5C4OA

Identification of a novel allosteric binding site for rorgt inhibitors
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
241
structure length
241
Chain Sequence
LTEIEHLVQSVCKSYRETCQLRLEDLLRQRSNIFSREEVTGYQRKSMWEMWERCAHHLTEAIQYVVEFAKRLSGFMELCQNDQIVLLKAGAMEVVLVRMCRAYNADNRTVFFEGKYGGMELFRALGCSELISSIFDFSHSLSALHFSEDEIALYTALVLINAHRPGLQEKRKVEQLQYNLELAFHHHLHKTHRQSILAKLPPKGKLRSLCSQHVERLQIFQHLHPIVVQAAFPPLYKELFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/transcription inhibitor
molecule keywords Nuclear receptor ROR-gamma
publication title Identification of an allosteric binding site for ROR gamma t inhibition.
pubmed doi rcsb
source organism Homo sapiens
total genus 92
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2015-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 5c4oA00
4OC7A 4PF3A 4XLDA 2Q7JA 5DX3B 1A28A 3UP3A 3VT5A 1T7TA 3L1BA 1RJKA 2OAXA 5DXKA 4MGAA 2ZLAA 3ET3A 1YY4A 1EXAA 3DT3A 4REEA 2FAIA 4RFWA 5DXBB 2AX8A 1FD0A 4PPPA 4S0SA 2PIXA 5KROA 5DMFA 3JZBA 3B0RA 3FS1A 2V0VA 1L2JA 3GN8A 5DLRA 2IHQA 4ZNVA 5L7HA 1R1KA 4OZRE 1EXXA 1ZGYA 2Q5GA 4OFUA 4QE6A 3V3QA 2ZMIA 3WTQA 1T7MA 2ZNQA 3X1IA 1T74A 3B68A 4NIEA 5DZ0A 5C4UA 1T79A 2Q59B 4PLEA 3T03A 4TUZA 3VT9A 3W0GA 3NOAA 2GP7A 2GTKA 2Q3YA 3FALA 4QJRA 4OJBA 1ZH7A 3CS6A 3TKMA 3Q95A 4ONIA 2B1ZA 3DR1A 3E7CA 1XLSE 2NW4A 2HVCA 3A9EB 3OMQA 4NUFA 4PP3A 1HG4A 4ZI1A 1YOKA 3B0QA 2OVHA 5DIEA 3D90A 4MG8A 3WT5A 1QKUA 4OKWA 4XI3A 3ET2A 2Q8SA 3ADWA 4R6SA 3K22A 4MGDA 3K23A 4G20A 3W5TA 3ADXA 2PIOA 5DUHA 2P7ZA 3FEIA 1FM9D 2OUZA 3V9TA 1I7IA 3D57A 4JL4A 4RMDA 4KZMA 3L3XA 4FGYA 1WM0X 1FCYA 2Q70A 2ZNOA 1N83A 2REWA 2JJ3A 3PLZA 1PDUA 5DWGA 1T65A 4ITFA 4FHIA 3TX7B 4JGVA 4A2JA 5DXRA 4DM6A 4DK8A 2W8YA 5AK2A 5HJPA 1KKQA 2R40D 1YMTA 5B5BA 3DZYD 1FM6D 3PBAA 3OLSA 4LNWA 4ZO1X 3RUTA 1NQ0A 1X7JA 2QABA 2ZL9A 4HEEX 5DXPA 1K7LA 1QKTA 3DCTA 4UDDA 5AZVA 5HCVA 1XVPB 3GYTA 3OOFA 2B1VA 3V9YA 5B41A 3UVVA 3VRUA 4DOSA 4YMQA 1M2ZA 3H0AD 1ZUCA 4OIUA 4PWLA 3VTDA 3HZFA 5APJA 4N73A 1SJ0A 4MG7A 1XAPA 1GWXA 1XOWA 4IWFA 5E19A 3K6PA 2VV3A 3VRWA 3P8XA 5DSHA 2GPUA 1RDTA 3GBKA 3R2AA 4G1YA 5CJ6A 4ZOMA 3PRGA 4POHA 1I37A 2XHSA 4M8EA 1G2NA 4FN9A 3A2HA 1YIMA 1ZAFA 4PVUA 5DV3A 5DV8A 5G45A 1XJ7A 2LBDA 5HYRA 2ZLCA 3AUQA 3HODA 3WMHA 5DVSA 3L03A 2ZMJA 5DZIA 5DV6A 1MZNA 1PQ9A 3GWSX 5EGVA 1ZKYA 1NUOA 2G0HA 5I4VA 3G8OA 4JYHA 1YYEA 2ACLB 2BJ4B 5GIDA 4JYGA 5DX3A 2PINA 5AWKA 5DXGA 3E00D 2AA5A 2P7AA 3HQ5A 4MG5A 1XNNA 4WHGA 4LBDA 3RUUA 5K13A 4RMCA 2PIRA 4XUMA 5DXBA 4ZJWA 5KCFA 2QA8B 4JAZA 2JF9A 2ZK5A 1E3KA 3AFRA 3WT6A 5KRIA 5AAVB 4IVYA 1NDEA 5DRJA 4YT1A 3R29A 3W5RA 3WT7A 3AURA 3B3KA 4OEZA 3HO0A 5DXMA 3TY0A 2VV1A 2YLQA 2GPOA 4E4QA 3HVLA 1PZLA 2QSEA 4P6WA 2I4ZA 3AZ2A 1R5KA 5DI7A 3UUCA 3OSIA 4PXMA 1XP6A 3DZUD 4APUA 5AAUA 3CDPA 5DRMA 3OS8A 1DB1A 4ZNTA 5L11A 2ZY0A 5A86A 4A4VA 2Q59A 5KCDA 2HAMA 3PCUA 4XUHA 2XYJA 2PIWA 3VJIA 4IS8A 3FLIA 3ERDA 3A9EA 3PO9A 4DQMA 1T5ZA 4RE8A 5KRHA 2QA6A 1Y9RA 4S15A 3LMPA 3DY6A 4MG6A 3VT8A 1IE9A 3E94A 2VV4B 4S14A 5AYGA 4IA2A 4J5XA 4P6XA 4IW6A 2R6WA 1NHZA 1UOMA 3WGPA 4IA7A 3OLFA 3VTBA 2J7XA 2R6YA 1XV9A 1R20D 3VT6A 4NY9A 5FQTA 2A3IA 1R6GA 1RKHA 3CQVA 3W0IA 3A3ZX 2ZBSA 3ADUA 3A2IA 3IA6A 3AZ3A 2XKWA 5IAWA 2ZXNA 4IQRA 4OH6A 4IV2A 1VJBA 1XNXA 2PITA 3SP9A 1OSHA 1FCXA 2AAXA 3NSQA 5ICKA 4QL8A 5FQPA 1PCGA 1S19A 2VV1B 1M13A 5DXQA 3B1MA 2AXAA 4NQAB 2YJAB 2B50A 2H79A 2QXMA 5G3JA 4ZN7A 3A78A 1NQ2A 1XVPA 5KRMA 5E15A 5KRLA 4DMAA 5EITA 3W0HA 4DK7A 1T63A 2YLYA 4OEAA 4OZTU 3W5PA 2E2RA 2ZNNA 4YPQA 3VT3A 1Q4XA 2JFAB 3F7DA 1GWRA 2QZOA 3IPSA 4LTWA 1Z5XU 2OZ7A 4NB6A 5E0WA 3D24A 3GYUA 5L7GA 1XV9B 4QE8A 2AWHA 4RZFA 1K4WA 1QKNA 2GPPA 3VRTA 2AYRA 1FM9A 2Q60A 2QR9A 3B0TA 3KWYA 4J5WC 5C4OA 1GS4A 1GWQA 5DVVA 3X36A 1OVLA 2ZK6A 5APHA 4G21A 1ERRA 2VSTA 4UDAA 4LNXA 3D5FA 3NSPA 3M7RA 3FXVA 3RVFA 2HC4A 4OLMA 2P4YA 3AN4A 5E7VA 2PIUA 3AN3A 5APKA 4MDDA 1KV6A 2GPVA 5DL4A 3DZYA 2ACLA 1FM6A 1S0XA 2BJ4A 4QK4A 3F5CB 3AUNA 2ZXMA 2FVJA 3IPUA 2I4PA 3IXPD 2O9IA 4CI5A 1T7FA 1I7GA 3RLLA 1XIUA 1ZDUA 4RUJA 5DUEA 5G43A 1K74D 2NXXA 2QA8A 2HASA 4Q13A 3G9EA 1NYXA 2YATA 1Y0SA 4MGBB 5AAVA 3ADTA 3B65A 3KPZA 5G42A 3B67A 3W5QA 4N8RA 4KZJA 3KMZA 2QZOB 1NQ7A 2AX6A 2ZK4A 5KYJA 3KMRA 3VN2A 1PQCA 2I4JA 2QGWA 1FCZA 3VRVA 5KRJA 3KFCA 2AA6A 5JY3A 4E2JA 2ZVTA 4Y29A 2G5OA 4KZIA 1NQ1A 5DYBA 1XZXX 4PP6A 3OSWA 5C4TA 4FHHA 3QT0A 2Q1VA 2PIVA 2PJLA 3CS8A 4IW8A 4OEYA 4B7WA 1OVLB 3ZR7A 5C4SA 1NAXA 2J7YA 4QM0A 1XP1A 1U3SA 4IA1A 3B0WA 5KCCA 3P0UA 3WWRA 3OLLA 5M96A 3ADVA 2PNUA 2VV4A 3P88A 3IPQA 4OHAA 5GICA 1YP0A 2QH6A 3VHUA 5KRCA 3WJ4A 1XLSA 3CDSA 5AZTA 2J14A 2V7CA 2HWRA 2EWPA 3WFFA 4X1GA 3X31A 2PIQA 4OEDA 1IE8A 3A2JA 3H52A 3E00A 3BQDA 1Z95A 3PEQA 1E3GA 2YLPA 3KMGA 3GZ9A 5KR9A 3CJWA 5DZ3A 4TV1B 4K7AA 2PRGA 2ZKCA 4K4JA 1UPVA 2Q61A 2PKLA 1H9UA 4UDBA 2Q7LA 4PP5A 1U9EA 3CS4A 1XP9A 5GT4A 3N00A 3G0WA 1U3RA 5KRFA 3R5NA 3R8AA 4OILA 3RLJA 3DZUA 5DTVA 4OARA 2ATHA 3OKHA 4EMAA 3BEJA 1NRLA 5DWEA 5ETHA 1X7BA 1X76A 4REFA 5DKBA 5KCWA 2HFPA 3V4AA 3VHVA 1XB7A 4JYIA 3V9VA 3KBAA 3VTCA 2ZASA 4CSJA 3SP6A 2JFAA 5HYKA 1SQNA 3BC5A 5E0XA 4IA3A 3X1HA 2I0GA 4WVDA 5KRAA 3HLVA 5DKSA 1YOWA 3OS9A 1T73A 1LBDA 3U9QA 5EHJA 3UUDB 3VHWA 1T7RA 4OFRA 3W0AA 1DKFB 5JJMB 4ZNHA 1R20A 4CI4A 1X7RA 3K8SA 2I0JA 4MG9B 1L2IA 4E4KA 1MV9A 2ABIA 4ITEA 1MVCA 2Q5PA 5DWIA 4IV4A 3WFGA 4J26A 2AA7A 1EREA 3ERTA 3W0JA 4ZJRA 4ZNUA 1S0ZA 2NV7A 3L0LA 5AWJA 2VSRA 5DIGA 3VT4A 2Q5SA 3R5MA 2QTUA 1T76A 1XDKB 3F5CA 2HBHA 4OKXA 5F9BA 1FBYA 1N46A 4OZTE 2O4JA 3UUAB 5G5WA 3VSPA 2POGA 2VV0A 4K6IA 3SZ1A 3V49A 5IXKA 3OZ0A 1G50A 5DUGA 2AB2A 2IOKA 1M7WA 2O4RA 3L0EA 3O1EA 1YINA 3L3ZA 3OMPA 3OOKA 4R2UA 3CTBA 4MGBA 3UU7A 4G1DA 2HWQA 1ILHA 2YLOA 1Z5XE 1XQCA 3OGTA 5KCTA 1SKXA 3ZRBA 5LWPA 2IOGA 2Q1HA 3HC5A 4X1FA 4J24A 1UPWA 4ZO1B 4G2IA 4WQPA 3OS8C 5FQRA 3KDUA 2ZNPA 1BSXA 1R1KD 2FSZA 4PRGA 3W0CA 2OVMA 2G44A 4OKTA 5EJVA 1ZDTA 2GWXA 3ET0A 5EC9A 3W0YA 4WLBA 1PQ6A 1RKGA 2H77A 1XQ3A 3FUGA 4BCRA 4OZRU 3OSAA 2PIPL 1NAVA 4RWVA 4PPSA 3MNPA 3EYBA 2HCDA 2NPAA 2AMAA 4J5XC 4WPFA 3FC6B 5DVCA 2BAWA 1S9PA 3GD2A 5DP0A 4EM9A 2XYXA 1U3QA 4OJ4A 1PRGA 3GWXA 5DK9A 2QPYA 5FQSA 5LGAA 2R40A 2XYWA 1G1UA 2QXSA 2POBA 3AZ1A 1OSVA 5DYDA 2P1UA 2YHDA 2Q6SA 5E1CA 3OMOA 1ZEOA 2Q7IA 1Y0XX 5HZCA 3VSOA 1PK5A 3IXPA 3JZCA 3FEJA 4OGHA 3VJSA 4O8FA 2QE4A 3LBDA 1K74A 4MGAB 5G46A 3L0JA 3H0AA 4TV1A 1I38A 4LSJA 3UU7B 5ACCA 5HJSA 5H1EA 5DKGA 5IZ0A 1XPCA 3G8IA 4RMEA 2HB7A 5EI1A 2AX9A 4L96A 1P8DA 2Z4JA 5DU5A 5KCEA 5DWLA 3P89A 1RK3A 3OMMA 3OMKA 