5C4TA

Identification of a novel allosteric binding site for rorgt inhibitors
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
241
structure length
241
Chain Sequence
LTEIEHLVQSVCKSYRETCQLRLEDLLRQRSNIFSREEVTGYQRKSMWEMWERCAHHLTEAIQYVVEFAKRLSGFMELCQNDQIVLLKAGAMEVVLVRMCRAYNADNRTVFFEGKYGGMELFRALGCSELISSIFDFSHSLSALHFSEDEIALYTALVLINAHRPGLQEKRKVEQLQYNLELAFHHHLHKTHRQSILAKLPPKGKLRSLCSQHVERLQIFQHLHPIVVQAAFPPLYKELFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/transcription inhibitor
molecule keywords Nuclear receptor ROR-gamma
publication title Identification of an allosteric binding site for ROR gamma t inhibition.
pubmed doi rcsb
source organism Homo sapiens
total genus 93
structure length 241
sequence length 241
ec nomenclature
pdb deposition date 2015-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 5c4tA00
1NAVA 3Q95B 5G42A 3UVVA 3UVVB 4DOSA 3F5CB 3A2JA 3D24A 5DMCA 5DSHA 4HLWA 2ACLA 2ACLB 1XNNA 2Q7KA 3NSPA 4OZTU 5DZHA 3D90A 2PIVA 3CLDA 5C4SA 3OMQA 3VJHA 3OGTA 4PPPA 4ZO1X 2GWXA 5GICA 5DKBA 2PIWA 1KV6A 2IOKA 2R40D 2I4JA 2XYWA 3A2IA 5AK2A 1UPWA 3R8DA 3VT6A 3W0HA 3JZBA 1K74A 3ZR7A 1OT7A 4IVWA 4N5GA 2GIUA 2HFPA 5G45A 2HB8A 5KRLA 2I0JA 2V7CA 4ZJRA 2NXXA 1PQCA 1NQ0A 3X36A 4IS8A 5ICKA 4RMEA 4OIUA 1H9UA 3BC5A 3L1BA 3AN4A 1Y0XX 4OILA 2Q60A 3B0RA 3VTCA 3X1HA 3HODA 1RJKA 1XVPA 1Y0SA 3B0TA 4J5WC 2H79A 4ZN7A 2FSZA 3ZRBA 4JAZA 4REEA 5HZCA 2QPYA 4RMCA 3A40X 5DZ1A 1SKXA 3GWXA 3X1IA 4ZNWA 5HYRA 1NAXA 5DUHA 2PIXA 2NPAA 2VV4A 1XQCA 2JJ3A 2VV4B 2Q5GA 3A2HA 3ERDA 3ILZA 4ZNUA 5AYGA 2POBA 2Q7IA 3BQDA 4PF3A 5G3JA 5SYZA 1G1UA 3OLFA 5DVSA 2ZK2A 3UUCA 4XI3A 1N4HA 5G5WA 4ZO1B 4JYHA 3HVLA 5L7EA 4P6XA 3L0JA 3WGPA 5APHA 