 1DB1A 4RUPA 1XVPB 3W0YA 4YNKA 1XNNA 1HJ1A 3A9EA 1NUOA 1XVPA 4DOSA 1I38A 4XTAA 5DWGA 2Q7IA 2Q6RA 5AVIA 5DVSA 1XNXA 2POBA 3OKHA 4KZIA 3VSOA 4UDAA 4J24A 1ZDUA 1GWRA 3AFRA 3WT7A 1NAVA 2VV4A 2YHDA 5DK9A 3TY0A 3ZR7A 4OH6A 4RUJA 1IE9A 1T76A 2PJLA 4MG6A 1XQ3A 1L2JA 3OMPA 1T74A 3ADWA 3AN4A 1GWQA 1SR7A 3IXPD 4JL4A 3VT4A 4JAZA 3HODA 3H52A 4IV2A 2ZLAA 2AWHA 3A2HA 4HEEX 4KZJA 4R6SA 4RMDA 1LV2A 4J26A 5GICA 4J5WC 2Q61A 1T7MA 2HASA 2QW4A 2JJ3A 2VV2A 3CQVA 5AYGA 2AA7A 1R1KA 5DTVA 1T7RA 1K7LA 2P1TA 5LGAA 2Q7LA 3KWYA 4G1DA 4OJ9A 1XP1A 1FM6A 4ZJRA 1T5ZA 2B1ZA 4OZRE 4BCRA 2Q1VA 3DCUA 3HZFA 3OOFA 5JY3A 4M8HA 5IZ0A 4DMAA 2Q6SA 3S9SA 3WT5A 3D24A 3CLDA 1P8DA 2Q5PA 5HYKA 4MGAB 4PLDA 4ZOMA 3W5PA 4OIUA 4Y29A 5DWIA 1RK3A 4MGAA 2GL8A 3R8DA 5DV8A 2P1VA 3F7DA 3ZRAA 4ITEA 3E00D 2P7AA 4RE8A 3VRUA 3D90A 2PNUA 1T65A 2IHQA 3VTDA 2ZLCA 1MVCA 4IWFA 3H0AA 2VV1B 2ZXMA 4QM0A 3DT3A 4PVUA 2VV1A 2JF9A 4A4VA 2ZMHA 1K4WA 5APKA 4XLDA 5DXPA 3ERDA 1Z95A 3CTBA 5KRHA 2G0GA 4IW8A 2AX7A 1U9EA 2O4RA 4WHFA 1PQ6A 5KRMA 3OKIA 3OSAA 5IXKA 5KRKA 2YLYA 1R6GA 3E94A 1XJ7A 2QGWA 3ET3A 3AURA 5FQPA 1RJKA 1SJ0A 2PITA 2QH6A 2GP7A 1WM0X 5M96A 2ABIA 1H9UA 5DXKA 5KRAA 2V7CA 4IU7A 2Q70A 4ZO1B 2GPUA 5E7VA 5ETHA 4ONIA 2NXXE 1NQ2A 2POGA 3R8AA 1XLSE 4RMEA 3G8OA 2AA2A 3B5RA 5KCDA 1PZLA 2V0VA 5DRJA 2ZK0A 2ZNOA 4WVDA 4A4WA 4OJBA 4IA7A 3IA6A 3U9QA 1T73A 2B1VA 3SP9A 3UU7B 3VT5A 3VT8A 4DM6A 2AX8A 1YYEA 3DZYA 3UU7A 1UPWA 2QTUA 4K4JA 4B7WA 1FCXA 2NPAA 3FALB 3OOKA 3P0UA 4X1GA 3UP3A 3X36A 4WQPA 4ZI1A 3ZRBA 2H79A 1T79A 3A3ZX 3FALA 4MDDA 4MGCA 5AWKA 3VHVA 2O4JA 3VRVA 4REEA 3FS1A 2P15A 4S14A 5DWLA 5DZHA 2G5OA 3WJ4A 1XAPA 4IQRA 4R2UA 5EGVA 5E15A 2I0GA 2QXSA 2ZK6A 4CSJA 2Q3YA 4DQMA 3KYTA 1M2ZA 2EWPA 3VJTA 4IS8A 4ZNWA 2ZK2A 4OH5A 5KYJA 5DVVA 1N4HA 3FEIA 2ZNPA 5E19A 3KBAA 2VV0A 3R8IA 3UVVB 5KRCA 1ILHA 5DU5A 1GWXA 2ZXZA 1FCZA 5AAVB 4F9MA 5JJMB 5DXEA 3V3EA 1X7EA 4IV4A 4OHAA 5AAVA 1XZXX 2QA8A 5FQRA 5JJMA 3BEJA 5DKGA 2ZVTA 3VN2A 3OAPA 4IW6A 1R20D 2J7YA 3ERTA 2Q8SA 2LBDA 4WLBA 1A28A 2Q7JA 4ZJWA 4N73A 1G2NA 4QK4A 1QKTA 5G44A 3DZUA 3B0QA 3D5FA 1EREA 5GIDA 2FSZA 2HCDA 4OEAA 4ITFA 5DXGA 5FQTA 2XKWA 5DX3A 3TKCA 1XPCA 4OGHA 4JGVA 3AN3A 3OMOA 1NYXA 3OS8C 4FGYA 5DMFA 2OZ7A 5DXRA 2ZNNA 4G1YA 5DL4A 4QJRA 1QKNA 3X31A 4NQAB 3AX8A 4MG9B 4POHA 4YT1A 4CI5A 5KCEA 2VV4B 3UP0A 5G5WA 4MG9A 4RZFA 3HQ5A 4ZNSA 4RFWA 4S15A 1Y0XX 4S0TA 5KCWA 4DK7A 1FM9D 2HVCA 4X1FA 4LSJA 1XV9B 4L98A 1X7RA 2NXXA 2PIQA 1HG4A 2FAIA 5DV6A 1ERRA 5E14A 2P54A 1XLSA 1XV9A 4JYGA 4Q50A 3W0AA 2OCFA 3VTCA 5HJPB 1I7IA 1YOWA 4XAOA 2BJ4B 5DRMA 3FC6B 5HJPA 3B66A 2BJ4A 1EXAA 1YJEA 2GIUA 4IUIA 3HC5A 3A78A 3QT0A 3FC6A 5DKEA 3G8IA 4E2JA 4CI4A 4WHGA 2VV3A 3KDTA 1R5KA 3SP6A 3RUUA 1U3QA 4OILA 3VJHA 3WGPA 1G5YA 3IMYA 3B0WA 3IPUA 4JYIA 3V4AA 3B1MA 1PQ9A 1G50A 5GIEA 3L3XA 3FURA 1ZUCA 3HO0A 3MNEA 3LMPA 5L7GA 2VSRA 1N83A 2ZL9A 4MG5A 3W5RA 2O9IA 2AA6A 4OKWA 5DYBA 3ET0A 5DSHA 3P89A 2QSEA 3ADVA 1Q4XA 1QKMA 4LNXA 3ADSA 4UDBA 2GPVA 2J7XA 1UOMA 4MGDB 3G0WA 2AM9A 4MGDA 4N1YA 2QXMA 4G21A 3K22A 1Z5XU 3WT6A 1BSXA 3DCTA 4NUFA 5APJA 2ZFXA 5KCFA 4KZMA 4TUZB 1S0XA 1MZNA 2YJAB 2VSTA 4K7AA 5EJVA 3RVFA 5APHA 3VJIA 3OGTA 4ZN9A 4TUZA 2ZKCA 3VT3A 5DP0A 2AX9A 3WJ5A 3UUDB 3RY9A 1X78A 2JFAB 2R40A 3K23A 2HB7A 4J5XA 3JZCA 5AVLA 3UUDA 2QNVA 2JFAA 1TXIA 3LBDA 4FHIA 5DLRA 3IPQA 5E0WA 2IOKA 3B68A 2FVJA 2PRGA 2YLPA 2XYJA 5JI0D 2ZY0A 3OLSA 2ZASA 4P6XA 2HAMA 2AMBA 5AAUA 4YPQA 2AB2A 1OT7A 3W0JA 1RKGA 3UUCA 3VJSA 4OKXA 2ZK1A 3R2AA 4HLWA 4PP6A 1RDTD 2Q5GA 5FQSA 1Y0SA 4QE6A 3V9YA 2ZK3A 3OLLA 3AZ3A 2HFPA 5DI7A 1K74A 5G3JA 5AZVA 1YINA 5HZCA 2Q6JA 3SZ1A 3L1BA 4OZTE 3CJWA 3CWDA 3GWXA 4MGBA 5AK2A 3DY6A 2OVHA 4ZNVA 2HWRA 3PEQA 5ICKA 5E0XA 5E1CA 1R1KD 2QE4A 1S9QA 4K6IA 2I4ZA 2ZXNA 3B67A 3V49A 5C4OA 4PXMA 2B23A 2PIRA 4OC7A 4PF3A 3NOAA 5DXBB 5DXMA 4OFRA 4OEYA 1FM6D 2QMVA 4OEDA 4NIEA 4OEZA 4LNWA 5DVCA 5DXBA 4EM9A 3ADUA 2PIXA 2HWQA 3IXPA 1M7WA 4ZNUA 3D6DA 3KFCA 2QGTA 2HARA 4XUHA 3VRTA 2OAXA 3OSWA 3R5MA 2PIOA 3FLIA 4PP5A 4UDDA 2QA8B 1VJBA 3TKMA 3OS9A 5G46A 3H0AD 4EMAA 4DM8A 5KRFA 4POJA 5KRJA 4QE8A 5KYAA 5L7HA 5F9BA 2YLQA 4XHDA 5DX3B 4FNEA 5KCTA 4OJ4A 2BAWA 3KPZA 3L0EA 3PCUA 3F5CA 1XP9A 1NQ1A 1YP0A 1ZKYA 3O1EA 4G1ZA 4RWVA 2J14A 3RLLA 3W0HA 3WTQA 4ZNTA 3CS6A 3KMGA 5DV3A 2P1UA 2OVMA 1PK5A 1X7BA 2Q5SA 4O8FA 3BQDA 4RZEA 3W5TA 4J5WA 1S9PA 3E00A 3W0CA 1OSHA 3VI8A 3RUTA 4OKTA 2ATHA 1ZDTA 2YLOA 1FCYA 4NB6A 3VT6A 1EXXA 3TX7B 1XOWA 1PQCA 3OMMA 4ZN7A 5CJ6A 