3HM1A 2QGTA 5DZHA 2OM9A 3DCUA 4RZEA 3S9SA 3UP0A 1X78A 2ZK2A 2P1TA 5KD9A 3A40X 3MNEA 2QMVA 1A52A 3R8IA 3VI8A 4TUZB 4DM8A 4ZNWA 3FALB 5G44A 3VJHA 2AO6A 3Q95B 2J4AA 3ZRAA 3R8DA 2AM9A 2B23A 4WHFA 1X7EA 3KYTA 4RUOX 2Q6RA 4MG8B 5GIEA 3UUDA 2QNVA 5DKEA 2HB8A 4DORA 5KCUA 2AA2A 1DKFA 5JJMA 4M8HA 3OAPA 5DWJA 1TFCA 4IWCA 4MGDB 4PLDA 1UHLA 4MG9A 1RDTD 3CWDA 5DXEA 4OK1A 4N1YA 5AVIA 3IMYA 4OJ9A 4YNKA 2ZMHA 1YJEA 2YJDA 4XTAA 4XAOA 3RY9A 4HLWA 4G2HA 1TXIA 5SYZA 2ZK1A 2P1VA 5JI0D 1LV2A 2G0GA 3VT7A 4MGCA 5AVLA 4A4WA 5HJPB 1YA3A 4R06A 1XDKA 2P54A 4L98A 2HARA 2AX7A 4N5GA 2F4BA 3D6DA 4G1ZA 3UUAA 2AMBA 3ET1A 4F9MA 2Z4BA 1SR7A 1HJ1A 3AX8A 3HC6A 2P15A 4Q0AC 2GL8A 2QW4A 3UVVB 1S9QA 2OCFA 3FURA 4RZGA 2Q7KA 1KNUA 4FNEA 1ILGA 1YUCA 2ZK0A 3B66A 4IU7A 4UDCA 3ZQTA 3ADSA 3WJ5A 4OIVA 4S0TA 2ZK3A 4MG7B 4XT9A 2Q6JA 2ZXZA 2YFEA 3ILZA 4OH5A 4Q50A 5L7EA 3B5RA 1UHLB 3KDTA 3O1DA 3OKIA 4XHDA 5DY8A 1OT7A 4ZN9A 3TKCA 4RUPA 1N4HA 4OKBA 2GIUA 2VV2A 5FQVA 5E14A 1G5YA 5DIDA 3FC6A 3MNOA 3V3EA 3OZJA 4J5WA 4ZNSA 4IUIA 4IVWA 5KYAA 2ZFXA 3VJTA 5KRKA 4RAKA 4POJA 5DZ1A 2P7GA 1QKMA 3CLDA 5DMCA 1P93A 2NXXE
chains in the Genus database with same CATH superfamily
4OC7A 4PF3A 4XLDA 2Q7JA 5DX3B 1A28A 3UP3A 3VT5A 1T7TA 3L1BA 1RJKA 2OAXA 5DXKA 4MGAA 2ZLAA 3ET3A 1YY4A 1EXAA 3DT3A 4REEA 2FAIA 4RFWA 5DXBB 2AX8A 1FD0A 4PPPA 4S0SA 2PIXA 5KROA 5DMFA 3JZBA 3B0RA 3FS1A 2V0VA 1L2JA 3GN8A 5DLRA 2IHQA 4ZNVA 5L7HA 1R1KA 4OZRE 1EXXA 1ZGYA 2Q5GA 4OFUA 4QE6A 3V3QA 2ZMIA 3WTQA 1T7MA 2ZNQA 3X1IA 1T74A 3B68A 4NIEA 5DZ0A 5C4UA 1T79A 2Q59B 4PLEA 3T03A 4TUZA 3VT9A 3W0GA 3NOAA 2GP7A 2GTKA 2Q3YA 3FALA 4QJRA 4OJBA 1ZH7A 3CS6A 3TKMA 3Q95A 4ONIA 2B1ZA 3DR1A 3E7CA 1XLSE 2NW4A 2HVCA 3A9EB 3OMQA 4NUFA 4PP3A 1HG4A 4ZI1A 1YOKA 3B0QA 2OVHA 5DIEA 3D90A 4MG8A 3WT5A 1QKUA 4OKWA 4XI3A 3ET2A 2Q8SA 3ADWA 4R6SA 3K22A 4MGDA 3K23A 4G20A 3W5TA 3ADXA 2PIOA 5DUHA 2P7ZA 3FEIA 1FM9D 2OUZA 3V9TA 1I7IA 3D57A 4JL4A 4RMDA 4KZMA 3L3XA 4FGYA 1WM0X 1FCYA 2Q70A 2ZNOA 1N83A 2REWA 2JJ3A 3PLZA 1PDUA 5DWGA 1T65A 4ITFA 4FHIA 3TX7B 4JGVA 4A2JA 5DXRA 4DM6A 4DK8A 2W8YA 5AK2A 5HJPA 1KKQA 2R40D 1YMTA 5B5BA 3DZYD 1FM6D 3PBAA 3OLSA 4LNWA 4ZO1X 3RUTA 1NQ0A 1X7JA 2QABA 2ZL9A 4HEEX 5DXPA 1K7LA 1QKTA 3DCTA 4UDDA 5AZVA 5HCVA 1XVPB 3GYTA 3OOFA 2B1VA 3V9YA 5B41A 3UVVA 3VRUA 4DOSA 4YMQA 1M2ZA 3H0AD 1ZUCA 4OIUA 4PWLA 3VTDA 3HZFA 5APJA 4N73A 1SJ0A 4MG7A 1XAPA 1GWXA 1XOWA 4IWFA 5E19A 3K6PA 2VV3A 3VRWA 3P8XA 5DSHA 2GPUA 1RDTA 3GBKA 3R2AA 4G1YA 5CJ6A 4ZOMA 3PRGA 4POHA 1I37A 2XHSA 4M8EA 1G2NA 4FN9A 3A2HA 1YIMA 1ZAFA 4PVUA 5DV3A 5DV8A 5G45A 1XJ7A 2LBDA 5HYRA 2ZLCA 3AUQA 3HODA 3WMHA 5DVSA 3L03A 2ZMJA 5DZIA 5DV6A 1MZNA 1PQ9A 3GWSX 5EGVA 1ZKYA 1NUOA 2G0HA 5I4VA 3G8OA 4JYHA 1YYEA 2ACLB 2BJ4B 5GIDA 4JYGA 5DX3A 2PINA 5AWKA 5DXGA 3E00D 2AA5A 2P7AA 3HQ5A 4MG5A 1XNNA 4WHGA 4LBDA 3RUUA 5K13A 4RMCA 2PIRA 4XUMA 5DXBA 4ZJWA 5KCFA 2QA8B 4JAZA 2JF9A 2ZK5A 1E3KA 3AFRA 3WT6A 5KRIA 5AAVB 4IVYA 1NDEA 5DRJA 4YT1A 3R29A 3W5RA 3WT7A 3AURA 3B3KA 4OEZA 3HO0A 5DXMA 3TY0A 2VV1A 2YLQA 2GPOA 4E4QA 3HVLA 1PZLA 2QSEA 4P6WA 2I4ZA 3AZ2A 1R5KA 5DI7A 3UUCA 3OSIA 4PXMA 1XP6A 3DZUD 4APUA 5AAUA 3CDPA 5DRMA 3OS8A 1DB1A 4ZNTA 5L11A 2ZY0A 5A86A 4A4VA 2Q59A 5KCDA 2HAMA 3PCUA 4XUHA 2XYJA 2PIWA 3VJIA 4IS8A 3FLIA 3ERDA 3A9EA 3PO9A 4DQMA 1T5ZA 4RE8A 5KRHA 2QA6A 1Y9RA 4S15A 3LMPA 3DY6A 4MG6A 3VT8A 1IE9A 3E94A 2VV4B 4S14A 5AYGA 4IA2A 4J5XA 4P6XA 4IW6A 2R6WA 1NHZA 1UOMA 3WGPA 4IA7A 3OLFA 3VTBA 2J7XA 2R6YA 1XV9A 1R20D 3VT6A 4NY9A 5FQTA 2A3IA 1R6GA 1RKHA 3CQVA 3W0IA 3A3ZX 2ZBSA 3ADUA 3A2IA 3IA6A 3AZ3A 2XKWA 5IAWA 2ZXNA 4IQRA 4OH6A 4IV2A 1VJBA 1XNXA 2PITA 3SP9A 1OSHA 1FCXA 2AAXA 3NSQA 5ICKA 4QL8A 5FQPA 1PCGA 1S19A 2VV1B 1M13A 5DXQA 3B1MA 2AXAA 4NQAB 2YJAB 2B50A 2H79A 2QXMA 5G3JA 4ZN7A 3A78A 1NQ2A 1XVPA 5KRMA 5E15A 5KRLA 4DMAA 5EITA 3W0HA 4DK7A 1T63A 2YLYA 4OEAA 4OZTU 3W5PA 2E2RA 2ZNNA 4YPQA 3VT3A 1Q4XA 2JFAB 3F7DA 1GWRA 2QZOA 3IPSA 4LTWA 1Z5XU 2OZ7A 4NB6A 5E0WA 3D24A 3GYUA 5L7GA 1XV9B 4QE8A 2AWHA 4RZFA 1K4WA 1QKNA 2GPPA 3VRTA 2AYRA 1FM9A 2Q60A 2QR9A 3B0TA 3KWYA 4J5WC 5C4OA 1GS4A 1GWQA 5DVVA 3X36A 1OVLA 2ZK6A 5APHA 4G21A 1ERRA 2VSTA 4UDAA 4LNXA 3D5FA 3NSPA 3M7RA 3FXVA 3RVFA 2HC4A 4OLMA 2P4YA 3AN4A 5E7VA 2PIUA 3AN3A 5APKA 4MDDA 1KV6A 2GPVA 5DL4A 3DZYA 2ACLA 1FM6A 1S0XA 2BJ4A 4QK4A 3F5CB 3AUNA 2ZXMA 2FVJA 3IPUA 2I4PA 3IXPD 2O9IA 4CI5A 1T7FA 1I7GA 3RLLA 1XIUA 1ZDUA 4RUJA 5DUEA 5G43A 1K74D 2NXXA 2QA8A 2HASA 4Q13A 3G9EA 1NYXA 2YATA 1Y0SA 4MGBB 5AAVA 3ADTA 3B65A 3KPZA 5G42A 3B67A 3W5QA 4N8RA 4KZJA 3KMZA 2QZOB 1NQ7A 2AX6A 2ZK4A 5KYJA 3KMRA 3VN2A 1PQCA 2I4JA 2QGWA 1FCZA 3VRVA 5KRJA 3KFCA 2AA6A 5JY3A 4E2JA 2ZVTA 4Y29A 2G5OA 4KZIA 1NQ1A 5DYBA 1XZXX 4PP6A 3OSWA 5C4TA 4FHHA 3QT0A 2Q1VA 2PIVA 2PJLA 3CS8A 4IW8A 4OEYA 4B7WA 1OVLB 3ZR7A 5C4SA 1NAXA 2J7YA 4QM0A 1XP1A 1U3SA 4IA1A 3B0WA 5KCCA 3P0UA 3WWRA 3OLLA 5M96A 3ADVA 2PNUA 2VV4A 3P88A 3IPQA 4OHAA 5GICA 1YP0A 2QH6A 3VHUA 5KRCA 3WJ4A 1XLSA 3CDSA 5AZTA 2J14A 2V7CA 2HWRA 2EWPA 3WFFA 4X1GA 3X31A 2PIQA 4OEDA 1IE8A 3A2JA 3H52A 3E00A 3BQDA 1Z95A 3PEQA 1E3GA 2YLPA 3KMGA 3GZ9A 5KR9A 3CJWA 5DZ3A 4TV1B 4K7AA 2PRGA 2ZKCA 4K4JA 1UPVA 2Q61A 2PKLA 1H9UA 4UDBA 2Q7LA 4PP5A 1U9EA 3CS4A 1XP9A 5GT4A 3N00A 3G0WA 1U3RA 5KRFA 3R5NA 3R8AA 4OILA 3RLJA 3DZUA 5DTVA 4OARA 2ATHA 3OKHA 4EMAA 3BEJA 1NRLA 5DWEA 5ETHA 1X7BA 1X76A 4REFA 5DKBA 5KCWA 2HFPA 3V4AA 3VHVA 1XB7A 4JYIA 3V9VA 3KBAA 3VTCA 2ZASA 4CSJA 3SP6A 2JFAA 5HYKA 1SQNA 3BC5A 5E0XA 4IA3A 3X1HA 2I0GA 4WVDA 5KRAA 3HLVA 5DKSA 1YOWA 3OS9A 1T73A 1LBDA 3U9QA 5EHJA 3UUDB 3VHWA 1T7RA 4OFRA 3W0AA 1DKFB 5JJMB 4ZNHA 1R20A 4CI4A 1X7RA 3K8SA 2I0JA 4MG9B 1L2IA 4E4KA 1MV9A 2ABIA 4ITEA 1MVCA 2Q5PA 5DWIA 4IV4A 3WFGA 4J26A 2AA7A 1EREA 3ERTA 3W0JA 4ZJRA 4ZNUA 1S0ZA 2NV7A 3L0LA 5AWJA 2VSRA 5DIGA 3VT4A 2Q5SA 3R5MA 2QTUA 1T76A 1XDKB 3F5CA 2HBHA 4OKXA 5F9BA 1FBYA 1N46A 4OZTE 2O4JA 3UUAB 5G5WA 3VSPA 2POGA 2VV0A 4K6IA 3SZ1A 3V49A 5IXKA 3OZ0A 1G50A 5DUGA 2AB2A 2IOKA 1M7WA 2O4RA 3L0EA 3O1EA 1YINA 3L3ZA 3OMPA 3OOKA 4R2UA 3CTBA 4MGBA 3UU7A 4G1DA 2HWQA 1ILHA 2YLOA 1Z5XE 1XQCA 3OGTA 5KCTA 1SKXA 3ZRBA 5LWPA 2IOGA 2Q1HA 3HC5A 4X1FA 4J24A 1UPWA 4ZO1B 4G2IA 4WQPA 3OS8C 5FQRA 3KDUA 2ZNPA 1BSXA 1R1KD 2FSZA 4PRGA 3W0CA 2OVMA 2G44A 4OKTA 5EJVA 1ZDTA 2GWXA 3ET0A 5EC9A 3W0YA 4WLBA 1PQ6A 1RKGA 2H77A 1XQ3A 3FUGA 4BCRA 4OZRU 3OSAA 2PIPL 1NAVA 4RWVA 4PPSA 3MNPA 3EYBA 2HCDA 2NPAA 2AMAA 4J5XC 4WPFA 3FC6B 5DVCA 2BAWA 1S9PA 3GD2A 5DP0A 4EM9A 2XYXA 1U3QA 4OJ4A 1PRGA 3GWXA 5DK9A 2QPYA 5FQSA 5LGAA 2R40A 2XYWA 1G1UA 2QXSA 2POBA 