5FQTA 3DR1A 4MG8B 4DK7A 2Z4JA 4UDAA 3UUDA 3UUDB 2GPVA 4NUFA 4G1ZA 3HLVA 4N1YA 2YFEA 5E0XA 3OMPA 2Q6SA 3HO0A 1K4WA 2ZY0A 5HYKA 4DQMA 1NQ2A 3ADXA 2YHDA 3LBDA 2AA2A 4DM8A 3SP6A 1FCZA 4G1DA 4HEEX 1I7IA 1A52A 4RUPA 1XLSE 1P93A 3OS8C 4YMQA 3A3ZX 3OLSA 1FM6D 2AMAA 3OKHA 1FM6A 3OZJA 3W0GA 2ZK6A 3P8XA 5DWEA 2QR9A 1PRGA 2YLYA 3GYUA 2AA6A 1R20D 1ILGA 2PKLA 1R20A 2Q70A 1E3GA 4J5WA 4PXMA 2Q8SA 5FQSA 3ZQTA 4NIEA 5KRKA 1NQ1A 3A78A 4MG7A 3DT3A 4MG7B 3AUNA 2NW4A 3MNOA 3EYBA 5LGAA 3FALA 1XP1A 4OH5A 4E4KA 1IE8A 4J24A 1MVCA 3ADVA 3DY6A 3IXPD 1PQ6A 3IXPA 3G8OA 4OKXA 3RY9A 5KRFA 4G2HA 4ITFA 3VJTA 1L2IA 4N73A 3KMGA 5GIDA 3AUQA 3AZ3A 1QKNA 1XZXX 1XIUA 3ET2A 3V9TA 5DX3A 3FC6B 3PO9A 4LNWA 1R1KA 4ZNVA 5DX3B 4J5XC 3G9EA 3RVFA 2Q6RA 1SJ0A 3TKMA 4MG9A 5JJMA 4X1FA 2HASA 3R29A 4ZNSA 3V9YA 4YPQA 1GWXA 3PLZA 1ZDUA 3AURA 4R2UA 4RZGA 5E0WA 5FQVA 4JYIA 5EI1A 4ITEA 1DB1A 1FD0A 5DUGA 3WJ4A 4E4QA 1OVLB 4MGDA 4MGDB 5KCUA 5DKEA 3OS8A 2OAXA 4G21A 5DZ0A 5L7GA 2ZNOA 1OSVA 5AAVA 5AAVB 5DIGA 1T7TA 2W8YA 5DP0A 3KBAA 1X7EA 2IHQA 2E2RA 4PVUA 2Q5SA 5DXGA 5G46A 1ERRA 4OEAA 2QXSA 3H52A 3AZ1A 3G8IA 4REFA 3AX8A 1T76A 4DORA 2GPPA 3WMHA 5EGVA 5DZIA 3V3EA 3W5RA 2OM9A 4OK1A 5DWIA 3NSQA 4KZMA 3R8IA 3PCUA 3UP0A 4CI5A 5E14A 4FN9A 4IV4A 5C4UA 4QE8A 4PP6A 4WVDA 1NDEA 2ZLCA 3W5PA 2QZOB 3AFRA 1FM9D 4J26A 4K6IA 4L98A 1FM9A 1XOWA 3Q95A 5EC9A 3F5CA 1EREA 4OJ9A 1YOWA 2PNUA 1PCGA 4POJA 5KRCA 5EITA 2ZVTA 2P1VA 3GWSX 1UHLA 5DYDA 1UHLB 4PPSA 5H1EA 1GWQA 2ZNPA 5DV6A 4J5XA 3W5TA 3VN2A 2HARA 1LV2A 2HB7A 3JZCA 4X1GA 2H77A 2JF9A 2HC4A 1M2ZA 3VRTA 2A3IA 4RMDA 3RUUA 1K74D 1PZLA 1T63A 4IW8A 4IUIA 4RFWA 5DY8A 1XJ7A 5KCFA 1XV9B 5KRMA 1UOMA 5E19A 5DZ3A 5KYJA 2P1UA 2ZMJA 5DLRA 4FNEA 4OJBA 