2B50A 5KRLA 4OIVA 2F4BA 5KD9A 3ADXA 2QZOB 2YFEA 3OMQA 4PLEA 5GT4A 2ZK5A 3A2JA 3V9TA 2QZOA 2PIVA 4OLMA 2H77A 4DK8A 2ZBSA 3M7RA 3DR1A 1S19A 3L0LA 1NRLA 2AX6A 5DWEA 3GN8A 2NW4A 3DZYD 5B41A 1UPVA 4YMQA 1NQ0A 2OUZA 3HC6A 4IA3A 4RAKA 3MNPA 3VHUA 3PO9A 5DXQA 4WPFA 1FBYA 2R6YA 1NAXA 2Q7KA 5EITA 4QL8A 3ZQTA 1Z5XE 2QPYA 4FHHA 3V3QA 3OLFA 5DZ3A 3X1HA 2AAXA 3B0TA 3AZ2A 4UDCA 2HC4A 1YOKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RDT A;  4TV1 B;  4OFU A;  1GS4 A;  5DKS A;  1Y9R A;  2GTK A;  1PCG A;  2AA5 A;  4IVW A;  4TV1 A;  5H1E A;  5AWJ A;  1E3K A;  4XI3 A;  3V9V A;  5C4S A;  3VT9 A;  2HBH A;  4RMC A;  3ADT A;  3O1D A;  4L96 A;  2P4Y A;  3CS4 A;  4XT9 A;  2R6W A;  3W0I A;  5IAW A;  2HB8 A;  3KMR A;  5C4T A;  1KV6 A;  2Z4J A;  3AZ1 A;  4LTW A;  5DID A;  2AO6 A;  4E4K A;  4PP3 A;  1PDU A;  3OZJ A;  4PRG A;  4IWC A;  1KKQ A;  3HM1 A;  2I4J A;  1U3S A;  3GYT A;  3GD2 A;  3DZU D;  4A2J A;  1MV9 A;  3FXV A;  1T7T A;  1FD0 A;  3K6P A;  4S0S A;  3PRG A;  5DUE A;  5EC9 A;  3VT7 A;  1YUC A;  2PIN A;  4MG8 B;  4DOR A;  1ILG A;  1SKX A;  3FUG A;  4MG8 A;  1NQ7 A;  3MNO A;  3VTB A;  3ET2 A;  2NV7 A;  2P7Z A;  3JZB A;  2REW A;  5G42 A;  3NSP A;  3RLJ A;  5DUH A;  1UHL B;  4APU A;  3HVL A;  1T63 A;  1YMT A;  2AYR A;  2QA6 A;  5DZI A;  1UHL A;  4PWL A;  3A2I A;  2Q60 A;  5DYD A;  5KCC A;  4OAR A;  5L7E A;  1R20 A;  2Q59 B;  1YY4 A;  5LWP A;  4RZG A;  5DZ0 A;  1OSV A;  2Q59 A;  1DKF B;  2ZK4 A;  3B65 A;  3L3Z A;  5KRI A;  3G9E A;  2QAB A;  4OKB A;  3NSQ A;  2I0J A;  1DKF A;  4OZR U;  5I4V A;  4G2H A;  4E4Q A;  5G43 A;  5FQV A;  4NY9 A;  4ZNH A;  5KR9 A;  3K8S A;  3B3K A;  1A52 A;  4MGB B;  2YAT A;  3CDP A;  1I7G A;  4MG7 B;  5DIG A;  3OZ0 A;  2AMA A;  4MG7 A;  2PKL A;  4ZO1 X;  1ZEO A;  5AZT A;  3GZ9 A;  3AUQ A;  3N00 A;  1KNU A;  3L03 A;  1RKH A;  2XYW A;  2XHS A;  2ZMJ A;  1YA3 A;  1SQN A;  3CS8 A;  3PLZ A;  5DKB A;  3P8X A;  1L2I A;  4XUM A;  2GPO A;  1FM9 A;  1IE8 A;  3A40 X;  3Q95 B;  5DUG A;  3R5N A;  1XDK B;  4P6W A;  1ZAF A;  1ZH7 A;  4Q0A C;  3Q95 A;  5A86 A;  2I4P A;  2OM9 A;  3PBA A;  3W5Q A;  5KRO A;  1XDK A;  1X76 A;  3ILZ A;  4OK1 A;  2Q1H A;  3GBK A;  3IPS A;  4J5X C;  1G1U A;  1XP6 A;  3AUN A;  4IA1 A;  4Q13 A;  5HCV A;  3UUA B;  1N46 A;  3P88 A;  3WFG A;  2ZNQ A;  3EYB A;  1OVL B;  3OS8 A;  3UUA A;  3BC5 A;  5DY8 A;  5SYZ A;  4M8E A;  1OVL A;  2Z4B A;  2GWX A;  2P7G A;  3GYU A;  4LBD A;  2J4A A;  3VSP A;  3E7C A;  3T03 A;  1T7F A;  3WWR A;  1E3G A;  1NHZ A;  4IVY A;  4REF A;  1TFC A;  2ZMI A;  4IA2 A;  4RUO X;  1M13 A;  4PPS A;  1PRG A;  5EHJ A;  3F5C B;  2G44 A;  3D57 A;  3FEJ A;  1LBD A;  1P93 A;  5K13 A;  3KMZ A;  4N8R A;  3B0R A;  3WFF A;  2R40 D;  3HLV A;  4G20 A;  4PPP A;  4R06 A;  3W0G A;  1XIU A;  5G45 A;  4OZT U;  3CDS A;  3UVV A;  2XYX A;  2YJD A;  3GWS X;  3VRW A;  3X1I A;  5HYR A;  2GPP A;  4G2I A;  1QKU A;  1X7J A;  2IOG A;  4N5G A;  5KCU A;  1NDE A;  2AXA A;  5EI1 A;  1ZGY A;  1U3R A;  2ACL B;  5HJS A;  1XB7 A;  3R29 A;  1YIM A;  2ACL A;  5DZ1 A;  2QR9 A;  3L0J A;  2PIP L;  1XQC A;  2W8Y A;  5L11 A;  2G0H A;  2E2R A;  1I37 A;  4FN9 A;  5DIE A;  5DMC A;  3KDU A;  3OMK A;  2PIW A;  1K74 D;  5DWJ A;  3ET1 A;  3OSI A;  5C4U A;  2A3I A;  3VHW A;  2PIU A;  5B5B A;  1S0Z A;  5ACC A;  3A9E B;  4JYH A;  3WMH A;  1DB1 A;  4RUP A;  1XVP B;  3W0Y A;  4YNK A;  1XNN A;  1HJ1 A;  3A9E A;  1NUO A;  1XVP A;  4DOS A;  1I38 A;  4XTA A;  5DWG A;  2Q7I A;  2Q6R A;  5AVI A;  5DVS A;  1XNX A;  2POB A;  3OKH A;  4KZI A;  3VSO A;  4UDA A;  4J24 A;  1ZDU A;  1GWR A;  3AFR A;  3WT7 A;  1NAV A;  2VV4 A;  2YHD A;  5DK9 A;  3TY0 A;  3ZR7 A;  4OH6 A;  4RUJ A;  1IE9 A;  1T76 A;  2PJL A;  4MG6 A;  1XQ3 A;  1L2J A;  3OMP A;  1T74 A;  3ADW A;  3AN4 A;  1GWQ A;  1SR7 A;  3IXP D;  4JL4 A;  3VT4 A;  4JAZ A;  3HOD A;  3H52 A;  4IV2 A;  2ZLA A;  2AWH A;  3A2H A;  4HEE X;  4KZJ A;  4R6S A;  4RMD A;  1LV2 A;  4J26 A;  5GIC A;  4J5W C;  2Q61 A;  1T7M A;  2HAS A;  2QW4 A;  2JJ3 A;  2VV2 A;  3CQV A;  5AYG A;  2AA7 A;  1R1K A;  5DTV A;  1T7R A;  1K7L A;  2P1T A;  5LGA A;  2Q7L A;  3KWY A;  4G1D A;  4OJ9 A;  1XP1 A;  1FM6 A;  4ZJR A;  1T5Z A;  2B1Z A;  4OZR E;  4BCR A;  2Q1V A;  3DCU A;  3HZF A;  3OOF A;  5JY3 A;  4M8H A;  5IZ0 A;  4DMA A;  2Q6S A;  3S9S A;  3WT5 A;  3D24 A;  3CLD A;  1P8D A;  2Q5P A;  5HYK A;  4MGA B;  4PLD A;  4ZOM A;  3W5P A;  4OIU A;  4Y29 A;  