3AZ1A 1OSVA 5DYDA 2P1UA 2YHDA 2Q6SA 5E1CA 3OMOA 1ZEOA 2Q7IA 1Y0XX 5HZCA 3VSOA 1PK5A 3IXPA 3JZCA 3FEJA 4OGHA 3VJSA 4O8FA 2QE4A 3LBDA 1K74A 4MGAB 5G46A 3L0JA 3H0AA 4TV1A 1I38A 4LSJA 3UU7B 5ACCA 5HJSA 5H1EA 5DKGA 5IZ0A 1XPCA 3G8IA 4RMEA 2HB7A 5EI1A 2AX9A 4L96A 1P8DA 2Z4JA 5DU5A 5KCEA 5DWLA 3P89A 1RK3A 3OMMA 3OMKA 3HM1A 2QGTA 5DZHA 2OM9A 3DCUA 4RZEA 3S9SA 3UP0A 1X78A 2ZK2A 2P1TA 5KD9A 3A40X 3MNEA 2QMVA 1A52A 3R8IA 3VI8A 4TUZB 4DM8A 4ZNWA 3FALB 5G44A 3VJHA 2AO6A 3Q95B 2J4AA 3ZRAA 3R8DA 2AM9A 2B23A 4WHFA 1X7EA 3KYTA 4RUOX 2Q6RA 4MG8B 5GIEA 3UUDA 2QNVA 5DKEA 2HB8A 4DORA 5KCUA 2AA2A 1DKFA 5JJMA 4M8HA 3OAPA 5DWJA 1TFCA 4IWCA 4MGDB 4PLDA 1UHLA 4MG9A 1RDTD 3CWDA 5DXEA 4OK1A 4N1YA 5AVIA 3IMYA 4OJ9A 4YNKA 2ZMHA 1YJEA 2YJDA 4XTAA 4XAOA 3RY9A 4HLWA 4G2HA 1TXIA 5SYZA 2ZK1A 2P1VA 5JI0D 1LV2A 2G0GA 3VT7A 4MGCA 5AVLA 4A4WA 5HJPB 1YA3A 4R06A 1XDKA 2P54A 4L98A 2HARA 2AX7A 4N5GA 2F4BA 3D6DA 4G1ZA 3UUAA 2AMBA 3ET1A 4F9MA 2Z4BA 1SR7A 1HJ1A 3AX8A 3HC6A 2P15A 4Q0AC 2GL8A 2QW4A 3UVVB 1S9QA 2OCFA 3FURA 4RZGA 2Q7KA 1KNUA 4FNEA 1ILGA 1YUCA 2ZK0A 3B66A 4IU7A 4UDCA 3ZQTA 3ADSA 3WJ5A 4OIVA 4S0TA 2ZK3A 4MG7B 4XT9A 2Q6JA 2ZXZA 2YFEA 3ILZA 4OH5A 4Q50A 5L7EA 3B5RA 1UHLB 3KDTA 3O1DA 3OKIA 4XHDA 5DY8A 1OT7A 4ZN9A 3TKCA 4RUPA 1N4HA 4OKBA 2GIUA 2VV2A 5FQVA 5E14A 1G5YA 5DIDA 3FC6A 3MNOA 3V3EA 3OZJA 4J5WA 4ZNSA 4IUIA 4IVWA 5KYAA 2ZFXA 3VJTA 5KRKA 4RAKA 4POJA 5DZ1A 2P7GA 1QKMA 3CLDA 5DMCA 1P93A 2NXXE
chains in the Genus database with same CATH topology
4OC7A 4PF3A 4XLDA 2Q7JA 5DX3B 1A28A 3UP3A 3VT5A 1T7TA 3L1BA 1RJKA 2OAXA 5DXKA 4MGAA 2ZLAA 3ET3A 1YY4A 1EXAA 3DT3A 4REEA 2FAIA 4RFWA 5DXBB 2AX8A 1FD0A 4PPPA 4S0SA 2PIXA 5KROA 5DMFA 3JZBA 3B0RA 3FS1A 2V0VA 1L2JA 3GN8A 5DLRA 2IHQA 4ZNVA 5L7HA 1R1KA 4OZRE 1EXXA 1ZGYA 2Q5GA 4OFUA 4QE6A 3V3QA 2ZMIA 3WTQA 1T7MA 2ZNQA 3X1IA 1T74A 3B68A 4NIEA 5DZ0A 5C4UA 1T79A 2Q59B 4PLEA 3T03A 4TUZA 3VT9A 3W0GA 3NOAA 2GP7A 2GTKA 2Q3YA 3FALA 4QJRA 4OJBA 1ZH7A 3CS6A 3TKMA 3Q95A 4ONIA 2B1ZA 3DR1A 3E7CA 1XLSE 2NW4A 2HVCA 3A9EB 3OMQA 4NUFA 4PP3A 1HG4A 4ZI1A 1YOKA 3B0QA 2OVHA 5DIEA 3D90A 4MG8A 3WT5A 1QKUA 4OKWA 4XI3A 3ET2A 2Q8SA 3ADWA 4R6SA 3K22A 4MGDA 3K23A 4G20A 3W5TA 3ADXA 2PIOA 5DUHA 2P7ZA 3FEIA 1FM9D 2OUZA 3V9TA 1I7IA 3D57A 4JL4A 4RMDA 4KZMA 3L3XA 4FGYA 1WM0X 1FCYA 2Q70A 2ZNOA 1N83A 2REWA 2JJ3A 3PLZA 1PDUA 5DWGA 1T65A 4ITFA 4FHIA 3TX7B 4JGVA 4A2JA 5DXRA 4DM6A 4DK8A 2W8YA 5AK2A 5HJPA 1KKQA 2R40D 1YMTA 5B5BA 3DZYD 1FM6D 3PBAA 3OLSA 4LNWA 4ZO1X 3RUTA 1NQ0A 1X7JA 2QABA 2ZL9A 4HEEX 5DXPA 1K7LA 1QKTA 3DCTA 4UDDA 5AZVA 5HCVA 1XVPB 3GYTA 3OOFA 2B1VA 3V9YA 5B41A 3UVVA 3VRUA 4DOSA 4YMQA 1M2ZA 3H0AD 1ZUCA 4OIUA 4PWLA 3VTDA 3HZFA 5APJA 4N73A 1SJ0A 4MG7A 1XAPA 1GWXA 1XOWA 4IWFA 5E19A 3K6PA 2VV3A 3VRWA 3P8XA 5DSHA 2GPUA 1RDTA 3GBKA 3R2AA 4G1YA 5CJ6A 4ZOMA 3PRGA 4POHA 1I37A 2XHSA 4M8EA 1G2NA 4FN9A 3A2HA 1YIMA 1ZAFA 4PVUA 5DV3A 5DV8A 5G45A 1XJ7A 2LBDA 5HYRA 2ZLCA 3AUQA 3HODA 3WMHA 5DVSA 3L03A 2ZMJA 5DZIA 5DV6A 1MZNA 1PQ9A 3GWSX 5EGVA 1ZKYA 1NUOA 2G0HA 5I4VA 3G8OA 4JYHA 1YYEA 2ACLB 2BJ4B 5GIDA 4JYGA 5DX3A 2PINA 5AWKA 5DXGA 3E00D 2AA5A 2P7AA 3HQ5A 4MG5A 1XNNA 4WHGA 4LBDA 3RUUA 5K13A 4RMCA 2PIRA 4XUMA 5DXBA 4ZJWA 5KCFA 2QA8B 4JAZA 2JF9A 2ZK5A 1E3KA 3AFRA 3WT6A 5KRIA 5AAVB 4IVYA 1NDEA 5DRJA 4YT1A 3R29A 3W5RA 3WT7A 3AURA 3B3KA 4OEZA 3HO0A 5DXMA 3TY0A 2VV1A 2YLQA 2GPOA 4E4QA 3HVLA 1PZLA 2QSEA 4P6WA 2I4ZA 3AZ2A 1R5KA 5DI7A 3UUCA 3OSIA 4PXMA 1XP6A 3DZUD 4APUA 5AAUA 3CDPA 5DRMA 3OS8A 1DB1A 4ZNTA 5L11A 2ZY0A 5A86A 4A4VA 2Q59A 5KCDA 2HAMA 3PCUA 4XUHA 2XYJA 2PIWA 3VJIA 4IS8A 3FLIA 3ERDA 3A9EA 3PO9A 4DQMA 1T5ZA 4RE8A 5KRHA 2QA6A 1Y9RA 4S15A 3LMPA 3DY6A 4MG6A 3VT8A 1IE9A 3E94A 2VV4B 4S14A 5AYGA 4IA2A 4J5XA 4P6XA 4IW6A 2R6WA 1NHZA 1UOMA 3WGPA 4IA7A 3OLFA 3VTBA 2J7XA 2R6YA 1XV9A 1R20D 3VT6A 4NY9A 5FQTA 2A3IA 1R6GA 1RKHA 3CQVA 3W0IA 3A3ZX 2ZBSA 3ADUA 3A2IA 3IA6A 3AZ3A 2XKWA 5IAWA 2ZXNA 4IQRA 4OH6A 4IV2A 1VJBA 1XNXA 2PITA 3SP9A 1OSHA 1FCXA 2AAXA 3NSQA 5ICKA 4QL8A 5FQPA 1PCGA 1S19A 2VV1B 1M13A 5DXQA 3B1MA 2AXAA 4NQAB 2YJAB 2B50A 2H79A 2QXMA 5G3JA 4ZN7A 3A78A 1NQ2A 1XVPA 5KRMA 5E15A 5KRLA 4DMAA 5EITA 3W0HA 4DK7A 1T63A 2YLYA 4OEAA 4OZTU 3W5PA 2E2RA 2ZNNA 4YPQA 3VT3A 1Q4XA 2JFAB 3F7DA 1GWRA 2QZOA 3IPSA 4LTWA 1Z5XU 2OZ7A 4NB6A 5E0WA 3D24A 3GYUA 5L7GA 1XV9B 4QE8A 2AWHA 4RZFA 1K4WA 1QKNA 2GPPA 3VRTA 2AYRA 1FM9A 2Q60A 2QR9A 3B0TA 3KWYA 4J5WC 5C4OA 1GS4A 1GWQA 5DVVA 3X36A 1OVLA 2ZK6A 5APHA 4G21A 1ERRA 2VSTA 4UDAA 4LNXA 3D5FA 3NSPA 3M7RA 3FXVA 3RVFA 2HC4A 4OLMA 2P4YA 3AN4A 5E7VA 2PIUA 3AN3A 5APKA 4MDDA 1KV6A 2GPVA 5DL4A 3DZYA 2ACLA 1FM6A 1S0XA 2BJ4A 4QK4A 3F5CB 3AUNA 2ZXMA 2FVJA 3IPUA 2I4PA 3IXPD 2O9IA 4CI5A 1T7FA 1I7GA 3RLLA 1XIUA 1ZDUA 4RUJA 5DUEA 5G43A 1K74D 2NXXA 2QA8A 2HASA 4Q13A 3G9EA 1NYXA 2YATA 1Y0SA 4MGBB 5AAVA 3ADTA 3B65A 3KPZA 5G42A 3B67A 3W5QA 4N8RA 4KZJA 3KMZA 2QZOB 1NQ7A 2AX6A 2ZK4A 5KYJA 3KMRA 3VN2A 1PQCA 2I4JA 2QGWA 1FCZA 3VRVA 5KRJA 3KFCA 2AA6A 5JY3A 4E2JA 2ZVTA 4Y29A 2G5OA 4KZIA 1NQ1A 5DYBA 1XZXX 4PP6A 3OSWA 5C4TA 4FHHA 3QT0A 2Q1VA 2PIVA 2PJLA 3CS8A 4IW8A 4OEYA 4B7WA 1OVLB 3ZR7A 5C4SA 1NAXA 2J7YA 4QM0A 1XP1A 1U3SA 4IA1A 3B0WA 5KCCA 3P0UA 3WWRA 3OLLA 5M96A 3ADVA 2PNUA 2VV4A 3P88A 3IPQA 4OHAA 5GICA 1YP0A 2QH6A 3VHUA 5KRCA 3WJ4A 1XLSA 3CDSA 5AZTA 2J14A 2V7CA 2HWRA 2EWPA 3WFFA 4X1GA 3X31A 2PIQA 4OEDA 1IE8A 3A2JA 3H52A 3E00A 3BQDA 1Z95A 3PEQA 1E3GA 2YLPA 3KMGA 3GZ9A 5KR9A 3CJWA 5DZ3A 4TV1B 4K7AA 2PRGA 2ZKCA 4K4JA 1UPVA 2Q61A 2PKLA 1H9UA 4UDBA 2Q7LA 4PP5A 1U9EA 3CS4A 1XP9A 5GT4A 3N00A 3G0WA 1U3RA 5KRFA 3R5NA 3R8AA 4OILA 3RLJA 3DZUA 5DTVA 4OARA 2ATHA 3OKHA 4EMAA 3BEJA 1NRLA 5DWEA 5ETHA 1X7BA 1X76A 4REFA 5DKBA 5KCWA 2HFPA 3V4AA 3VHVA 1XB7A 4JYIA 3V9VA 3KBAA 3VTCA 2ZASA 4CSJA 3SP6A 2JFAA 5HYKA 1SQNA 3BC5A 5E0XA 4IA3A 3X1HA 2I0GA 4WVDA 5KRAA 3HLVA 5DKSA 1YOWA 3OS9A 1T73A 1LBDA 3U9QA 5EHJA 3UUDB 3VHWA 1T7RA 4OFRA 3W0AA 1DKFB 5JJMB 4ZNHA 1R20A 4CI4A 1X7RA 3K8SA 2I0JA 4MG9B 1L2IA 4E4KA 1MV9A 2ABIA 4ITEA 1MVCA 2Q5PA 5DWIA 4IV4A 3WFGA 4J26A 2AA7A 1EREA 3ERTA 3W0JA 4ZJRA 4ZNUA 1S0ZA 2NV7A 3L0LA 5AWJA 2VSRA 5DIGA 3VT4A 2Q5SA 3R5MA 2QTUA 1T76A 1XDKB 3F5CA 2HBHA 4OKXA 5F9BA 1FBYA 1N46A 4OZTE 2O4JA 3UUAB 5G5WA 3VSPA 2POGA 2VV0A 4K6IA 3SZ1A 3V49A 5IXKA 3OZ0A 1G50A 5DUGA 2AB2A 2IOKA 1M7WA 2O4RA 3L0EA 3O1EA 1YINA 3L3ZA 3OMPA 3OOKA 4R2UA 3CTBA 4MGBA 3UU7A 4G1DA 2HWQA 1ILHA 2YLOA 1Z5XE 1XQCA 3OGTA 5KCTA 1SKXA 3ZRBA 5LWPA 2IOGA 2Q1HA 3HC5A 4X1FA 4J24A 1UPWA 4ZO1B 4G2IA 4WQPA 3OS8C 5FQRA 3KDUA 2ZNPA 1BSXA 1R1KD 