5F9BA 2QTUA 4JGVA 4MGBA 4MGBB 2Q7JA 2GTKA 3B1MA 4QL8A 3VRWA 3CTBA 2VV0A 1S0ZA 1M7WA 3KMRA 5DWLA 4N8RA 1YIMA 2AX9A 1X78A 1RK3A 3WTQA 3B3KA 3VSPA 1Z5XU 4ZNHA 5DXQA 3W0IA 4LBDA 1YUCA 3IPUA 2P7AA 4LTWA 3K6PA 4XHDA 3OSIA 3R2AA 3SZ1A 5DRJA 2HBHA 1WM0X 1YY4A 1UPVA 3L03A 4QE6A 3RLJA 3VHWA 1ZAFA 3B66A 1FCXA 2HWRA 4UDDA 5DIDA 4IWCA 2ZL9A 3K8SA 5ACCA 1S9PA 2YATA 1TXIA 2PIPL 4MG8A 3P0UA 2GPOA 1BSXA 3KDTA 1YMTA 5JY3A 4LNXA 4YNKA 3L3ZA 1YP0A 3K23A 3QT0A 4FHHA 5AVIA 3E00D 3E00A 3PEQA 5B41A 4MDDA 1EXXA 3TY0A 2HCDA 3VT7A 1S0XA 5KRJA 1X7RA 2ZK1A 2PIQA 4LSJA 3DZYD 2R6YA 4CI4A 3DZYA 1RDTD 1RDTA 4XUHA 3VT3A 1R6GA 4MG6A 5DXKA 3CDSA 1N46A 4MG5A 3WT6A 2VSTA 1FBYA 5KRHA 2AX8A 2QGWA 1Z5XE 5DWJA 3WFGA 4ZOMA 3VT4A 1XQ3A 2O9IA 2ZFXA 4ZN9A 2G5OA 4NY9A 5E15A 5L11A 4QK4A 4Q50A 1XDKB 4RUJA 2AX7A 5HJSA 2AX6A 4O8FA 3FEIA 4POHA 1SQNA 4OKTA 2R6WA 2ZNQA 5CJ6A 5JI0D 3HM1A 2I4ZA 2NXXE 4OFUA 5DXMA 5DWGA 1G5YA 2QSEA 2QW4A 4EM9A 1EXAA 2HWQA 1YJEA 1T5ZA 4XTAA 5KCWA 4ZNTA 1R5KA 3B0QA 2EWPA 2AA7A 1X7BA 3GN8A 3DCTA 1XP6A 1R1KD 2G0HA 2GPUA 2VV1B 2QABA 2YLOA 1YINA 3FC6A 4OKBA 4OEYA 2LBDA 4WHGA 1ZUCA 3O1DA 4QM0A 5L7HA 3HC6A 3GYTA 3R5NA 4KZIA 1PDUA 3ZRAA 4A4WA 1U3RA 2QH6A 4IQRA 3WFFA 4CSJA 1FCYA 5I4VA 5KCTA 3CS8A 4OH6A 3CS6A 3OMOA 4P6WA 5AZVA 1ZEOA 3L0LA 5DUEA 2QA6A 3VTBA 4DM6A 4PLEA 1MV9A 1XB7A 1OVLA 3BEJA 3VRVA 3WWRA 5KCCA 3D6DA 3VT9A 5KRIA 1GWRA 2PRGA 2J4AA 2NV7A 3ADUA 5AVLA 3UU7B 5C4OA 3K22A 3OZ0A 2V0VA 4WHFA 3AN3A 3T03A 1E3KA 2GP7A 2ZK0A 3GBKA 3UP3A 2G44A 3OMMA 1KKQA 4Y29A 4RUOX 2OVHA 3V49A 5B5BA 3LMPA 5IXKA 1U9EA 4PP3A 3WT5A 2AB2A 4TV1A 5G44A 4TV1B 3VTDA 2Q1VA 2J14A 2QMVA 3R5MA 5DXBA 2JFAB 3MNEA 3B5RA 4G2IA 2I0GA 5DXBB 1ZGYA 1K7LA 2XYXA 4ZJWA 2P4YA 