5DWI A;  1RK3 A;  4MGA A;  2GL8 A;  3R8D A;  5DV8 A;  2P1V A;  3F7D A;  3ZRA A;  4ITE A;  3E00 D;  2P7A A;  4RE8 A;  3VRU A;  3D90 A;  2PNU A;  1T65 A;  2IHQ A;  3VTD A;  2ZLC A;  1MVC A;  4IWF A;  3H0A A;  2VV1 B;  2ZXM A;  4QM0 A;  3DT3 A;  4PVU A;  2VV1 A;  2JF9 A;  4A4V A;  2ZMH A;  1K4W A;  5APK A;  4XLD A;  5DXP A;  3ERD A;  1Z95 A;  3CTB A;  5KRH A;  2G0G A;  4IW8 A;  2AX7 A;  1U9E A;  2O4R A;  4WHF A;  1PQ6 A;  5KRM A;  3OKI A;  3OSA A;  5IXK A;  5KRK A;  2YLY A;  1R6G A;  3E94 A;  1XJ7 A;  2QGW A;  3ET3 A;  3AUR A;  5FQP A;  1RJK A;  1SJ0 A;  2PIT A;  2QH6 A;  2GP7 A;  1WM0 X;  5M96 A;  2ABI A;  1H9U A;  5DXK A;  5KRA A;  2V7C A;  4IU7 A;  2Q70 A;  4ZO1 B;  2GPU A;  5E7V A;  5ETH A;  4ONI A;  2NXX E;  1NQ2 A;  2POG A;  3R8A A;  1XLS E;  4RME A;  3G8O A;  2AA2 A;  3B5R A;  5KCD A;  1PZL A;  2V0V A;  5DRJ A;  2ZK0 A;  2ZNO A;  4WVD A;  4A4W A;  4OJB A;  4IA7 A;  3IA6 A;  3U9Q A;  1T73 A;  2B1V A;  3SP9 A;  3UU7 B;  3VT5 A;  3VT8 A;  4DM6 A;  2AX8 A;  1YYE A;  3DZY A;  3UU7 A;  1UPW A;  2QTU A;  4K4J A;  4B7W A;  1FCX A;  2NPA A;  3FAL B;  3OOK A;  3P0U A;  4X1G A;  3UP3 A;  3X36 A;  4WQP A;  4ZI1 A;  3ZRB A;  2H79 A;  1T79 A;  3A3Z X;  3FAL A;  4MDD A;  4MGC A;  5AWK A;  3VHV A;  2O4J A;  3VRV A;  4REE A;  3FS1 A;  2P15 A;  4S14 A;  5DWL A;  5DZH A;  2G5O A;  3WJ4 A;  1XAP A;  4IQR A;  4R2U A;  5EGV A;  5E15 A;  2I0G A;  2QXS A;  2ZK6 A;  4CSJ A;  2Q3Y A;  4DQM A;  3KYT A;  1M2Z A;  2EWP A;  3VJT A;  4IS8 A;  4ZNW A;  2ZK2 A;  4OH5 A;  5KYJ A;  5DVV A;  1N4H A;  3FEI A;  2ZNP A;  5E19 A;  3KBA A;  2VV0 A;  3R8I A;  3UVV B;  5KRC A;  1ILH A;  5DU5 A;  1GWX A;  2ZXZ A;  1FCZ A;  5AAV B;  4F9M A;  5JJM B;  5DXE A;  3V3E A;  1X7E A;  4IV4 A;  4OHA A;  5AAV A;  1XZX X;  2QA8 A;  5FQR A;  5JJM A;  3BEJ A;  5DKG A;  2ZVT A;  3VN2 A;  3OAP A;  4IW6 A;  1R20 D;  2J7Y A;  3ERT A;  2Q8S A;  2LBD A;  4WLB A;  1A28 A;  2Q7J A;  4ZJW A;  4N73 A;  1G2N A;  4QK4 A;  1QKT A;  5G44 A;  3DZU A;  3B0Q A;  3D5F A;  1ERE A;  5GID A;  2FSZ A;  2HCD A;  4OEA A;  4ITF A;  5DXG A;  5FQT A;  2XKW A;  5DX3 A;  3TKC A;  1XPC A;  4OGH A;  4JGV A;  3AN3 A;  3OMO A;  1NYX A;  3OS8 C;  4FGY A;  5DMF A;  2OZ7 A;  5DXR A;  2ZNN A;  4G1Y A;  5DL4 A;  4QJR A;  1QKN A;  3X31 A;  4NQA B;  3AX8 A;  4MG9 B;  4POH A;  4YT1 A;  4CI5 A;  5KCE A;  2VV4 B;  3UP0 A;  5G5W A;  4MG9 A;  4RZF A;  3HQ5 A;  4ZNS A;  4RFW A;  4S15 A;  1Y0X X;  4S0T A;  5KCW A;  4DK7 A;  1FM9 D;  2HVC A;  4X1F A;  4LSJ A;  1XV9 B;  4L98 A;  1X7R A;  2NXX A;  2PIQ A;  1HG4 A;  2FAI A;  5DV6 A;  1ERR A;  5E14 A;  2P54 A;  1XLS A;  1XV9 A;  4JYG A;  4Q50 A;  3W0A A;  2OCF A;  3VTC A;  5HJP B;  1I7I A;  1YOW A;  4XAO A;  2BJ4 B;  5DRM A;  3FC6 B;  5HJP A;  3B66 A;  2BJ4 A;  1EXA A;  1YJE A;  2GIU A;  4IUI A;  3HC5 A;  3A78 A;  3QT0 A;  3FC6 A;  5DKE A;  3G8I A;  4E2J A;  4CI4 A;  4WHG A;  2VV3 A;  3KDT A;  1R5K A;  3SP6 A;  3RUU A;  1U3Q A;  4OIL A;  3VJH A;  3WGP A;  1G5Y A;  3IMY A;  3B0W A;  3IPU A;  4JYI A;  3V4A A;  3B1M A;  1PQ9 A;  1G50 A;  5GIE A;  3L3X A;  3FUR A;  1ZUC A;  3HO0 A;  3MNE A;  3LMP A;  5L7G A;  2VSR A;  1N83 A;  2ZL9 A;  4MG5 A;  3W5R A;  2O9I A;  2AA6 A;  4OKW A;  5DYB A;  3ET0 A;  5DSH A;  3P89 A;  2QSE A;  3ADV A;  1Q4X A;  1QKM A;  4LNX A;  3ADS A;  4UDB A;  2GPV A;  2J7X A;  1UOM A;  4MGD B;  3G0W A;  2AM9 A;  4MGD A;  4N1Y A;  2QXM A;  4G21 A;  3K22 A;  1Z5X U;  3WT6 A;  1BSX A;  3DCT A;  4NUF A;  5APJ A;  2ZFX A;  5KCF A;  4KZM A;  4TUZ B;  1S0X A;  1MZN A;  2YJA B;  2VST A;  4K7A A;  5EJV A;  3RVF A;  5APH A;  3VJI A;  3OGT A;  4ZN9 A;  4TUZ A;  2ZKC A;  3VT3 A;  5DP0 A;  2AX9 A;  3WJ5 A;  3UUD B;  3RY9 A;  1X78 A;  2JFA B;  2R40 A;  3K23 A;  2HB7 A;  4J5X A;  3JZC A;  5AVL A;  3UUD A;  2QNV A;  2JFA A;  1TXI A;  3LBD A;  4FHI A;  5DLR A;  3IPQ A;  5E0W A;  2IOK A;  3B68 A;  2FVJ A;  2PRG A;  2YLP A;  2XYJ A;  5JI0 D;  2ZY0 A;  3OLS A;  2ZAS A;  4P6X A;  2HAM A;  2AMB A;  5AAU A;  4YPQ A;  2AB2 A;  1OT7 A;  3W0J A;  1RKG A;  3UUC A;  3VJS A;  4OKX A;  2ZK1 A;  3R2A A;  4HLW A;  4PP6 A;  1RDT D;  2Q5G A;  5FQS A;  1Y0S A;  4QE6 A;  3V9Y A;  2ZK3 A;  3OLL A;  3AZ3 A;  2HFP A;  5DI7 A;  1K74 A;  5G3J A;  5AZV A;  1YIN A;  5HZC A;  2Q6J A;  3SZ1 A;  3L1B A;  4OZT E;  3CJW A;  3CWD A;  3GWX A;  4MGB A;  5AK2 A;  3DY6 A;  2OVH A;  4ZNV A;  2HWR A;  3PEQ A;  5ICK A;  5E0X A;  