2FSZA 4PRGA 3W0CA 2OVMA 2G44A 4OKTA 5EJVA 1ZDTA 2GWXA 3ET0A 5EC9A 3W0YA 4WLBA 1PQ6A 1RKGA 2H77A 1XQ3A 3FUGA 4BCRA 4OZRU 3OSAA 2PIPL 1NAVA 4RWVA 4PPSA 3MNPA 3EYBA 2HCDA 2NPAA 2AMAA 4J5XC 4WPFA 3FC6B 5DVCA 2BAWA 1S9PA 3GD2A 5DP0A 4EM9A 2XYXA 1U3QA 4OJ4A 1PRGA 3GWXA 5DK9A 2QPYA 5FQSA 5LGAA 2R40A 2XYWA 1G1UA 2QXSA 2POBA 3AZ1A 1OSVA 5DYDA 2P1UA 2YHDA 2Q6SA 5E1CA 3OMOA 1ZEOA 2Q7IA 1Y0XX 5HZCA 3VSOA 1PK5A 3IXPA 3JZCA 3FEJA 4OGHA 3VJSA 4O8FA 2QE4A 3LBDA 1K74A 4MGAB 5G46A 3L0JA 3H0AA 4TV1A 1I38A 4LSJA 3UU7B 5ACCA 5HJSA 5H1EA 5DKGA 5IZ0A 1XPCA 3G8IA 4RMEA 2HB7A 5EI1A 2AX9A 4L96A 1P8DA 2Z4JA 5DU5A 5KCEA 5DWLA 3P89A 1RK3A 3OMMA 3OMKA 3HM1A 2QGTA 5DZHA 2OM9A 3DCUA 4RZEA 3S9SA 3UP0A 1X78A 2ZK2A 2P1TA 5KD9A 3A40X 3MNEA 2QMVA 1A52A 3R8IA 3VI8A 4TUZB 4DM8A 4ZNWA 3FALB 5G44A 3VJHA 2AO6A 3Q95B 2J4AA 3ZRAA 3R8DA 2AM9A 2B23A 4WHFA 1X7EA 3KYTA 4RUOX 2Q6RA 4MG8B 5GIEA 3UUDA 2QNVA 5DKEA 2HB8A 4DORA 5KCUA 2AA2A 1DKFA 5JJMA 4M8HA 3OAPA 5DWJA 1TFCA 4IWCA 4MGDB 4PLDA 1UHLA 4MG9A 1RDTD 3CWDA 5DXEA 4OK1A 4N1YA 5AVIA 3IMYA 4OJ9A 4YNKA 2ZMHA 1YJEA 2YJDA 4XTAA 4XAOA 3RY9A 4HLWA 4G2HA 1TXIA 5SYZA 2ZK1A 2P1VA 5JI0D 1LV2A 2G0GA 3VT7A 4MGCA 5AVLA 4A4WA 5HJPB 1YA3A 4R06A 1XDKA 2P54A 4L98A 2HARA 2AX7A 4N5GA 2F4BA 3D6DA 4G1ZA 3UUAA 2AMBA 3ET1A 4F9MA 2Z4BA 1SR7A 1HJ1A 3AX8A 3HC6A 2P15A 4Q0AC 2GL8A 2QW4A 3UVVB 1S9QA 2OCFA 3FURA 4RZGA 2Q7KA 1KNUA 4FNEA 1ILGA 1YUCA 2ZK0A 3B66A 4IU7A 4UDCA 3ZQTA 3ADSA 3WJ5A 4OIVA 4S0TA 2ZK3A 4MG7B 4XT9A 2Q6JA 2ZXZA 2YFEA 3ILZA 4OH5A 4Q50A 5L7EA 3B5RA 1UHLB 3KDTA 3O1DA 3OKIA 4XHDA 5DY8A 1OT7A 4ZN9A 3TKCA 4RUPA 1N4HA 4OKBA 2GIUA 2VV2A 5FQVA 5E14A 1G5YA 5DIDA 3FC6A 3MNOA 3V3EA 3OZJA 4J5WA 4ZNSA 4IUIA 4IVWA 5KYAA 2ZFXA 3VJTA 5KRKA 4RAKA 4POJA 5DZ1A 2P7GA 1QKMA 3CLDA 5DMCA 1P93A 2NXXE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OC7 A;  4PF3 A;  4XLD A;  2Q7J A;  5DX3 B;  1A28 A;  3UP3 A;  3VT5 A;  1T7T A;  3L1B A;  1RJK A;  2OAX A;  5DXK A;  4MGA A;  2ZLA A;  3ET3 A;  1YY4 A;  1EXA A;  3DT3 A;  4REE A;  2FAI A;  4RFW A;  5DXB B;  2AX8 A;  1FD0 A;  4PPP A;  4S0S A;  2PIX A;  5KRO A;  5DMF A;  3JZB A;  3B0R A;  3FS1 A;  2V0V A;  1L2J A;  3GN8 A;  5DLR A;  2IHQ A;  4ZNV A;  5L7H A;  1R1K A;  4OZR E;  1EXX A;  1ZGY A;  2Q5G A;  4OFU A;  4QE6 A;  3V3Q A;  2ZMI A;  3WTQ A;  1T7M A;  2ZNQ A;  3X1I A;  1T74 A;  3B68 A;  4NIE A;  5DZ0 A;  5C4U A;  1T79 A;  2Q59 B;  4PLE A;  3T03 A;  4TUZ A;  3VT9 A;  3W0G A;  3NOA A;  2GP7 A;  2GTK A;  2Q3Y A;  3FAL A;  4QJR A;  4OJB A;  1ZH7 A;  3CS6 A;  3TKM A;  3Q95 A;  4ONI A;  2B1Z A;  3DR1 A;  3E7C A;  1XLS E;  2NW4 A;  2HVC A;  3A9E B;  3OMQ A;  4NUF A;  4PP3 A;  1HG4 A;  4ZI1 A;  1YOK A;  3B0Q A;  2OVH A;  5DIE A;  3D90 A;  4MG8 A;  3WT5 A;  1QKU A;  4OKW A;  4XI3 A;  3ET2 A;  2Q8S A;  3ADW A;  4R6S A;  3K22 A;  4MGD A;  3K23 A;  4G20 A;  3W5T A;  3ADX A;  2PIO A;  5DUH A;  2P7Z A;  3FEI A;  1FM9 D;  2OUZ A;  3V9T A;  1I7I A;  3D57 A;  4JL4 A;  4RMD A;  4KZM A;  3L3X A;  4FGY A;  1WM0 X;  1FCY A;  2Q70 A;  2ZNO A;  1N83 A;  2REW A;  2JJ3 A;  3PLZ A;  1PDU A;  5DWG A;  1T65 A;  4ITF A;  4FHI A;  3TX7 B;  4JGV A;  4A2J A;  5DXR A;  4DM6 A;  4DK8 A;  2W8Y A;  5AK2 A;  5HJP A;  1KKQ A;  2R40 D;  1YMT A;  5B5B A;  3DZY D;  1FM6 D;  3PBA A;  3OLS A;  4LNW A;  4ZO1 X;  3RUT A;  1NQ0 A;  1X7J A;  2QAB A;  2ZL9 A;  4HEE X;  5DXP A;  1K7L A;  1QKT A;  3DCT A;  4UDD A;  5AZV A;  5HCV A;  1XVP B;  3GYT A;  3OOF A;  2B1V A;  3V9Y A;  5B41 A;  3UVV A;  3VRU A;  4DOS A;  4YMQ A;  1M2Z A;  3H0A D;  1ZUC A;  4OIU A;  4PWL A;  3VTD A;  3HZF A;  5APJ A;  4N73 A;  1SJ0 A;  4MG7 A;  1XAP A;  1GWX A;  1XOW A;  4IWF A;  5E19 A;  3K6P A;  2VV3 A;  3VRW A;  3P8X A;  5DSH A;  2GPU A;  1RDT A;  3GBK A;  3R2A A;  4G1Y A;  5CJ6 A;  4ZOM A;  3PRG A;  4POH A;  1I37 A;  2XHS A;  4M8E A;  1G2N A;  4FN9 A;  3A2H A;  1YIM A;  1ZAF A;  4PVU A;  5DV3 A;  5DV8 A;  5G45 A;  1XJ7 A;  2LBD A;  5HYR A;  2ZLC A;  3AUQ A;  3HOD A;  3WMH A;  5DVS A;  3L03 A;  2ZMJ A;  5DZI A;  5DV6 A;  1MZN A;  1PQ9 A;  3GWS X;  5EGV A;  1ZKY A;  1NUO A;  2G0H A;  5I4V A;  3G8O A;  4JYH A;  1YYE A;  2ACL B;  2BJ4 B;  5GID A;  4JYG A;  5DX3 A;  2PIN A;  5AWK A;  5DXG A;  3E00 D;  2AA5 A;  2P7A A;  3HQ5 A;  4MG5 A;  1XNN A;  4WHG A;  4LBD A;  3RUU A;  5K13 A;  4RMC A;  2PIR A;  4XUM A;  5DXB A;  4ZJW A;  5KCF A;  2QA8 B;  4JAZ A;  2JF9 A;  2ZK5 A;  1E3K A;  3AFR A;  3WT6 A;  5KRI A;  5AAV B;  4IVY A;  1NDE A;  5DRJ A;  4YT1 A;  3R29 A;  3W5R A;  3WT7 A;  3AUR A;  3B3K A;  4OEZ A;  3HO0 A;  5DXM A;  3TY0 A;  2VV1 A;  2YLQ A;  2GPO A;  4E4Q A;  3HVL A;  1PZL A;  2QSE A;  4P6W A;  2I4Z A;  3AZ2 A;  1R5K A;  5DI7 A;  3UUC A;  3OSI A;  4PXM A;  1XP6 A;  3DZU D;  4APU A;  5AAU A;  3CDP A;  5DRM A;  3OS8 A;  1DB1 A;  4ZNT A;  5L11 A;  2ZY0 A;  5A86 A;  4A4V A;  2Q59 A;  5KCD A;  2HAM A;  3PCU A;  4XUH A;  2XYJ A;  2PIW A;  3VJI A;  4IS8 A;  3FLI A;  3ERD A;  3A9E A;  3PO9 A;  4DQM A;  1T5Z A;  4RE8 A;  5KRH A;  2QA6 A;  1Y9R A;  4S15 A;  3LMP A;  3DY6 A;  4MG6 A;  3VT8 A;  1IE9 A;  3E94 A;  2VV4 B;  4S14 A;  5AYG A;  4IA2 A;  4J5X A;  4P6X A;  4IW6 A;  2R6W A;  1NHZ A;  1UOM A;  3WGP A;  4IA7 A;  3OLF A;  3VTB A;  2J7X A;  2R6Y A;  1XV9 A;  1R20 D;  3VT6 A;  4NY9 A;  5FQT A;  2A3I A;  1R6G A;  1RKH A;  3CQV A;  3W0I A;  3A3Z X;  2ZBS A;  3ADU A;  3A2I A;  3IA6 A;  3AZ3 A;  2XKW A;  5IAW A;  2ZXN A;  4IQR A;  4OH6 A;  4IV2 A;  1VJB A;  1XNX A;  2PIT A;  3SP9 A;  1OSH A;  1FCX A;  2AAX A;  3NSQ A;  5ICK A;  4QL8 A;  5FQP A;  1PCG A;  1S19 A;  2VV1 B;  1M13 A;  5DXQ A;  3B1M A;  2AXA A;  4NQA B;  2YJA B;  2B50 A;  2H79 A;  2QXM A;  5G3J A;  4ZN7 A;  3A78 A;  1NQ2 A;  1XVP A;  5KRM A;  5E15 A;  5KRL A;  4DMA A;  5EIT A;  3W0H A;  4DK7 A;  1T63 A;  2YLY A;  4OEA A;  4OZT U;  3W5P A;  2E2R A;  2ZNN A;  4YPQ A;  3VT3 A;  1Q4X A;  2JFA B;  3F7D A;  1GWR A;  2QZO A;  3IPS A;  4LTW A;  1Z5X U;  2OZ7 A;  4NB6 A;  5E0W A;  3D24 A;  3GYU A;  5L7G A;  1XV9 B;  4QE8 A;  2AWH A;  4RZF A;  1K4W A;  1QKN A;  2GPP A;  3VRT A;  2AYR A;  1FM9 A;  2Q60 A;  2QR9 A;  3B0T A;  3KWY A;  4J5W C;  5C4O A;  1GS4 A;  1GWQ A;  5DVV A;  3X36 A;  1OVL A;  2ZK6 A;  5APH A;  4G21 A;  1ERR A;  2VST A;  4UDA A;  4LNX A;  3D5F A;  3NSP A;  3M7R A;  3FXV A;  3RVF A;  2HC4 A;  4OLM A;  2P4Y A;  3AN4 A;  5E7V A;  2PIU A;  3AN3 A;  5APK A;  4MDD A;  1KV6 A;  2GPV A;  5DL4 A;  3DZY A;  2ACL A;  1FM6 A;  1S0X A;  2BJ4 A;  4QK4 A;  3F5C