3VSOA 2QZOA 3L0EA 5DVCA 4S14A 2OCFA 2ZK3A 4PWLA 1MZNA 4OARA 5KRAA 3NOAA 3VHVA 4RZEA 2P54A 4F9MA 5C4TA 1T65A 4RWVA 5DKGA 1IE9A 1T73A 2ZKCA 5GIEA 4R6SA 3VT5A 2FAIA 2ZMHA 2B1VA 3UUAA 5FQPA 3UUAB 1NYXA 3CS4A 5M96A 1NUOA 2PIUA 2QNVA 4R06A 5DRMA 2PJLA 4G1YA 1ZH7A 4OJ4A 1YA3A 2Q6JA 3OMKA 2XKWA 4IV2A 3OKIA 2PIRA 3OOFA 1U3QA 1VJBA 1XV9A 1NQ7A 5DL4A 4L96A 4S0TA 4A2JA 2YJAB 2BJ4A 3D57A 2BJ4B 3CWDA 2PIOA 5DIEA 3V3QA 1XLSA 2QXMA 3FXVA 4OEDA 4XT9A 3ET0A 3TX7B 2QE4A 2ZK5A 4RZFA 3ADTA 2BAWA 5DXPA 1QKMA 1T7RA 2PITA 3KYTA 4WLBA 5ETHA 2AYRA 4K4JA 5AZTA 1LBDA 3W0CA 4Q0AC 1G50A 4S15A 4KZJA 2R40A 5EHJA 5KR9A 3ADWA 4FHIA 4G20A 5DKSA 5E1CA 5A86A 4OFRA 1SR7A 5HCVA 2J7XA 3GD2A 5G43A 2OZ7A 2G0GA 3P89A 4M8HA 2QA8A 4IA2A 2QA8B 3KDUA 2Z4BA 3FEJA 5DVVA 5FQRA 3VRUA 1DKFA 2ZXNA 1DKFB 2O4RA 4IWFA 1GS4A 3R8AA 3F7DA 1XVPB 4XUMA 3V9VA 2AA5A 2AMBA 2ZASA 3PRGA 4OGHA 4UDBA 2O4JA 5LWPA 3KFCA 2GL8A 5E7VA 1KNUA 5AWJA 5IAWA 2REWA 2P7GA 4M8EA 3VHUA 4OZTE 3VJSA 2XYJA 2ZBSA 2Q7LA 2ZLAA 3OOKA 2OVMA 3AZ2A 1U3SA 3CQVA 4WPFA 3VJIA 2HVCA 1X7JA 2AAXA 1I37A 3B67A 5KYAA 5KCEA 3KMZA 5KROA 4JYGA 3FURA 2IOGA 4XAOA 5DXEA 5AAUA 5IZ0A 3DCUA 5K13A 3M7RA 4Q13A 4YT1A 4E2JA 4B7WA 4OKWA 2ZXMA 3KPZA 1HG4A 5DU5A 1M13A 3H0AD 5APJA 3H0AA 2ZMIA 1XDKA 3W5QA 3HC5A 4IW6A 4OLMA 2YLPA 4APUA 5EJVA 4BCRA 4A4VA 3HZFA 4ONIA 3G0WA 3W0YA 3RUTA 2HAMA 3FUGA 3P88A 1YOKA 1PQ9A 3KWYA 4MGAA 4OHAA 4MGAB 3CDPA 1ILHA 3PBAA 3SP9A 2ZNNA 2ABIA 3A9EA 3A9EB 2QGTA 2Q61A 2P15A 4RE8A 1I38A 2VV1A 3TKCA 2AM9A 3B0WA 3V4AA 3E7CA 2POGA 5KCDA 2J7YA 1T74A 5DI7A 1T7MA 5DYBA 3VT8A 2AWHA 3OAPA 2B1ZA 2OUZA 3OSWA 4QJRA 1XP9A 4FGYA 5DV8A 1S19A 3FALB 1HJ1A 2ZXZA 3HQ5A 1XNXA 3ERTA 4IVYA 3DZUD 4DMAA 3DZUA 1G2NA 