5E1C A;  1R1K D;  2QE4 A;  1S9Q A;  4K6I A;  2I4Z A;  2ZXN A;  3B67 A;  3V49 A;  5C4O A;  4PXM A;  2B23 A;  2PIR A;  4OC7 A;  4PF3 A;  3NOA A;  5DXB B;  5DXM A;  4OFR A;  4OEY A;  1FM6 D;  2QMV A;  4OED A;  4NIE A;  4OEZ A;  4LNW A;  5DVC A;  5DXB A;  4EM9 A;  3ADU A;  2PIX A;  2HWQ A;  3IXP A;  1M7W A;  4ZNU A;  3D6D A;  3KFC A;  2QGT A;  2HAR A;  4XUH A;  3VRT A;  2OAX A;  3OSW A;  3R5M A;  2PIO A;  3FLI A;  4PP5 A;  4UDD A;  2QA8 B;  1VJB A;  3TKM A;  3OS9 A;  5G46 A;  3H0A D;  4EMA A;  4DM8 A;  5KRF A;  4POJ A;  5KRJ A;  4QE8 A;  5KYA A;  5L7H A;  5F9B A;  2YLQ A;  4XHD A;  5DX3 B;  4FNE A;  5KCT A;  4OJ4 A;  2BAW A;  3KPZ A;  3L0E A;  3PCU A;  3F5C A;  1XP9 A;  1NQ1 A;  1YP0 A;  1ZKY A;  3O1E A;  4G1Z A;  4RWV A;  2J14 A;  3RLL A;  3W0H A;  3WTQ A;  4ZNT A;  3CS6 A;  3KMG A;  5DV3 A;  2P1U A;  2OVM A;  1PK5 A;  1X7B A;  2Q5S A;  4O8F A;  3BQD A;  4RZE A;  3W5T A;  4J5W A;  1S9P A;  3E00 A;  3W0C A;  1OSH A;  3VI8 A;  3RUT A;  4OKT A;  2ATH A;  1ZDT A;  2YLO A;  1FCY A;  4NB6 A;  3VT6 A;  1EXX A;  3TX7 B;  1XOW A;  1PQC A;  3OMM A;  4ZN7 A;  5CJ6 A;  2B50 A;  5KRL A;  4OIV A;  2F4B A;  5KD9 A;  3ADX A;  2QZO B;  2YFE A;  3OMQ A;  4PLE A;  5GT4 A;  2ZK5 A;  3A2J A;  3V9T A;  2QZO A;  2PIV A;  4OLM A;  2H77 A;  4DK8 A;  2ZBS A;  3M7R A;  3DR1 A;  1S19 A;  3L0L A;  1NRL A;  2AX6 A;  5DWE A;  3GN8 A;  2NW4 A;  3DZY D;  5B41 A;  1UPV A;  4YMQ A;  1NQ0 A;  2OUZ A;  3HC6 A;  4IA3 A;  4RAK A;  3MNP A;  3VHU A;  3PO9 A;  5DXQ A;  4WPF A;  1FBY A;  2R6Y A;  1NAX A;  2Q7K A;  5EIT A;  4QL8 A;  3ZQT A;  1Z5X E;  2QPY A;  4FHH A;  3V3Q A;  3OLF A;  5DZ3 A;  3X1H A;  2AAX A;  3B0T A;  3AZ2 A;  4UDC A;  2HC4 A;  1YOK A; 
#chains in the Genus database with same CATH topology
 1RDT A;  4TV1 B;  4OFU A;  1GS4 A;  5DKS A;  1Y9R A;  2GTK A;  1PCG A;  2AA5 A;  4IVW A;  4TV1 A;  5H1E A;  5AWJ A;  1E3K A;  4XI3 A;  3V9V A;  5C4S A;  3VT9 A;  2HBH A;  4RMC A;  3ADT A;  3O1D A;  4L96 A;  2P4Y A;  3CS4 A;  4XT9 A;  2R6W A;  3W0I A;  5IAW A;  2HB8 A;  3KMR A;  5C4T A;  1KV6 A;  2Z4J A;  3AZ1 A;  4LTW A;  5DID A;  2AO6 A;  4E4K A;  4PP3 A;  1PDU A;  3OZJ A;  4PRG A;  4IWC A;  1KKQ A;  3HM1 A;  2I4J A;  1U3S A;  3GYT A;  3GD2 A;  3DZU D;  4A2J A;  1MV9 A;  3FXV A;  1T7T A;  1FD0 A;  3K6P A;  4S0S A;  3PRG A;  5DUE A;  5EC9 A;  3VT7 A;  1YUC A;  2PIN A;  4MG8 B;  4DOR A;  1ILG A;  1SKX A;  3FUG A;  4MG8 A;  1NQ7 A;  3MNO A;  3VTB A;  3ET2 A;  2NV7 A;  2P7Z A;  3JZB A;  2REW A;  5G42 A;  3NSP A;  3RLJ A;  5DUH A;  1UHL B;  4APU A;  3HVL A;  1T63 A;  1YMT A;  2AYR A;  2QA6 A;  5DZI A;  1UHL A;  4PWL A;  3A2I A;  2Q60 A;  5DYD A;  5KCC A;  4OAR A;  5L7E A;  1R20 A;  2Q59 B;  1YY4 A;  5LWP A;  4RZG A;  5DZ0 A;  1OSV A;  2Q59 A;  1DKF B;  2ZK4 A;  3B65 A;  3L3Z A;  5KRI A;  3G9E A;  2QAB A;  4OKB A;  3NSQ A;  2I0J A;  1DKF A;  4OZR U;  5I4V A;  4G2H A;  4E4Q A;  5G43 A;  5FQV A;  4NY9 A;  4ZNH A;  5KR9 A;  3K8S A;  3B3K A;  1A52 A;  4MGB B;  2YAT A;  3CDP A;  1I7G A;  4MG7 B;  5DIG A;  3OZ0 A;  2AMA A;  4MG7 A;  2PKL A;  4ZO1 X;  1ZEO A;  5AZT A;  3GZ9 A;  3AUQ A;  3N00 A;  1KNU A;  3L03 A;  1RKH A;  2XYW A;  2XHS A;  2ZMJ A;  1YA3 A;  1SQN A;  3CS8 A;  3PLZ A;  5DKB A;  3P8X A;  1L2I A;  4XUM A;  2GPO A;  1FM9 A;  1IE8 A;  3A40 X;  3Q95 B;  5DUG A;  3R5N A;  1XDK B;  4P6W A;  1ZAF A;  1ZH7 A;  4Q0A C;  3Q95 A;  5A86 A;  2I4P A;  2OM9 A;  3PBA A;  3W5Q A;  5KRO A;  1XDK A;  1X76 A;  3ILZ A;  4OK1 A;  2Q1H A;  3GBK A;  3IPS A;  4J5X C;  1G1U A;  1XP6 A;  3AUN A;  4IA1 A;  4Q13 A;  5HCV A;  3UUA B;  1N46 A;  3P88 A;  3WFG A;  2ZNQ A;  3EYB A;  1OVL B;  3OS8 A;  3UUA A;  3BC5 A;  5DY8 A;  5SYZ A;  4M8E A;  1OVL A;  2Z4B A;  2GWX A;  2P7G A;  3GYU A;  4LBD A;  2J4A A;  3VSP A;  3E7C A;  3T03 A;  1T7F A;  3WWR A;  1E3G A;  1NHZ A;  4IVY A;  4REF A;  1TFC A;  2ZMI A;  4IA2 A;  4RUO X;  1M13 A;  4PPS A;  1PRG A;  5EHJ A;  3F5C B;  2G44 A;  3D57 A;  3FEJ A;  1LBD A;  1P93 A;  5K13 A;  3KMZ A;  4N8R A;  3B0R A;  3WFF A;  2R40 D;  3HLV A;  4G20 A;  4PPP A;  4R06 A;  3W0G A;  1XIU A;  5G45 A;  4OZT U;  3CDS A;  3UVV A;  2XYX A;  2YJD A;  3GWS X;  3VRW A;  3X1I A;  5HYR A;  2GPP A;  4G2I A;  1QKU A;  1X7J A;  2IOG A;  4N5G A;  5KCU A;  1NDE A;  2AXA A;  5EI1 A;  1ZGY A;  1U3R A;  2ACL B;  5HJS A;  1XB7 A;  3R29 A;  1YIM A;  2ACL A;  5DZ1 A;  2QR9 A;  3L0J A;  2PIP L;  1XQC A;  