B;  3AUN A;  2ZXM A;  2FVJ A;  3IPU A;  2I4P A;  3IXP D;  2O9I A;  4CI5 A;  1T7F A;  1I7G A;  3RLL A;  1XIU A;  1ZDU A;  4RUJ A;  5DUE A;  5G43 A;  1K74 D;  2NXX A;  2QA8 A;  2HAS A;  4Q13 A;  3G9E A;  1NYX A;  2YAT A;  1Y0S A;  4MGB B;  5AAV A;  3ADT A;  3B65 A;  3KPZ A;  5G42 A;  3B67 A;  3W5Q A;  4N8R A;  4KZJ A;  3KMZ A;  2QZO B;  1NQ7 A;  2AX6 A;  2ZK4 A;  5KYJ A;  3KMR A;  3VN2 A;  1PQC A;  2I4J A;  2QGW A;  1FCZ A;  3VRV A;  5KRJ A;  3KFC A;  2AA6 A;  5JY3 A;  4E2J A;  2ZVT A;  4Y29 A;  2G5O A;  4KZI A;  1NQ1 A;  5DYB A;  1XZX X;  4PP6 A;  3OSW A;  5C4T A;  4FHH A;  3QT0 A;  2Q1V A;  2PIV A;  2PJL A;  3CS8 A;  4IW8 A;  4OEY A;  4B7W A;  1OVL B;  3ZR7 A;  5C4S A;  1NAX A;  2J7Y A;  4QM0 A;  1XP1 A;  1U3S A;  4IA1 A;  3B0W A;  5KCC A;  3P0U A;  3WWR A;  3OLL A;  5M96 A;  3ADV A;  2PNU A;  2VV4 A;  3P88 A;  3IPQ A;  4OHA A;  5GIC A;  1YP0 A;  2QH6 A;  3VHU A;  5KRC A;  3WJ4 A;  1XLS A;  3CDS A;  5AZT A;  2J14 A;  2V7C A;  2HWR A;  2EWP A;  3WFF A;  4X1G A;  3X31 A;  2PIQ A;  4OED A;  1IE8 A;  3A2J A;  3H52 A;  3E00 A;  3BQD A;  1Z95 A;  3PEQ A;  1E3G A;  2YLP A;  3KMG A;  3GZ9 A;  5KR9 A;  3CJW A;  5DZ3 A;  4TV1 B;  4K7A A;  2PRG A;  2ZKC A;  4K4J A;  1UPV A;  2Q61 A;  2PKL A;  1H9U A;  4UDB A;  2Q7L A;  4PP5 A;  1U9E A;  3CS4 A;  1XP9 A;  5GT4 A;  3N00 A;  3G0W A;  1U3R A;  5KRF A;  3R5N A;  3R8A A;  4OIL A;  3RLJ A;  3DZU A;  5DTV A;  4OAR A;  2ATH A;  3OKH A;  4EMA A;  3BEJ A;  1NRL A;  5DWE A;  5ETH A;  1X7B A;  1X76 A;  4REF A;  5DKB A;  5KCW A;  2HFP A;  3V4A A;  3VHV A;  1XB7 A;  4JYI A;  3V9V A;  3KBA A;  3VTC A;  2ZAS A;  4CSJ A;  3SP6 A;  2JFA A;  5HYK A;  1SQN A;  3BC5 A;  5E0X A;  4IA3 A;  3X1H A;  2I0G A;  4WVD A;  5KRA A;  3HLV A;  5DKS A;  1YOW A;  3OS9 A;  1T73 A;  1LBD A;  3U9Q A;  5EHJ A;  3UUD B;  3VHW A;  1T7R A;  4OFR A;  3W0A A;  1DKF B;  5JJM B;  4ZNH A;  1R20 A;  4CI4 A;  1X7R A;  3K8S A;  2I0J A;  4MG9 B;  1L2I A;  4E4K A;  1MV9 A;  2ABI A;  4ITE A;  1MVC A;  2Q5P A;  5DWI A;  4IV4 A;  3WFG A;  4J26 A;  2AA7 A;  1ERE A;  3ERT A;  3W0J A;  4ZJR A;  4ZNU A;  1S0Z A;  2NV7 A;  3L0L A;  5AWJ A;  2VSR A;  5DIG A;  3VT4 A;  2Q5S A;  3R5M A;  2QTU A;  1T76 A;  1XDK B;  3F5C A;  2HBH A;  4OKX A;  5F9B A;  1FBY A;  1N46 A;  4OZT E;  2O4J A;  3UUA B;  5G5W A;  3VSP A;  2POG A;  2VV0 A;  4K6I A;  3SZ1 A;  3V49 A;  5IXK A;  3OZ0 A;  1G50 A;  5DUG A;  2AB2 A;  2IOK A;  1M7W A;  2O4R A;  3L0E A;  3O1E A;  1YIN A;  3L3Z A;  3OMP A;  3OOK A;  4R2U A;  3CTB A;  4MGB A;  3UU7 A;  4G1D A;  2HWQ A;  1ILH A;  2YLO A;  1Z5X E;  1XQC A;  3OGT A;  5KCT A;  1SKX A;  3ZRB A;  5LWP A;  2IOG A;  2Q1H A;  3HC5 A;  4X1F A;  4J24 A;  1UPW A;  4ZO1 B;  4G2I A;  4WQP A;  3OS8 C;  5FQR A;  3KDU A;  2ZNP A;  1BSX A;  1R1K D;  2FSZ A;  4PRG A;  3W0C A;  2OVM A;  2G44 A;  4OKT A;  5EJV A;  1ZDT A;  2GWX A;  3ET0 A;  5EC9 A;  3W0Y A;  4WLB A;  1PQ6 A;  1RKG A;  2H77 A;  1XQ3 A;  3FUG A;  4BCR A;  4OZR U;  3OSA A;  2PIP L;  1NAV A;  4RWV A;  4PPS A;  3MNP A;  3EYB A;  2HCD A;  2NPA A;  2AMA A;  4J5X C;  4WPF A;  3FC6 B;  5DVC A;  2BAW A;  1S9P A;  3GD2 A;  5DP0 A;  4EM9 A;  2XYX A;  1U3Q A;  4OJ4 A;  1PRG A;  3GWX A;  5DK9 A;  2QPY A;  5FQS A;  5LGA A;  2R40 A;  2XYW A;  1G1U A;  2QXS A;  2POB A;  3AZ1 A;  1OSV A;  5DYD A;  2P1U A;  2YHD A;  2Q6S A;  5E1C A;  3OMO A;  1ZEO A;  2Q7I A;  1Y0X X;  5HZC A;  3VSO A;  1PK5 A;  3IXP A;  3JZC A;  3FEJ A;  4OGH A;  3VJS A;  4O8F A;  2QE4 A;  3LBD A;  1K74 A;  4MGA B;  5G46 A;  3L0J A;  3H0A A;  4TV1 A;  1I38 A;  4LSJ A;  3UU7 B;  5ACC A;  5HJS A;  5H1E A;  5DKG A;  5IZ0 A;  1XPC A;  3G8I A;  4RME A;  2HB7 A;  5EI1 A;  2AX9 A;  4L96 A;  1P8D A;  2Z4J A;  5DU5 A;  5KCE A;  5DWL A;  3P89 A;  1RK3 A;  3OMM A;  3OMK A;  3HM1 A;  2QGT A;  5DZH A;  2OM9 A;  3DCU A;  4RZE A;  3S9S A;  3UP0 A;  1X78 A;  2ZK2 A;  2P1T A;  5KD9 A;  3A40 X;  3MNE A;  2QMV A;  1A52 A;  3R8I A;  3VI8 A;  4TUZ B;  4DM8 A;  4ZNW A;  3FAL B;  5G44 A;  3VJH A;  2AO6 A;  3Q95 B;  2J4A A;  3ZRA A;  3R8D A;  2AM9 A;  2B23 A;  4WHF A;  1X7E A;  3KYT A;  4RUO X;  2Q6R A;  4MG8 B;  5GIE A;  3UUD A;  2QNV A;  5DKE A;  2HB8 A;  4DOR A;  5KCU A;  2AA2 A;  1DKF A;  5JJM A;  4M8H A;  3OAP A;  5DWJ A;  1TFC A;  4IWC A;  4MGD B;  4PLD A;  1UHL A;  4MG9 A;  1RDT D;  3CWD A;  5DXE A;  4OK1 A;  4N1Y A;  5AVI A;  3IMY A;  4OJ9 A;  4YNK A;  2ZMH A;  1YJE A;  2YJD A;  4XTA A;  4XAO A;  3RY9 A;  4HLW A;  4G2H A;  1TXI A;  5SYZ A;  2ZK1 A;  2P1V A;  5JI0 D;  1LV2 A;  2G0G A;  3VT7 A;  4MGC A;  5AVL A;  4A4W A;  5HJP B;  1YA3 A;  4R06 A;  1XDK A;  2P54 A;  4L98 A;  2HAR A;  2AX7 A;  4N5G A;  2F4B A;  3D6D A;  4G1Z A;  3UUA A;  2AMB A;  3ET1 A;  4F9M A;  2Z4B A;  1SR7 A;  1HJ1 A;  3AX8 A;  3HC6 A;  2P15 A;  4Q0A C;  2GL8 A;  2QW4 A;  3UVV B;  1S9Q A;  2OCF A;  3FUR A;  4RZG A;  2Q7K A;  1KNU A;  4FNE A;  1ILG A;  1YUC A;  2ZK0 A;  3B66 A;  4IU7 A;  4UDC A;  3ZQT A;  3ADS A;  3WJ5 A;  4OIV A;  4S0T A;  2ZK3 A;  4MG7 B;  4XT9 A;  2Q6J A;  2ZXZ A;  2YFE A;  3ILZ A;  4OH5 A;  4Q50 A;  5L7E A;  3B5R A;  1UHL B;  3KDT A;  3O1D A;  3OKI A;  4XHD A;  5DY8 A;  1OT7 A;  4ZN9 A;  3TKC A;  4RUP A;  1N4H A;  4OKB A;  2GIU A;  2VV2 A;  5FQV A;  5E14 A;  1G5Y A;  5DID A;  3FC6 A;  3MNO A;  3V3E A;  3OZJ A;  4J5W A;  4ZNS A;  4IUI A;  4IVW A;  5KYA A;  2ZFX A;  3VJT A;  5KRK A;  4RAK A;  4POJ A;  5DZ1 A;  2P7G A;  1QKM A;  3CLD A;  5DMC A;  1P93 A;  2NXX E; 
#chains in the Genus database with same CATH topology
 4OC7 A;  4PF3 A;  4XLD A;  2Q7J A;  5DX3 B;  1A28 A;  3UP3 A;  3VT5 A;  1T7T A;  3L1B A;  1RJK A;  2OAX A;  5DXK A;  4MGA A;  2ZLA A;  3ET3 A;  1YY4 A;  1EXA A;  3DT3 A;  4REE A;  2FAI A;  4RFW A;  5DXB B;  2AX8 A;  1FD0 A;  4PPP A;  4S0S A;  2PIX A;  5KRO A;  5DMF A;  3JZB A;  3B0R A;  3FS1 A;  2V0V A;  1L2J A;  3GN8 A;  5DLR A;  2IHQ A;  4ZNV A;  5L7H A;  1R1K A;  4OZR E;  1EXX A;  1ZGY A;  2Q5G A;  4OFU A;  4QE6 A;  3V3Q A;  2ZMI A;  3WTQ A;  1T7M A;  2ZNQ A;  3X1I A;  1T74 A;  3B68 A;  4NIE A;  5DZ0 A;  5C4U A;  1T79 A;  2Q59 B;  4PLE A;  3T03 A;  4TUZ A;  3VT9 A;  3W0G A;  3NOA A;  2GP7 A;  2GTK A;  2Q3Y A;  3FAL A;  4QJR A;  4OJB A;  1ZH7 A;  3CS6 A;  3TKM A;  3Q95 A;  4ONI A;  2B1Z A;  3DR1 A;  3E7C A;  1XLS E;  2NW4 A;  2HVC A;  3A9E B;  3OMQ A;  4NUF A;  4PP3 A;  1HG4 A;  4ZI1 A;  1YOK A;  3B0Q A;  2OVH A;  5DIE A;  3D90 A;  4MG8 A;  3WT5 A;  1QKU A;  4OKW A;  4XI3 A;  3ET2 A;  2Q8S A;  3ADW A;  4R6S A;  3K22 A;  4MGD A;  3K23 A;  4G20 A;  3W5T A;  3ADX A;  2PIO A;  5DUH A;  2P7Z A;  3FEI A;  1FM9 D;  2OUZ A;  3V9T A;  1I7I A;  3D57 A;  4JL4 A;  4RMD A;  4KZM A;  3L3X A;  4FGY A;  1WM0 X;  1FCY A;  2Q70 A;  2ZNO A;  1N83 A;  2REW A;  2JJ3 A;  3PLZ A;  1PDU A;  5DWG A;  1T65 A;  4ITF A;  4FHI A;  3TX7 B;  4JGV A;  4A2J A;  5DXR A;  4DM6 A;  4DK8 A;  2W8Y A;  5AK2 A;  5HJP A;  1KKQ A;  2R40 D;  1YMT A;  5B5B A;  3DZY D;  1FM6 D;  3PBA A;  3OLS A;  4LNW A;  4ZO1 X;  3RUT A;  1NQ0 A;  1X7J A;  2QAB A;  2ZL9 A;  4HEE X;  5DXP A;  1K7L A;  1QKT A;  3DCT A;  4UDD A;  5AZV A;  5HCV A;  1XVP B;  3GYT A;  3OOF A;  2B1V A;  3V9Y A;  5B41 A;  3UVV A;  3VRU A;  4DOS A;  4YMQ A;  1M2Z A;  3H0A D;  1ZUC A;  4OIU A;  4PWL A;  3VTD A;  3HZF A;  5APJ A;  4N73 A;  1SJ0 A;  4MG7 A;  1XAP A;  1GWX A;  1XOW A;  4IWF A;  5E19 A;  3K6P A;  2VV3 A;  3VRW A;  3P8X A;  5DSH A;  2GPU A;  1RDT A;  3GBK A;  3R2A A;  4G1Y A;  5CJ6 A;  4ZOM A;  3PRG A;  4POH A;  1I37 A;  2XHS A;  4M8E A;  1G2N A;  4FN9 A;  3A2H A;  1YIM A;  1ZAF A;  4PVU A;  5DV3 A;  5DV8 A;  5G45 A;  1XJ7 A;  2LBD A;  5HYR A;  2ZLC A;  3AUQ A;  3HOD A;  3WMH A;  5DVS A;  3L03 A;  2ZMJ A;  5DZI A;  5DV6 A;  1MZN A;  1PQ9 A;  3GWS X;  5EGV A;  1ZKY A;  1NUO A;  2G0H A;  5I4V A;  3G8O A;  4JYH A;  1YYE A;  2ACL B;  2BJ4 B;  5GID A;  4JYG A;  5DX3 A;  2PIN A;  5AWK A;  5DXG A;  3E00 D;  2AA5 A;  2P7A A;  3HQ5 A;  4MG5 A;  1XNN A;  4WHG A;  4LBD A;  3RUU A;  5K13 A;  4RMC A;  2PIR A;  4XUM A;  5DXB A;  4ZJW A;  5KCF A;  2QA8 B;  4JAZ A;  2JF9 A;  2ZK5 A;  1E3K A;  3AFR A;  3WT6 A;  5KRI A;  5AAV B;  4IVY A;  1NDE A;  5DRJ A;  4YT1 A;  3R29 A;  3W5R A;  3WT7 A;  3AUR A;  3B3K A;  4OEZ A;  3HO0 A;  5DXM A;  3TY0 A;  2VV1 A;  2YLQ A;  2GPO A;  4E4Q A;  3HVL A;  1PZL A;  2QSE A;  4P6W A;  2I4Z A;  3AZ2 A;  1R5K A;  5DI7 A;  3UUC A;  3OSI A;  4PXM A;  1XP6 A;  3DZU D;  4APU A;  5AAU A;  3CDP A;  5DRM A;  3OS8 A;  1DB1 A;  4ZNT A;  5L11 A;  2ZY0 A;  5A86 A;  4A4V A;  2Q59 A;  5KCD A;  2HAM A;  3PCU A;  4XUH A;  2XYJ A;  2PIW A;  3VJI A;  4IS8 A;  3FLI A;  3ERD A;  3A9E A;  3PO9 A;  4DQM A;  1T5Z A;  4RE8 A;  5KRH A;  2QA6 A;  1Y9R A;  4S15 A;  3LMP A;  3DY6 A;  4MG6 A;  3VT8 A;  1IE9 A;  3E94 A;  2VV4 B;  4S14 A;  5AYG A;  4IA2 A;  4J5X A;  4P6X A;  4IW6 A;  2R6W A;  1NHZ A;  1UOM A;  3WGP A;  4IA7 A;  3OLF A;  3VTB A;  2J7X A;  2R6Y A;  1XV9 A;  1R20 D;  3VT6 A;  4NY9 A;  5FQT A;  2A3I A;  1R6G A;  1RKH A;  3CQV A;  3W0I A;  3A3Z X;  2ZBS A;  3ADU A;  3A2I A;  3IA6 A;  3AZ3 A;  2XKW A;  5IAW A;  2ZXN A;  4IQR A;  4OH6 A;  4IV2 A;  1VJB A;  1XNX A;  2PIT A;  3SP9 A;  1OSH A;  1FCX A;  2AAX A;  3NSQ A;  5ICK A;  4QL8 A;  5FQP A;  1PCG A;  1S19 A;  2VV1 B;  1M13 A;  5DXQ A;  3B1M A;  2AXA A;  4NQA B;  2YJA B;  2B50 A;  2H79 A;  2QXM A;  5G3J A;  4ZN7 A;  3A78 A;  1NQ2 A;  1XVP A;  5KRM A;  5E15 A;  5KRL A;  4DMA A;  5EIT A;  3W0H A;  4DK7 A;  1T63 A;  2YLY A;  4OEA A;  4OZT U;  3W5P A;  2E2R A;  2ZNN A;  4YPQ A;  3VT3 A;  1Q4X A;  2JFA B;  3F7D A;  1GWR A;  2QZO A;  3IPS A;  4LTW A;  1Z5X U;  2OZ7 A;  4NB6 A;  5E0W A;  3D24 A;  3GYU A;  5L7G A;  1XV9 B;  4QE8 A;  2AWH A;  4RZF A;  1K4W A;  1QKN A;  2GPP A;  3VRT A;  2AYR A;  1FM9 A;  2Q60 A;  2QR9 A;  3B0T A;  3KWY A;  4J5W C;  5C4O A;  1GS4 A;  1GWQ A;  5DVV A;  3X36 A;  1OVL A;  2ZK6 A;  5APH A;  4G21 A;  1ERR A;  2VST A;  4UDA A;  4LNX A;  3D5F A;  3NSP A;  3M7R A;  3FXV A;  3RVF A;  2HC4 A;  4OLM A;  2P4Y A;  3AN4 A;  5E7V A;  2PIU A;  3AN3 A;  5APK A;  4MDD A;  1KV6 A;  2GPV A;  5DL4 A;  3DZY A;  2ACL A;  1FM6 A;  1S0X A;  2BJ4 A;  4QK4 A;  3F5C B;  3AUN A;  2ZXM A;  2FVJ A;  3IPU A;  2I4P A;  3IXP D;  2O9I A;  4CI5 A;  1T7F A;  1I7G A;  3RLL A;  1XIU A;  1ZDU A;  4RUJ A;  5DUE A;  5G43 A;  1K74 D;  2NXX A;  2QA8 A;  2HAS A;  4Q13 A;  3G9E A;  1NYX A;  2YAT A;  1Y0S A;  4MGB B;  5AAV A;  3ADT A;  3B65 A;  3KPZ A;  5G42 A;  3B67 A;  3W5Q A;  4N8R A;  4KZJ A;  3KMZ A;  2QZO B;  1NQ7 A;  2AX6 A;  2ZK4 A;  5KYJ A;  3KMR A;  3VN2 A;  1PQC A;  2I4J A;  2QGW A;  1FCZ A;  3VRV A;  5KRJ A;  3KFC A;  2AA6 A;  5JY3 A;  4E2J A;  2ZVT A;  4Y29 A;  2G5O A;  4KZI A;  1NQ1 A;  5DYB A;  1XZX X;  4PP6 A;  3OSW A;  5C4T A;  4FHH A;  3QT0 A;  2Q1V A;  2PIV A;  2PJL A;  3CS8 A;  4IW8 A;  4OEY A;  4B7W A;  1OVL B;  3ZR7 A;  5C4S A;  1NAX A;  2J7Y A;  4QM0 A;  1XP1 A;  1U3S A;  4IA1 A;  3B0W A;  5KCC A;  3P0U A;  3WWR A;  3OLL A;  5M96 A;  3ADV A;  2PNU A;  2VV4 A;  3P88 A;  3IPQ A;  4OHA A;  5GIC A;  1YP0 A;  2QH6 A;  3VHU A;  5KRC A;  3WJ4 A;  1XLS A;  3CDS A;  5AZT A;  2J14 A;  2V7C A;  2HWR A;  2EWP A;  3WFF A;  4X1G A;  3X31 A;  2PIQ A;  4OED A;  1IE8 A;  3A2J A;  3H52 A;  3E00 A;  3BQD A;  1Z95 A;  3PEQ A;  1E3G A;  2YLP A;  3KMG A;  3GZ9 A;  5KR9 A;  3CJW A;  5DZ3 A;  4TV1 B;  4K7A A;  2PRG A;  2ZKC A;  4K4J A;  1UPV A;  2Q61 A;  2PKL A;  1H9U A;  4UDB A;  2Q7L A;  4PP5 A;  1U9E A;  3CS4 A;  1XP9 A;  5GT4 A;  3N00 A;  3G0W A;  1U3R A;  5KRF A;  3R5N A;  3R8A A;  4OIL A;  3RLJ A;  3DZU A;  5DTV A;  4OAR A;  2ATH A;  3OKH A;  4EMA A;  3BEJ A;  1NRL A;  5DWE A;  5ETH A;  1X7B A;  1X76 A;  4REF A;  5DKB A;  5KCW A;  2HFP A;  3V4A A;  3VHV A;  1XB7 A;  4JYI A;  3V9V A;  3KBA A;  3VTC A;  2ZAS A;  4CSJ A;  3SP6 A;  2JFA A;  5HYK A;  1SQN A;  3BC5 A;  5E0X A;  4IA3 A;  3X1H A;  2I0G A;  4WVD A;  5KRA A;  3HLV A;  5DKS A;  1YOW A;  3OS9 A;  1T73 A;  1LBD A;  3U9Q A;  5EHJ A;  3UUD B;  3VHW A;  1T7R A;  4OFR A;  3W0A A;  1DKF B;  5JJM B;  4ZNH A;  1R20 A;  4CI4 A;  1X7R A;  3K8S A;  2I0J A;  4MG9 B;  1L2I A;  4E4K A;  1MV9 A;  2ABI A;  4ITE A;  1MVC A;  2Q5P A;  5DWI A;  4IV4 A;  3WFG A;  4J26 A;  2AA7 A;  1ERE A;  3ERT A;  3W0J A;  4ZJR A;  4ZNU A;  1S0Z A;  2NV7 A;  3L0L A;  5AWJ A;  2VSR A;  5DIG A;  3VT4 A;  2Q5S A;  3R5M A;  2QTU A;  1T76 A;  1XDK B;  3F5C A;  2HBH A;  4OKX A;  5F9B A;  1FBY A;  1N46 A;  4OZT E;  2O4J A;  3UUA B;  5G5W A;  3VSP A;  2POG A;  2VV0 A;  4K6I A;  3SZ1 A;  3V49 A;  5IXK A;  3OZ0 A;  1G50 A;  5DUG A;  2AB2 A;  2IOK A;  1M7W A;  2O4R A;  3L0E A;  3O1E A;  1YIN A;  3L3Z A;  3OMP A;  3OOK A;  4R2U A;  3CTB A;  4MGB A;  3UU7 A;  4G1D A;  2HWQ A;  1ILH A;  2YLO A;  1Z5X E;  1XQC A;  3OGT A;  5KCT A;  1SKX A;  3ZRB A;  5LWP A;  2IOG A;  2Q1H A;  3HC5 A;  4X1F A;  4J24 A;  1UPW A;  4ZO1 B;  4G2I A;  4WQP A;  3OS8 C;  5FQR A;  