2W8Y A;  5L11 A;  2G0H A;  2E2R A;  1I37 A;  4FN9 A;  5DIE A;  5DMC A;  3KDU A;  3OMK A;  2PIW A;  1K74 D;  5DWJ A;  3ET1 A;  3OSI A;  5C4U A;  2A3I A;  3VHW A;  2PIU A;  5B5B A;  1S0Z A;  5ACC A;  3A9E B;  4JYH A;  3WMH A;  1DB1 A;  4RUP A;  1XVP B;  3W0Y A;  4YNK A;  1XNN A;  1HJ1 A;  3A9E A;  1NUO A;  1XVP A;  4DOS A;  1I38 A;  4XTA A;  5DWG A;  2Q7I A;  2Q6R A;  5AVI A;  5DVS A;  1XNX A;  2POB A;  3OKH A;  4KZI A;  3VSO A;  4UDA A;  4J24 A;  1ZDU A;  1GWR A;  3AFR A;  3WT7 A;  1NAV A;  2VV4 A;  2YHD A;  5DK9 A;  3TY0 A;  3ZR7 A;  4OH6 A;  4RUJ A;  1IE9 A;  1T76 A;  2PJL A;  4MG6 A;  1XQ3 A;  1L2J A;  3OMP A;  1T74 A;  3ADW A;  3AN4 A;  1GWQ A;  1SR7 A;  3IXP D;  4JL4 A;  3VT4 A;  4JAZ A;  3HOD A;  3H52 A;  4IV2 A;  2ZLA A;  2AWH A;  3A2H A;  4HEE X;  4KZJ A;  4R6S A;  4RMD A;  1LV2 A;  4J26 A;  5GIC A;  4J5W C;  2Q61 A;  1T7M A;  2HAS A;  2QW4 A;  2JJ3 A;  2VV2 A;  3CQV A;  5AYG A;  2AA7 A;  1R1K A;  5DTV A;  1T7R A;  1K7L A;  2P1T A;  5LGA A;  2Q7L A;  3KWY A;  4G1D A;  4OJ9 A;  1XP1 A;  1FM6 A;  4ZJR A;  1T5Z A;  2B1Z A;  4OZR E;  4BCR A;  2Q1V A;  3DCU A;  3HZF A;  3OOF A;  5JY3 A;  4M8H A;  5IZ0 A;  4DMA A;  2Q6S A;  3S9S A;  3WT5 A;  3D24 A;  3CLD A;  1P8D A;  2Q5P A;  5HYK A;  4MGA B;  4PLD A;  4ZOM A;  3W5P A;  4OIU A;  4Y29 A;  5DWI A;  1RK3 A;  4MGA A;  2GL8 A;  3R8D A;  5DV8 A;  2P1V A;  3F7D A;  3ZRA A;  4ITE A;  3E00 D;  2P7A A;  4RE8 A;  3VRU A;  3D90 A;  2PNU A;  1T65 A;  2IHQ A;  3VTD A;  2ZLC A;  1MVC A;  4IWF A;  3H0A A;  2VV1 B;  2ZXM A;  4QM0 A;  3DT3 A;  4PVU A;  2VV1 A;  2JF9 A;  4A4V A;  2ZMH A;  1K4W A;  5APK A;  4XLD A;  5DXP A;  3ERD A;  1Z95 A;  3CTB A;  5KRH A;  2G0G A;  4IW8 A;  2AX7 A;  1U9E A;  2O4R A;  4WHF A;  1PQ6 A;  5KRM A;  3OKI A;  3OSA A;  5IXK A;  5KRK A;  2YLY A;  1R6G A;  3E94 A;  1XJ7 A;  2QGW A;  3ET3 A;  3AUR A;  5FQP A;  1RJK A;  1SJ0 A;  2PIT A;  2QH6 A;  2GP7 A;  1WM0 X;  5M96 A;  2ABI A;  1H9U A;  5DXK A;  5KRA A;  2V7C A;  4IU7 A;  2Q70 A;  4ZO1 B;  2GPU A;  5E7V A;  5ETH A;  4ONI A;  2NXX E;  1NQ2 A;  2POG A;  3R8A A;  1XLS E;  4RME A;  3G8O A;  2AA2 A;  3B5R A;  5KCD A;  1PZL A;  2V0V A;  5DRJ A;  2ZK0 A;  2ZNO A;  4WVD A;  4A4W A;  4OJB A;  4IA7 A;  3IA6 A;  3U9Q A;  1T73 A;  2B1V A;  3SP9 A;  3UU7 B;  3VT5 A;  3VT8 A;  4DM6 A;  2AX8 A;  1YYE A;  3DZY A;  3UU7 A;  1UPW A;  2QTU A;  4K4J A;  4B7W A;  1FCX A;  2NPA A;  3FAL B;  3OOK A;  3P0U A;  4X1G A;  3UP3 A;  3X36 A;  4WQP A;  4ZI1 A;  3ZRB A;  2H79 A;  1T79 A;  3A3Z X;  3FAL A;  4MDD A;  4MGC A;  5AWK A;  3VHV A;  2O4J A;  3VRV A;  4REE A;  3FS1 A;  2P15 A;  4S14 A;  5DWL A;  5DZH A;  2G5O A;  3WJ4 A;  1XAP A;  4IQR A;  4R2U A;  5EGV A;  5E15 A;  2I0G A;  2QXS A;  2ZK6 A;  4CSJ A;  2Q3Y A;  4DQM A;  3KYT A;  1M2Z A;  2EWP A;  3VJT A;  4IS8 A;  4ZNW A;  2ZK2 A;  4OH5 A;  5KYJ A;  5DVV A;  1N4H A;  3FEI A;  2ZNP A;  5E19 A;  3KBA A;  2VV0 A;  3R8I A;  3UVV B;  5KRC A;  1ILH A;  5DU5 A;  1GWX A;  2ZXZ A;  1FCZ A;  5AAV B;  4F9M A;  5JJM B;  5DXE A;  3V3E A;  1X7E A;  4IV4 A;  4OHA A;  5AAV A;  1XZX X;  2QA8 A;  5FQR A;  5JJM A;  3BEJ A;  5DKG A;  2ZVT A;  3VN2 A;  3OAP A;  4IW6 A;  1R20 D;  2J7Y A;  3ERT A;  2Q8S A;  2LBD A;  4WLB A;  1A28 A;  2Q7J A;  4ZJW A;  4N73 A;  1G2N A;  4QK4 A;  1QKT A;  5G44 A;  3DZU A;  3B0Q A;  3D5F A;  1ERE A;  5GID A;  2FSZ A;  2HCD A;  4OEA A;  4ITF A;  5DXG A;  5FQT A;  2XKW A;  5DX3 A;  3TKC A;  1XPC A;  4OGH A;  4JGV A;  3AN3 A;  3OMO A;  1NYX A;  3OS8 C;  4FGY A;  5DMF A;  2OZ7 A;  5DXR A;  2ZNN A;  4G1Y A;  5DL4 A;  4QJR A;  1QKN A;  3X31 A;  4NQA B;  3AX8 A;  4MG9 B;  4POH A;  4YT1 A;  4CI5 A;  5KCE A;  2VV4 B;  3UP0 A;  5G5W A;  4MG9 A;  4RZF A;  3HQ5 A;  4ZNS A;  4RFW A;  4S15 A;  1Y0X X;  4S0T A;  5KCW A;  4DK7 A;  1FM9 D;  2HVC A;  4X1F A;  4LSJ A;  1XV9 B;  4L98 A;  1X7R A;  2NXX A;  2PIQ A;  1HG4 A;  2FAI A;  5DV6 A;  1ERR A;  5E14 A;  2P54 A;  1XLS A;  1XV9 A;  4JYG A;  4Q50 A;  3W0A A;  2OCF A;  3VTC A;  5HJP B;  1I7I A;  1YOW A;  4XAO A;  2BJ4 B;  5DRM A;  3FC6 B;  5HJP A;  3B66 A;  2BJ4 A;  1EXA A;  1YJE A;  2GIU A;  4IUI A;  3HC5 A;  3A78 A;  3QT0 A;  3FC6 A;  5DKE A;  3G8I A;  4E2J A;  4CI4 A;  4WHG A;  2VV3 A;  3KDT A;  1R5K A;  3SP6 A;  3RUU A;  1U3Q A;  4OIL A;  3VJH A;  3WGP A;  1G5Y A;  3IMY A;  3B0W A;  3IPU A;  4JYI A;  3V4A A;  3B1M A;  1PQ9 A;  1G50 A;  5GIE A;  3L3X A;  