3KDU A;  2ZNP A;  1BSX A;  1R1K D;  2FSZ A;  4PRG A;  3W0C A;  2OVM A;  2G44 A;  4OKT A;  5EJV A;  1ZDT A;  2GWX A;  3ET0 A;  5EC9 A;  3W0Y A;  4WLB A;  1PQ6 A;  1RKG A;  2H77 A;  1XQ3 A;  3FUG A;  4BCR A;  4OZR U;  3OSA A;  2PIP L;  1NAV A;  4RWV A;  4PPS A;  3MNP A;  3EYB A;  2HCD A;  2NPA A;  2AMA A;  4J5X C;  4WPF A;  3FC6 B;  5DVC A;  2BAW A;  1S9P A;  3GD2 A;  5DP0 A;  4EM9 A;  2XYX A;  1U3Q A;  4OJ4 A;  1PRG A;  3GWX A;  5DK9 A;  2QPY A;  5FQS A;  5LGA A;  2R40 A;  2XYW A;  1G1U A;  2QXS A;  2POB A;  3AZ1 A;  1OSV A;  5DYD A;  2P1U A;  2YHD A;  2Q6S A;  5E1C A;  3OMO A;  1ZEO A;  2Q7I A;  1Y0X X;  5HZC A;  3VSO A;  1PK5 A;  3IXP A;  3JZC A;  3FEJ A;  4OGH A;  3VJS A;  4O8F A;  2QE4 A;  3LBD A;  1K74 A;  4MGA B;  5G46 A;  3L0J A;  3H0A A;  4TV1 A;  1I38 A;  4LSJ A;  3UU7 B;  5ACC A;  5HJS A;  5H1E A;  5DKG A;  5IZ0 A;  1XPC A;  3G8I A;  4RME A;  2HB7 A;  5EI1 A;  2AX9 A;  4L96 A;  1P8D A;  2Z4J A;  5DU5 A;  5KCE A;  5DWL A;  3P89 A;  1RK3 A;  3OMM A;  3OMK A;  3HM1 A;  2QGT A;  5DZH A;  2OM9 A;  3DCU A;  4RZE A;  3S9S A;  3UP0 A;  1X78 A;  2ZK2 A;  2P1T A;  5KD9 A;  3A40 X;  3MNE A;  2QMV A;  1A52 A;  3R8I A;  3VI8 A;  4TUZ B;  4DM8 A;  4ZNW A;  3FAL B;  5G44 A;  3VJH A;  2AO6 A;  3Q95 B;  2J4A A;  3ZRA A;  3R8D A;  2AM9 A;  2B23 A;  4WHF A;  1X7E A;  3KYT A;  4RUO X;  2Q6R A;  4MG8 B;  5GIE A;  3UUD A;  2QNV A;  5DKE A;  2HB8 A;  4DOR A;  5KCU A;  2AA2 A;  1DKF A;  5JJM A;  4M8H A;  3OAP A;  5DWJ A;  1TFC A;  4IWC A;  4MGD B;  4PLD A;  1UHL A;  4MG9 A;  1RDT D;  3CWD A;  5DXE A;  4OK1 A;  4N1Y A;  5AVI A;  3IMY A;  4OJ9 A;  4YNK A;  2ZMH A;  1YJE A;  2YJD A;  4XTA A;  4XAO A;  3RY9 A;  4HLW A;  4G2H A;  1TXI A;  5SYZ A;  2ZK1 A;  2P1V A;  5JI0 D;  1LV2 A;  2G0G A;  3VT7 A;  4MGC A;  5AVL A;  4A4W A;  5HJP B;  1YA3 A;  4R06 A;  1XDK A;  2P54 A;  4L98 A;  2HAR A;  2AX7 A;  4N5G A;  2F4B A;  3D6D A;  4G1Z A;  3UUA A;  2AMB A;  3ET1 A;  4F9M A;  2Z4B A;  1SR7 A;  1HJ1 A;  3AX8 A;  3HC6 A;  2P15 A;  4Q0A C;  2GL8 A;  2QW4 A;  3UVV B;  1S9Q A;  2OCF A;  3FUR A;  4RZG A;  2Q7K A;  1KNU A;  4FNE A;  1ILG A;  1YUC A;  2ZK0 A;  3B66 A;  4IU7 A;  4UDC A;  3ZQT A;  3ADS A;  3WJ5 A;  4OIV A;  4S0T A;  2ZK3 A;  4MG7 B;  4XT9 A;  2Q6J A;  2ZXZ A;  2YFE A;  3ILZ A;  4OH5 A;  4Q50 A;  5L7E A;  3B5R A;  1UHL B;  3KDT A;  3O1D A;  3OKI A;  4XHD A;  5DY8 A;  1OT7 A;  4ZN9 A;  3TKC A;  4RUP A;  1N4H A;  4OKB A;  2GIU A;  2VV2 A;  5FQV A;  5E14 A;  1G5Y A;  5DID A;  3FC6 A;  3MNO A;  3V3E A;  3OZJ A;  4J5W A;  4ZNS A;  4IUI A;  4IVW A;  5KYA A;  2ZFX A;  3VJT A;  5KRK A;  4RAK A;  4POJ A;  5DZ1 A;  2P7G A;  1QKM A;  3CLD A;  5DMC A;  1P93 A;  2NXX E; 
#chains in the Genus database with same CATH homology
 4OC7 A;  4PF3 A;  4XLD A;  2Q7J A;  5DX3 B;  1A28 A;  3UP3 A;  3VT5 A;  1T7T A;  3L1B A;  1RJK A;  2OAX A;  5DXK A;  4MGA A;  2ZLA A;  3ET3 A;  1YY4 A;  1EXA A;  3DT3 A;  4REE A;  2FAI A;  4RFW A;  5DXB B;  2AX8 A;  1FD0 A;  4PPP A;  4S0S A;  2PIX A;  5KRO A;  5DMF A;  3JZB A;  3B0R A;  3FS1 A;  2V0V A;  1L2J A;  3GN8 A;  5DLR A;  2IHQ A;  4ZNV A;  5L7H A;  1R1K A;  4OZR E;  1EXX A;  1ZGY A;  2Q5G A;  4OFU A;  4QE6 A;  3V3Q A;  2ZMI A;  3WTQ A;  1T7M A;  2ZNQ A;  3X1I A;  1T74 A;  3B68 A;  4NIE A;  5DZ0 A;  5C4U A;  1T79 A;  2Q59 B;  4PLE A;  3T03 A;  4TUZ A;  3VT9 A;  3W0G A;  3NOA A;  2GP7 A;  2GTK A;  2Q3Y A;  3FAL A;  4QJR A;  4OJB A;  1ZH7 A;  3CS6 A;  3TKM A;  3Q95 A;  4ONI A;  2B1Z A;  3DR1 A;  3E7C A;  1XLS E;  2NW4 A;  2HVC A;  3A9E B;  3OMQ A;  4NUF A;  4PP3 A;  1HG4 A;  4ZI1 A;  1YOK A;  3B0Q A;  2OVH A;  5DIE A;  3D90 A;  4MG8 A;  3WT5 A;  1QKU A;  4OKW A;  4XI3 A;  3ET2 A;  2Q8S A;  3ADW A;  4R6S A;  3K22 A;  4MGD A;  3K23 A;  4G20 A;  3W5T A;  3ADX A;  2PIO A;  5DUH A;  2P7Z A;  3FEI A;  1FM9 D;  2OUZ A;  3V9T A;  1I7I A;  3D57 A;  4JL4 A;  4RMD A;  4KZM A;  3L3X A;  4FGY A;  1WM0 X;  1FCY A;  2Q70 A;  2ZNO A;  1N83 A;  2REW A;  2JJ3 A;  3PLZ A;  1PDU A;  5DWG A;  1T65 A;  4ITF A;  4FHI A;  3TX7 B;  4JGV A;  4A2J A;  5DXR A;  4DM6 A;  4DK8 A;  2W8Y A;  5AK2 A;  5HJP A;  1KKQ A;  2R40 D;  1YMT A;  5B5B A;  3DZY D;  1FM6 D;  3PBA A;  3OLS A;  4LNW A;  4ZO1 X;  3RUT A;  1NQ0 A;  1X7J A;  2QAB A;  2ZL9 A;  4HEE X;  5DXP A;  1K7L A;  1QKT A;  3DCT A;  4UDD A;  5AZV A;  5HCV A;  1XVP B;  3GYT A;  3OOF A;  2B1V A;  3V9Y A;  5B41 A;  3UVV A;  3VRU A;  4DOS A;  4YMQ A;  1M2Z A;  3H0A D;  1ZUC A;  4OIU A;  4PWL A;  3VTD A;  3HZF A;  5APJ A;  4N73 A;  1SJ0 A;  4MG7 A;  1XAP A;  1GWX A;  1XOW A;  4IWF A;  5E19 A;  3K6P A;  2VV3 A;  3VRW A;  3P8X A;  5DSH A;  2GPU A;  1RDT A;  3GBK A;  3R2A A;  4G1Y A;  5CJ6 A;  4ZOM A;  3PRG A;  4POH A;  1I37 A;  2XHS A;  4M8E A;  1G2N A;  4FN9 A;  3A2H A;  1YIM A;  1ZAF A;  4PVU A;  5DV3 A;  5DV8 A;  5G45 A;  1XJ7 A;  2LBD A;  5HYR A;  2ZLC A;  3AUQ A;  3HOD A;  3WMH A;  5DVS A;  3L03 A;  2ZMJ A;  5DZI A;  5DV6 A;  1MZN A;  1PQ9 A;  3GWS X;  5EGV A;  1ZKY A;  1NUO A;  2G0H A;  5I4V A;  3G8O A;  4JYH A;  1YYE A;  2ACL B;  2BJ4 B;  5GID A;  4JYG A;  5DX3 A;  2PIN A;  5AWK A;  5DXG A;  3E00 D;  2AA5 A;  2P7A A;  3HQ5 A;  4MG5 A;  1XNN A;  4WHG A;  4LBD A;  3RUU A;  5K13 A;  4RMC A;  2PIR A;  4XUM A;  5DXB A;  4ZJW A;  5KCF A;  2QA8 B;  4JAZ A;  2JF9 A;  2ZK5 A;  1E3K A;  3AFR A;  3WT6 A;  5KRI A;  5AAV B;  4IVY A;  1NDE A;  5DRJ A;  4YT1 A;  3R29 A;  3W5R A;  3WT7 A;  3AUR A;  3B3K A;  4OEZ A;  3HO0 A;  5DXM A;  3TY0 A;  2VV1 A;  2YLQ A;  2GPO A;  4E4Q A;  3HVL A;  1PZL A;  2QSE A;  4P6W A;  2I4Z A;  3AZ2 A;  1R5K A;  5DI7 A;  3UUC A;  3OSI A;  4PXM A;  1XP6 A;  3DZU D;  4APU A;  5AAU A;  3CDP A;  5DRM A;  3OS8 A;  1DB1 A;  4ZNT A;  5L11 A;  2ZY0 A;  5A86 A;  4A4V A;  2Q59 A;  5KCD A;  2HAM A;  3PCU A;  4XUH A;  2XYJ A;  2PIW A;  3VJI A;  4IS8 A;  3FLI A;  3ERD A;  3A9E A;  3PO9 A;  4DQM A;  1T5Z A;  4RE8 A;  5KRH A;  2QA6 A;  1Y9R A;  4S15 A;  3LMP A;  3DY6 A;  4MG6 A;  3VT8 A;  1IE9 A;  3E94 A;  2VV4 B;  4S14 A;  5AYG A;  4IA2 A;  4J5X A;  4P6X A;  4IW6 A;  2R6W A;  1NHZ A;  1UOM A;  3WGP A;  4IA7 A;  3OLF A;  3VTB A;  2J7X A;  2R6Y A;  1XV9 A;  1R20 D;  3VT6 A;  4NY9 A;  5FQT A;  2A3I A;  1R6G A;  1RKH A;  3CQV A;  3W0I A;  3A3Z X;  2ZBS A;  3ADU A;  3A2I A;  3IA6 A;  3AZ3 A;  2XKW A;  5IAW A;  2ZXN A;  4IQR A;  4OH6 A;  4IV2 A;  1VJB A;  1XNX A;  2PIT A;  3SP9 A;  1OSH A;  1FCX A;  2AAX A;  3NSQ A;  5ICK A;  4QL8 A;  5FQP A;  1PCG A;  1S19 A;  2VV1 B;  1M13 A;  5DXQ A;  3B1M A;  2AXA A;  4NQA B;  2YJA B;  2B50 A;  2H79 A;  2QXM A;  5G3J A;  4ZN7 A;  3A78 A;  1NQ2 A;  1XVP A;  5KRM A;  5E15 A;  5KRL A;  4DMA A;  5EIT A;  3W0H A;  4DK7 A;  1T63 A;  2YLY A;  4OEA A;  4OZT U;  3W5P A;  2E2R A;  2ZNN A;  4YPQ A;  3VT3 A;  1Q4X A;  2JFA B;  3F7D A;  1GWR A;  2QZO A;  3IPS A;  4LTW A;  1Z5X U;  2OZ7 A;  4NB6 A;  5E0W A;  3D24 A;  3GYU A;  5L7G A;  1XV9 B;  4QE8 A;  2AWH A;  4RZF A;  1K4W A;  1QKN A;  2GPP A;  3VRT A;  2AYR A;  1FM9 A;  2Q60 A;  2QR9 A;  3B0T A;  3KWY A;  4J5W C;  5C4O A;  1GS4 A;  1GWQ A;  5DVV A;  3X36 A;  1OVL A;  2ZK6 A;  5APH A;  4G21 A;  1ERR A;  2VST A;  4UDA A;  4LNX A;  3D5F A;  3NSP A;  3M7R A;  3FXV A;  3RVF A;  2HC4 A;  4OLM A;  2P4Y A;  3AN4 A;  5E7V A;  2PIU A;  3AN3 A;  5APK A;  4MDD A;  1KV6 A;  2GPV A;  5DL4 A;  3DZY A;  2ACL A;  1FM6 A;  1S0X A;  2BJ4 A;  4QK4 A;  3F5C B;  3AUN A;  2ZXM A;  2FVJ A;  3IPU A;  2I4P A;  3IXP D;  2O9I A;  4CI5 A;  1T7F A;  1I7G A;  3RLL A;  1XIU A;  1ZDU A;  4RUJ A;  5DUE A;  5G43 A;  1K74 D;  2NXX A;  2QA8 A;  2HAS A;  4Q13 A;  3G9E A;  1NYX A;  2YAT A;  1Y0S A;  4MGB B;  5AAV A;  3ADT A;  3B65 A;  3KPZ A;  5G42 A;  3B67 A;  3W5Q A;  4N8R A;  4KZJ A;  3KMZ A;  2QZO B;  1NQ7 A;  2AX6 A;  2ZK4 A;  5KYJ A;  3KMR A;  3VN2 A;  1PQC A;  2I4J A;  2QGW A;  1FCZ A;  3VRV A;  5KRJ A;  3KFC A;  2AA6 A;  5JY3 A;  4E2J A;  2ZVT A;  4Y29 A;  2G5O A;  4KZI A;  1NQ1 A;  5DYB A;  1XZX X;  4PP6 A;  3OSW A;  5C4T A;  4FHH A;  3QT0 A;  2Q1V A;  2PIV A;  2PJL A;  3CS8 A;  4IW8 A;  4OEY A;  4B7W A;  1OVL B;  3ZR7 A;  5C4S A;  1NAX A;  2J7Y A;  4QM0 A;  1XP1 A;  1U3S A;  4IA1 A;  3B0W A;  5KCC A;  3P0U A;  3WWR A;  3OLL A;  5M96 A;  3ADV A;  2PNU A;  2VV4 A;  3P88 A;  3IPQ A;  4OHA A;  5GIC A;  1YP0 A;  2QH6 A;  3VHU A;  5KRC A;  3WJ4 A;  1XLS A;  3CDS A;  5AZT A;  2J14 A;  2V7C A;  2HWR A;  2EWP A;  3WFF A;  4X1G A;  3X31 A;  2PIQ A;  4OED A;  1IE8 A;  3A2J A;  3H52 A;  3E00 A;  3BQD A;  1Z95 A;  3PEQ A;  1E3G A;  2YLP A;  3KMG A;  3GZ9 A;  5KR9 A;  3CJW A;  5DZ3 A;  4TV1 B;  4K7A A;  2PRG A;  2ZKC A;  4K4J A;  1UPV A;  2Q61 A;  2PKL A;  1H9U A;  4UDB A;  2Q7L A;  4PP5 A;  1U9E A;  3CS4 A;  1XP9 A;  5GT4 A;  3N00 A;  3G0W A;  1U3R A;  5KRF A;  3R5N A;  3R8A A;  4OIL A;  3RLJ A;  3DZU A;  5DTV A;  4OAR A;  2ATH A;  3OKH A;  4EMA A;  3BEJ A;  1NRL A;  5DWE A;  5ETH A;  1X7B A;  1X76 A;  4REF A;  5DKB A;  5KCW A;  2HFP A;  3V4A A;  3VHV A;  1XB7 A;  4JYI A;  3V9V A;  3KBA A;  3VTC A;  2ZAS A;  4CSJ A;  3SP6 A;  2JFA A;  5HYK A;  1SQN A;  3BC5 A;  5E0X A;  4IA3 A;  3X1H A;  2I0G A;  4WVD A;  5KRA A;  3HLV A;  5DKS A;  1YOW A;  3OS9 A;  1T73 A;  1LBD A;  3U9Q A;  5EHJ A;  3UUD B;  3VHW A;  1T7R A;  4OFR A;  3W0A A;  1DKF B;  5JJM B;  4ZNH A;  1R20 A;  4CI4 A;  1X7R A;  3K8S A;  2I0J A;  4MG9 B;  1L2I A;  4E4K A;  1MV9 A;  2ABI A;  4ITE A;  1MVC A;  2Q5P A;  5DWI A;  4IV4 A;  3WFG A;  4J26 A;  2AA7 A;  1ERE A;  3ERT A;  3W0J A;  4ZJR A;  4ZNU A;  1S0Z A;  2NV7 A;  3L0L A;  5AWJ A;  2VSR A;  5DIG A;  3VT4 A;  2Q5S A;  3R5M A;  2QTU A;  1T76 A;  1XDK B;  3F5C A;  2HBH A;  4OKX A;  5F9B A;  1FBY A;  1N46 A;  4OZT E;  2O4J A;  3UUA B;  5G5W A;  3VSP A;  2POG A;  2VV0 A;  4K6I A;  3SZ1 A;  3V49 A;  5IXK A;  3OZ0 A;  1G50 A;  5DUG A;  2AB2 A;  2IOK A;  1M7W A;  2O4R A;  3L0E A;  3O1E A;  1YIN A;  3L3Z A;  3OMP A;  3OOK A;  4R2U A;  3CTB A;  4MGB A;  3UU7 A;  4G1D A;  2HWQ A;  1ILH A;  2YLO A;  1Z5X E;  1XQC A;  3OGT A;  5KCT A;  1SKX A;  3ZRB A;  5LWP A;  2IOG A;  2Q1H A;  3HC5 A;  4X1F A;  4J24 A;  1UPW A;  4ZO1 B;  4G2I A;  4WQP A;  3OS8 C;  5FQR A;  3KDU A;  2ZNP A;  1BSX A;  1R1K D;  2FSZ A;  4PRG A;  3W0C A;  2OVM A;  2G44 A;  4OKT A;  5EJV A;  1ZDT A;  2GWX A;  3ET0 A;  5EC9 A;  3W0Y A;  4WLB A;  1PQ6 A;  1RKG A;  2H77 A;  1XQ3 A;  3FUG A;  4BCR A;  4OZR U;  3OSA A;  2PIP L;  1NAV A;  4RWV A;  4PPS A;  3MNP A;  3EYB A;  2HCD A;  2NPA A;  2AMA A;  4J5X C;  4WPF A;  3FC6 B;  5DVC A;  2BAW A;  1S9P A;  3GD2 A;  5DP0 A;  4EM9 A;  2XYX A;  1U3Q A;  4OJ4 A;  1PRG A;  3GWX A;  5DK9 A;  2QPY A;  5FQS A;  5LGA A;  2R40 A;  2XYW A;  1G1U A;  2QXS A;  2POB A;  3AZ1 A;  1OSV A;  5DYD A;  2P1U A;  2YHD A;  2Q6S A;  5E1C A;  3OMO A;  1ZEO A;  2Q7I A;  1Y0X X;  5HZC A;  3VSO A;  1PK5 A;  3IXP A;  3JZC A;  3FEJ A;  4OGH A;  3VJS A;  4O8F A;  2QE4 A;  3LBD A;  1K74 A;  4MGA B;  5G46 A;  3L0J A;  3H0A A;  4TV1 A;  1I38 A;  4LSJ A;  3UU7 B;  5ACC A;  5HJS A;  5H1E A;  5DKG A;  5IZ0 A;  1XPC A;  3G8I A;  4RME A;  2HB7 A;  5EI1 A;  2AX9 A;  4L96 A;  1P8D A;  2Z4J A;  5DU5 A;  5KCE A;  5DWL A;  3P89 A;  1RK3 A;  3OMM A;  3OMK A;  3HM1 A;  2QGT A;  5DZH A;  2OM9 A;  3DCU A;  4RZE A;  3S9S A;  3UP0 A;  1X78 A;  2ZK2 A;  2P1T A;  5KD9 A;  3A40 X;  3MNE A;  2QMV A;  1A52 A;  3R8I A;  3VI8 A;  4TUZ B;  4DM8 A;  4ZNW A;  3FAL B;  5G44 A;  3VJH A;  2AO6 A;  3Q95 B;  2J4A A;  3ZRA A;  3R8D A;  2AM9 A;  2B23 A;  4WHF A;  1X7E A;  3KYT A;  4RUO X;  2Q6R A;  4MG8 B;  5GIE A;  3UUD A;  2QNV A;  5DKE A;  2HB8 A;  4DOR A;  5KCU A;  2AA2 A;  1DKF A;  5JJM A;  4M8H A;  3OAP A;  5DWJ A;  1TFC A;  4IWC A;  4MGD B;  4PLD A;  1UHL A;  4MG9 A;  1RDT D;  3CWD A;  5DXE A;  4OK1 A;  4N1Y A;  5AVI A;  3IMY A;  4OJ9 A;  4YNK A;  2ZMH A;  1YJE A;  2YJD A;  4XTA A;  4XAO A;  3RY9 A;  4HLW A;  4G2H A;  1TXI A;  5SYZ A;  2ZK1 A;  2P1V A;  5JI0 D;  1LV2 A;  2G0G A;  3VT7 A;  4MGC A;  5AVL A;  4A4W A;  5HJP B;  1YA3 A;  4R06 A;  1XDK A;  2P54 A;  4L98 A;  2HAR A;  2AX7 A;  4N5G A;  2F4B A;  3D6D A;  4G1Z A;  3UUA A;  2AMB A;  3ET1 A;  4F9M A;  2Z4B A;  1SR7 A;  1HJ1 A;  3AX8 A;  3HC6 A;  2P15 A;  4Q0A C;  2GL8 A;  2QW4 A;  3UVV B;  1S9Q A;  2OCF A;  3FUR A;  4RZG A;  2Q7K A;  1KNU A;  4FNE A;  1ILG A;  1YUC A;  2ZK0 A;  3B66 A;  4IU7 A;  4UDC A;  3ZQT A;  3ADS A;  3WJ5 A;  4OIV A;  4S0T A;  2ZK3 A;  4MG7 B;  4XT9 A;  2Q6J A;  2ZXZ A;  2YFE A;  3ILZ A;  4OH5 A;  4Q50 A;  5L7E A;  3B5R A;  1UHL B;  3KDT A;  3O1D A;  3OKI A;  4XHD A;  5DY8 A;  1OT7 A;  4ZN9 A;  3TKC A;  4RUP A;  1N4H A;  4OKB A;  2GIU A;  2VV2 A;  5FQV A;  5E14 A;  1G5Y A;  5DID A;  3FC6 A;  3MNO A;  3V3E A;  3OZJ A;  4J5W A;  4ZNS A;  4IUI A;  4IVW A;  5KYA A;  2ZFX A;  3VJT A;  5KRK A;  4RAK A;  4POJ A;  5DZ1 A;  2P7G A;  1QKM A;  3CLD A;  5DMC A;  1P93 A;  2NXX E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...