3FUR A;  1ZUC A;  3HO0 A;  3MNE A;  3LMP A;  5L7G A;  2VSR A;  1N83 A;  2ZL9 A;  4MG5 A;  3W5R A;  2O9I A;  2AA6 A;  4OKW A;  5DYB A;  3ET0 A;  5DSH A;  3P89 A;  2QSE A;  3ADV A;  1Q4X A;  1QKM A;  4LNX A;  3ADS A;  4UDB A;  2GPV A;  2J7X A;  1UOM A;  4MGD B;  3G0W A;  2AM9 A;  4MGD A;  4N1Y A;  2QXM A;  4G21 A;  3K22 A;  1Z5X U;  3WT6 A;  1BSX A;  3DCT A;  4NUF A;  5APJ A;  2ZFX A;  5KCF A;  4KZM A;  4TUZ B;  1S0X A;  1MZN A;  2YJA B;  2VST A;  4K7A A;  5EJV A;  3RVF A;  5APH A;  3VJI A;  3OGT A;  4ZN9 A;  4TUZ A;  2ZKC A;  3VT3 A;  5DP0 A;  2AX9 A;  3WJ5 A;  3UUD B;  3RY9 A;  1X78 A;  2JFA B;  2R40 A;  3K23 A;  2HB7 A;  4J5X A;  3JZC A;  5AVL A;  3UUD A;  2QNV A;  2JFA A;  1TXI A;  3LBD A;  4FHI A;  5DLR A;  3IPQ A;  5E0W A;  2IOK A;  3B68 A;  2FVJ A;  2PRG A;  2YLP A;  2XYJ A;  5JI0 D;  2ZY0 A;  3OLS A;  2ZAS A;  4P6X A;  2HAM A;  2AMB A;  5AAU A;  4YPQ A;  2AB2 A;  1OT7 A;  3W0J A;  1RKG A;  3UUC A;  3VJS A;  4OKX A;  2ZK1 A;  3R2A A;  4HLW A;  4PP6 A;  1RDT D;  2Q5G A;  5FQS A;  1Y0S A;  4QE6 A;  3V9Y A;  2ZK3 A;  3OLL A;  3AZ3 A;  2HFP A;  5DI7 A;  1K74 A;  5G3J A;  5AZV A;  1YIN A;  5HZC A;  2Q6J A;  3SZ1 A;  3L1B A;  4OZT E;  3CJW A;  3CWD A;  3GWX A;  4MGB A;  5AK2 A;  3DY6 A;  2OVH A;  4ZNV A;  2HWR A;  3PEQ A;  5ICK A;  5E0X A;  5E1C A;  1R1K D;  2QE4 A;  1S9Q A;  4K6I A;  2I4Z A;  2ZXN A;  3B67 A;  3V49 A;  5C4O A;  4PXM A;  2B23 A;  2PIR A;  4OC7 A;  4PF3 A;  3NOA A;  5DXB B;  5DXM A;  4OFR A;  4OEY A;  1FM6 D;  2QMV A;  4OED A;  4NIE A;  4OEZ A;  4LNW A;  5DVC A;  5DXB A;  4EM9 A;  3ADU A;  2PIX A;  2HWQ A;  3IXP A;  1M7W A;  4ZNU A;  3D6D A;  3KFC A;  2QGT A;  2HAR A;  4XUH A;  3VRT A;  2OAX A;  3OSW A;  3R5M A;  2PIO A;  3FLI A;  4PP5 A;  4UDD A;  2QA8 B;  1VJB A;  3TKM A;  3OS9 A;  5G46 A;  3H0A D;  4EMA A;  4DM8 A;  5KRF A;  4POJ A;  5KRJ A;  4QE8 A;  5KYA A;  5L7H A;  5F9B A;  2YLQ A;  4XHD A;  5DX3 B;  4FNE A;  5KCT A;  4OJ4 A;  2BAW A;  3KPZ A;  3L0E A;  3PCU A;  3F5C A;  1XP9 A;  1NQ1 A;  1YP0 A;  1ZKY A;  3O1E A;  4G1Z A;  4RWV A;  2J14 A;  3RLL A;  3W0H A;  3WTQ A;  4ZNT A;  3CS6 A;  3KMG A;  5DV3 A;  2P1U A;  2OVM A;  1PK5 A;  1X7B A;  2Q5S A;  4O8F A;  3BQD A;  4RZE A;  3W5T A;  4J5W A;  1S9P A;  3E00 A;  3W0C A;  1OSH A;  3VI8 A;  3RUT A;  4OKT A;  2ATH A;  1ZDT A;  2YLO A;  1FCY A;  4NB6 A;  3VT6 A;  1EXX A;  3TX7 B;  1XOW A;  1PQC A;  3OMM A;  4ZN7 A;  5CJ6 A;  2B50 A;  5KRL A;  4OIV A;  2F4B A;  5KD9 A;  3ADX A;  2QZO B;  2YFE A;  3OMQ A;  4PLE A;  5GT4 A;  2ZK5 A;  3A2J A;  3V9T A;  2QZO A;  2PIV A;  4OLM A;  2H77 A;  4DK8 A;  2ZBS A;  3M7R A;  3DR1 A;  1S19 A;  3L0L A;  1NRL A;  2AX6 A;  5DWE A;  3GN8 A;  2NW4 A;  3DZY D;  5B41 A;  1UPV A;  4YMQ A;  1NQ0 A;  2OUZ A;  3HC6 A;  4IA3 A;  4RAK A;  3MNP A;  3VHU A;  3PO9 A;  5DXQ A;  4WPF A;  1FBY A;  2R6Y A;  1NAX A;  2Q7K A;  5EIT A;  4QL8 A;  3ZQT A;  1Z5X E;  2QPY A;  4FHH A;  3V3Q A;  3OLF A;  5DZ3 A;  3X1H A;  2AAX A;  3B0T A;  3AZ2 A;  4UDC A;  2HC4 A;  1YOK A; 
#chains in the Genus database with same CATH homology
 1RDT A;  4TV1 B;  4OFU A;  1GS4 A;  5DKS A;  1Y9R A;  2GTK A;  1PCG A;  2AA5 A;  4IVW A;  4TV1 A;  5H1E A;  5AWJ A;  1E3K A;  4XI3 A;  3V9V A;  5C4S A;  3VT9 A;  2HBH A;  4RMC A;  3ADT A;  3O1D A;  4L96 A;  2P4Y A;  3CS4 A;  4XT9 A;  2R6W A;  3W0I A;  5IAW A;  2HB8 A;  3KMR A;  5C4T A;  1KV6 A;  2Z4J A;  3AZ1 A;  4LTW A;  5DID A;  2AO6 A;  4E4K A;  4PP3 A;  1PDU A;  3OZJ A;  4PRG A;  4IWC A;  1KKQ A;  3HM1 A;  2I4J A;  1U3S A;  3GYT A;  3GD2 A;  3DZU D;  4A2J A;  1MV9 A;  3FXV A;  1T7T A;  1FD0 A;  3K6P A;  4S0S A;  3PRG A;  5DUE A;  5EC9 A;  3VT7 A;  1YUC A;  2PIN A;  4MG8 B;  4DOR A;  1ILG A;  1SKX A;  3FUG A;  4MG8 A;  1NQ7 A;  3MNO A;  3VTB A;  3ET2 A;  2NV7 A;  2P7Z A;  3JZB A;  2REW A;  5G42 A;  3NSP A;  3RLJ A;  5DUH A;  1UHL B;  4APU A;  3HVL A;  1T63 A;  1YMT A;  2AYR A;  2QA6 A;  5DZI A;  1UHL A;  4PWL A;  3A2I A;  2Q60 A;  5DYD A;  5KCC A;  4OAR A;  5L7E A;  1R20 A;  2Q59 B;  1YY4 A;  5LWP A;  4RZG A;  5DZ0 A;  1OSV A;  2Q59 A;  1DKF B;  2ZK4 A;  3B65 A;  3L3Z A;  5KRI A;  3G9E A;  2QAB A;  4OKB A;  3NSQ A;  2I0J A;  1DKF A;  4OZR U;  5I4V A;  4G2H A;  4E4Q A;  5G43 A;  5FQV A;  4NY9 A;  4ZNH A;  5KR9 A;  3K8S A;  3B3K A;  1A52 A;  4MGB B;  2YAT A;  3CDP A;  1I7G A;  4MG7 B;  5DIG A;  3OZ0 A;  2AMA A;  4MG7 A;  2PKL A;  4ZO1 X;  1ZEO A;  5AZT A;  3GZ9 A;  3AUQ A;  3N00 A;  1KNU A;  3L03 A;  1RKH A;  2XYW A;  2XHS A;  2ZMJ A;  1YA3 A;  1SQN A;  3CS8 A;  3PLZ A;  5DKB A;  3P8X A;  1L2I A;  4XUM A;  2GPO A;  1FM9 A;  1IE8 A;  3A40 X;  3Q95 B;  5DUG A;  3R5N A;  1XDK B;  4P6W A;  1ZAF A;  1ZH7 A;  4Q0A C;  3Q95 A;  5A86 A;  2I4P A;  2OM9 A;  3PBA A;  3W5Q A;  5KRO A;  1XDK A;  1X76 A;  3ILZ A;  4OK1 A;  2Q1H A;  3GBK A;  3IPS A;  4J5X C;  1G1U A;  1XP6 A;  3AUN A;  4IA1 A;  4Q13 A;  5HCV A;  3UUA B;  1N46 A;  3P88 A;  3WFG A;  2ZNQ A;  3EYB A;  1OVL B;  3OS8 A;  3UUA A;  3BC5 A;  5DY8 A;  5SYZ A;  4M8E A;  1OVL A;  2Z4B A;  2GWX A;  2P7G A;  3GYU A;  4LBD A;  2J4A A;  3VSP A;  3E7C A;  3T03 A;  1T7F A;  3WWR A;  1E3G A;  1NHZ A;  4IVY A;  4REF A;  1TFC A;  2ZMI A;  4IA2 A;  4RUO X;  1M13 A;  4PPS A;  1PRG A;  5EHJ A;  3F5C B;  2G44 A;  3D57 A;  3FEJ A;  1LBD A;  1P93 A;  5K13 A;  3KMZ A;  4N8R A;  3B0R A;  3WFF A;  2R40 D;  3HLV A;  4G20 A;  4PPP A;  4R06 A;  3W0G A;  1XIU A;  5G45 A;  4OZT U;  3CDS A;  3UVV A;  2XYX A;  2YJD A;  3GWS X;  3VRW A;  3X1I A;  5HYR A;  2GPP A;  4G2I A;  1QKU A;  1X7J A;  2IOG A;  4N5G A;  5KCU A;  1NDE A;  2AXA A;  5EI1 A;  1ZGY A;  1U3R A;  2ACL B;  5HJS A;  1XB7 A;  3R29 A;  1YIM A;  2ACL A;  5DZ1 A;  2QR9 A;  3L0J A;  2PIP L;  1XQC A;  2W8Y A;  5L11 A;  2G0H A;  2E2R A;  1I37 A;  4FN9 A;  5DIE A;  5DMC A;  3KDU A;  3OMK A;  2PIW A;  1K74 D;  5DWJ A;  3ET1 A;  3OSI A;  5C4U A;  2A3I A;  3VHW A;  2PIU A;  5B5B A;  1S0Z A;  5ACC A;  3A9E B;  4JYH A;  3WMH A;  1DB1 A;  4RUP A;  1XVP B;  3W0Y A;  4YNK A;  1XNN A;  1HJ1 A;  3A9E A;  1NUO A;  1XVP A;  4DOS A;  1I38 A;  4XTA A;  5DWG A;  2Q7I A;  2Q6R A;  5AVI A;  5DVS A;  1XNX A;  2POB A;  3OKH A;  4KZI A;  3VSO A;  4UDA A;  4J24 A;  1ZDU A;  1GWR A;  3AFR A;  3WT7 A;  1NAV A;  2VV4 A;  2YHD A;  5DK9 A;  3TY0 A;  3ZR7 A;  4OH6 A;  4RUJ A;  1IE9 A;  1T76 A;  2PJL A;  4MG6 A;  1XQ3 A;  1L2J A;  3OMP A;  1T74 A;  3ADW A;  3AN4 A;  1GWQ A;  1SR7 A;  3IXP D;  4JL4 A;  3VT4 A;  4JAZ A;  3HOD A;  3H52 A;  4IV2 A;  2ZLA A;  2AWH A;  3A2H A;  4HEE X;  4KZJ A;  4R6S A;  4RMD A;  1LV2 A;  4J26 A;  5GIC A;  4J5W C;  2Q61 A;  1T7M A;  2HAS A;  2QW4 A;  2JJ3 A;  2VV2 A;  3CQV A;  5AYG A;  2AA7 A;  1R1K A;  5DTV A;  1T7R A;  1K7L A;  2P1T A;  5LGA A;  2Q7L A;  3KWY A;  4G1D A;  4OJ9 A;  1XP1 A;  1FM6 A;  4ZJR A;  1T5Z A;  2B1Z A;  4OZR E;  4BCR A;  2Q1V A;  3DCU A;  3HZF A;  3OOF A;  5JY3 A;  4M8H A;  5IZ0 A;  4DMA A;  2Q6S A;  3S9S A;  3WT5 A;  3D24 A;  3CLD A;  1P8D A;  2Q5P A;  5HYK A;  4MGA B;  4PLD A;  4ZOM A;  3W5P A;  4OIU A;  4Y29 A;  5DWI A;  1RK3 A;  4MGA A;  2GL8 A;  3R8D A;  5DV8 A;  2P1V A;  3F7D A;  3ZRA A;  4ITE A;  3E00 D;  2P7A A;  4RE8 A;  3VRU A;  3D90 A;  2PNU A;  1T65 A;  2IHQ A;  3VTD A;  2ZLC A;  1MVC A;  4IWF A;  3H0A A;  2VV1 B;  2ZXM A;  4QM0 A;  3DT3 A;  4PVU A;  2VV1 A;  2JF9 A;  4A4V A;  2ZMH A;  1K4W A;  5APK A;  4XLD A;  5DXP A;  3ERD A;  1Z95 A;  3CTB A;  5KRH A;  2G0G A;  4IW8 A;  2AX7 A;  1U9E A;  2O4R A;  4WHF A;  1PQ6 A;  5KRM A;  3OKI A;  3OSA A;  5IXK A;  5KRK A;  2YLY A;  1R6G A;  3E94 A;  1XJ7 A;  2QGW A;  3ET3 A;  3AUR A;  5FQP A;  1RJK A;  1SJ0 A;  2PIT A;  2QH6 A;  2GP7 A;  1WM0 X;  5M96 A;  2ABI A;  1H9U A;  5DXK A;  5KRA A;  2V7C A;  4IU7 A;  2Q70 A;  4ZO1 B;  2GPU A;  5E7V A;  5ETH A;  4ONI A;  2NXX E;  1NQ2 A;  2POG A;  3R8A A;  1XLS E;  4RME A;  3G8O A;  2AA2 A;  3B5R A;  5KCD A;  1PZL A;  2V0V A;  5DRJ A;  2ZK0 A;  2ZNO A;  4WVD A;  4A4W A;  4OJB A;  4IA7 A;  3IA6 A;  3U9Q A;  1T73 A;  2B1V A;  3SP9 A;  3UU7 B;  3VT5 A;  3VT8 A;  4DM6 A;  2AX8 A;  1YYE A;  3DZY A;  3UU7 A;  1UPW A;  2QTU A;  4K4J A;  4B7W A;  1FCX A;  2NPA A;  3FAL B;  3OOK A;  3P0U A;  4X1G A;  3UP3 A;  3X36 A;  4WQP A;  4ZI1 A;  3ZRB A;  2H79 A;  1T79 A;  3A3Z X;  3FAL A;  4MDD A;  4MGC A;  5AWK A;  3VHV A;  2O4J A;  3VRV A;  4REE A;  3FS1 A;  2P15 A;  4S14 A;  5DWL A;  5DZH A;  2G5O A;  3WJ4 A;  1XAP A;  4IQR A;  4R2U A;  5EGV A;  5E15 A;  2I0G A;  2QXS A;  2ZK6 A;  4CSJ A;  2Q3Y A;  4DQM A;  3KYT A;  1M2Z A;  2EWP A;  3VJT A;  4IS8 A;  4ZNW A;  2ZK2 A;  4OH5 A;  5KYJ A;  5DVV A;  1N4H A;  3FEI A;  2ZNP A;  5E19 A;  3KBA A;  2VV0 A;  3R8I A;  3UVV B;  5KRC A;  1ILH A;  5DU5 A;  1GWX A;  2ZXZ A;  1FCZ A;  5AAV B;  4F9M A;  5JJM B;  5DXE A;  3V3E A;  1X7E A;  4IV4 A;  4OHA A;  5AAV A;  1XZX X;  2QA8 A;  5FQR A;  5JJM A;  3BEJ A;  5DKG A;  2ZVT A;  3VN2 A;  3OAP A;  4IW6 A;  1R20 D;  2J7Y A;  3ERT A;  2Q8S A;  2LBD A;  4WLB A;  1A28 A;  2Q7J A;  4ZJW A;  4N73 A;  1G2N A;  4QK4 A;  1QKT A;  5G44 A;  3DZU A;  3B0Q A;  3D5F A;  1ERE A;  5GID A;  2FSZ A;  2HCD A;  4OEA A;  4ITF A;  5DXG A;  5FQT A;  2XKW A;  5DX3 A;  3TKC A;  1XPC A;  4OGH A;  4JGV A;  3AN3 A;  3OMO A;  1NYX A;  3OS8 C;  4FGY A;  5DMF A;  2OZ7 A;  5DXR A;  2ZNN A;  4G1Y A;  5DL4 A;  4QJR A;  1QKN A;  3X31 A;  4NQA B;  3AX8 A;  4MG9 B;  4POH A;  4YT1 A;  4CI5 A;  5KCE A;  2VV4 B;  3UP0 A;  5G5W A;  4MG9 A;  4RZF A;  3HQ5 A;  4ZNS A;  4RFW A;  4S15 A;  1Y0X X;  4S0T A;  5KCW A;  4DK7 A;  1FM9 D;  2HVC A;  4X1F A;  4LSJ A;  1XV9 B;  4L98 A;  1X7R A;  2NXX A;  2PIQ A;  1HG4 A;  2FAI A;  5DV6 A;  1ERR A;  5E14 A;  2P54 A;  1XLS A;  1XV9 A;  4JYG A;  4Q50 A;  3W0A A;  2OCF A;  3VTC A;  5HJP B;  1I7I A;  1YOW A;  4XAO A;  2BJ4 B;  5DRM A;  3FC6 B;  5HJP A;  3B66 A;  2BJ4 A;  1EXA A;  1YJE A;  2GIU A;  4IUI A;  3HC5 A;  3A78 A;  3QT0 A;  3FC6 A;  5DKE A;  3G8I A;  4E2J A;  4CI4 A;  4WHG A;  2VV3 A;  3KDT A;  1R5K A;  3SP6 A;  3RUU A;  1U3Q A;  4OIL A;  3VJH A;  3WGP A;  1G5Y A;  3IMY A;  3B0W A;  3IPU A;  4JYI A;  3V4A A;  3B1M A;  1PQ9 A;  1G50 A;  5GIE A;  3L3X A;  3FUR A;  1ZUC A;  3HO0 A;  3MNE A;  3LMP A;  5L7G A;  2VSR A;  1N83 A;  2ZL9 A;  4MG5 A;  3W5R A;  2O9I A;  2AA6 A;  4OKW A;  5DYB A;  3ET0 A;  5DSH A;  3P89 A;  2QSE A;  3ADV A;  1Q4X A;  1QKM A;  4LNX A;  3ADS A;  4UDB A;  2GPV A;  2J7X A;  1UOM A;  4MGD B;  3G0W A;  2AM9 A;  4MGD A;  4N1Y A;  2QXM A;  4G21 A;  3K22 A;  1Z5X U;  3WT6 A;  1BSX A;  3DCT A;  4NUF A;  5APJ A;  2ZFX A;  5KCF A;  4KZM A;  4TUZ B;  1S0X A;  1MZN A;  2YJA B;  2VST A;  4K7A A;  5EJV A;  3RVF A;  5APH A;  3VJI A;  3OGT A;  4ZN9 A;  4TUZ A;  2ZKC A;  3VT3 A;  5DP0 A;  2AX9 A;  3WJ5 A;  3UUD B;  3RY9 A;  1X78 A;  2JFA B;  2R40 A;  3K23 A;  2HB7 A;  4J5X A;  3JZC A;  5AVL A;  3UUD A;  2QNV A;  2JFA A;  1TXI A;  3LBD A;  4FHI A;  5DLR A;  3IPQ A;  5E0W A;  2IOK A;  3B68 A;  2FVJ A;  2PRG A;  2YLP A;  2XYJ A;  5JI0 D;  2ZY0 A;  3OLS A;  2ZAS A;  4P6X A;  2HAM A;  2AMB A;  5AAU A;  4YPQ A;  2AB2 A;  1OT7 A;  3W0J A;  1RKG A;  3UUC A;  3VJS A;  4OKX A;  2ZK1 A;  3R2A A;  4HLW A;  4PP6 A;  1RDT D;  2Q5G A;  5FQS A;  1Y0S A;  4QE6 A;  3V9Y A;  2ZK3 A;  3OLL A;  3AZ3 A;  2HFP A;  5DI7 A;  1K74 A;  5G3J A;  5AZV A;  1YIN A;  5HZC A;  2Q6J A;  3SZ1 A;  3L1B A;  4OZT E;  3CJW A;  3CWD A;  3GWX A;  4MGB A;  5AK2 A;  3DY6 A;  2OVH A;  4ZNV A;  2HWR A;  3PEQ A;  5ICK A;  5E0X A;  5E1C A;  1R1K D;  2QE4 A;  1S9Q A;  4K6I A;  2I4Z A;  2ZXN A;  3B67 A;  3V49 A;  5C4O A;  4PXM A;  2B23 A;  2PIR A;  4OC7 A;  4PF3 A;  3NOA A;  5DXB B;  5DXM A;  4OFR A;  4OEY A;  1FM6 D;  2QMV A;  4OED A;  4NIE A;  4OEZ A;  4LNW A;  5DVC A;  5DXB A;  4EM9 A;  3ADU A;  2PIX A;  2HWQ A;  3IXP A;  1M7W A;  4ZNU A;  3D6D A;  3KFC A;  2QGT A;  2HAR A;  4XUH A;  3VRT A;  2OAX A;  3OSW A;  3R5M A;  2PIO A;  3FLI A;  4PP5 A;  4UDD A;  2QA8 B;  1VJB A;  3TKM A;  3OS9 A;  5G46 A;  3H0A D;  4EMA A;  4DM8 A;  5KRF A;  4POJ A;  5KRJ A;  4QE8 A;  5KYA A;  5L7H A;  5F9B A;  2YLQ A;  4XHD A;  5DX3 B;  4FNE A;  5KCT A;  4OJ4 A;  2BAW A;  3KPZ A;  3L0E A;  3PCU A;  3F5C A;  1XP9 A;  1NQ1 A;  1YP0 A;  1ZKY A;  3O1E A;  4G1Z A;  4RWV A;  2J14 A;  3RLL A;  3W0H A;  3WTQ A;  4ZNT A;  3CS6 A;  3KMG A;  5DV3 A;  2P1U A;  2OVM A;  1PK5 A;  1X7B A;  2Q5S A;  4O8F A;  3BQD A;  4RZE A;  3W5T A;  4J5W A;  1S9P A;  3E00 A;  3W0C A;  1OSH A;  3VI8 A;  3RUT A;  4OKT A;  2ATH A;  1ZDT A;  2YLO A;  1FCY A;  4NB6 A;  3VT6 A;  1EXX A;  3TX7 B;  1XOW A;  1PQC A;  3OMM A;  4ZN7 A;  5CJ6 A;  2B50 A;  5KRL A;  4OIV A;  2F4B A;  5KD9 A;  3ADX A;  2QZO B;  2YFE A;  3OMQ A;  4PLE A;  5GT4 A;  2ZK5 A;  3A2J A;  3V9T A;  2QZO A;  2PIV A;  4OLM A;  2H77 A;  4DK8 A;  2ZBS A;  3M7R A;  3DR1 A;  1S19 A;  3L0L A;  1NRL A;  2AX6 A;  5DWE A;  3GN8 A;  2NW4 A;  3DZY D;  5B41 A;  1UPV A;  4YMQ A;  1NQ0 A;  2OUZ A;  3HC6 A;  4IA3 A;  4RAK A;  3MNP A;  3VHU A;  3PO9 A;  5DXQ A;  4WPF A;  1FBY A;  2R6Y A;  1NAX A;  2Q7K A;  5EIT A;  4QL8 A;  3ZQT A;  1Z5X E;  2QPY A;  4FHH A;  3V3Q A;  3OLF A;  5DZ3 A;  3X1H A;  2AAX A;  3B0T A;  3AZ2 A;  4UDC A;  2HC4 A;  1YOK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...