1T7FA 4IU7A 3WJ5A 1ZKYA 2Q3YA 4IA1A 3S9SA 4OEZA 3WT7A 3UU7A 1A28A 2Q59A 2Q59B 3FS1A 3OLLA 1QKTA 4RAKA 1NHZA 1PK5A 4NQAB 4OIVA 1P8DA 5KD9A 1RKGA 2B50A 3OS9A 4OZRU 4UDCA 4WQPA 3D5FA 4NB6A 1XPCA 1T79A 3IPSA 3L3XA 4TUZA 3ET3A 4TUZB 2ATHA 3MNPA 4XLDA 5DMFA 4ZI1A 2PINA 3B68A 4MG9B 2AXAA 5JJMB 4EMAA 5HJPA 2JFAA 5HJPB 1XAPA 2P1TA 3ADSA 1L2JA 3FLIA 1QKUA 2Q5PA 1NRLA 5APKA 3IPQA 2ZK4A 3W0JA 4PRGA 1YYEA 4JL4A 2F4BA 2VV2A 1OSHA 3N00A 5DV3A 3VI8A 1N83A 5DK9A 3E94A 3W0AA 4MGCA 2VV3A 2XHSA 2YJDA 4PLDA 5DXRA 3IMYA 5AWKA 3OSAA 3X31A 1I7GA 5DTVA 4K7AA 2FVJA 1Q4XA 3B65A 1RKHA 2Q1HA 3IA6A 1Y9RA 4IA7A 2AO6A 4OC7A 3ET1A 1TFCA 4IA3A 4DK8A 1S9QA 1Z95A 3RLLA 4PP5A 4S0SA 5GT4A 3O1EA 2VSRA 2B23A 3CJWA 1X76A 3GZ9A 4OZRE 1ZDTA 2YLQA 2I4PA 3U9QA 2P7ZA
chains in the Genus database with same CATH superfamily
1NAVA 3Q95B 5G42A 3UVVA 3UVVB 4DOSA 3F5CB 3A2JA 3D24A 5DMCA 5DSHA 4HLWA 2ACLA 2ACLB 1XNNA 2Q7KA 3NSPA 4OZTU 5DZHA 3D90A 2PIVA 3CLDA 5C4SA 3OMQA 3VJHA 3OGTA 4PPPA 4ZO1X 2GWXA 5GICA 5DKBA 2PIWA 1KV6A 2IOKA 2R40D 2I4JA 2XYWA 3A2IA 5AK2A 1UPWA 3R8DA 3VT6A 3W0HA 3JZBA 1K74A 3ZR7A 1OT7A 4IVWA 4N5GA 2GIUA 2HFPA 5G45A 2HB8A 5KRLA 2I0JA 2V7CA 4ZJRA 2NXXA 1PQCA 1NQ0A 3X36A 4IS8A 5ICKA 4RMEA 4OIUA 1H9UA 3BC5A 3L1BA 3AN4A 1Y0XX 4OILA 2Q60A 3B0RA 3VTCA 3X1HA 3HODA 1RJKA 1XVPA 1Y0SA 3B0TA 4J5WC 2H79A 4ZN7A 2FSZA 3ZRBA 4JAZA 4REEA 5HZCA 2QPYA 4RMCA 3A40X 5DZ1A 1SKXA 3GWXA 3X1IA 4ZNWA 5HYRA 1NAXA 5DUHA 2PIXA 2NPAA 2VV4A 1XQCA 2JJ3A 2VV4B 2Q5GA 3A2HA 3ERDA 3ILZA 4ZNUA 5AYGA 2POBA 2Q7IA 3BQDA 4PF3A 5G3JA 5SYZA 1G1UA 3OLFA 5DVSA 2ZK2A 3UUCA 4XI3A 1N4HA 5G5WA 4ZO1B 4JYHA 3HVLA 5L7EA 4P6XA 3L0JA 3WGPA 5APHA 5FQTA 3DR1A 4MG8B 4DK7A 2Z4JA 4UDAA 3UUDA 3UUDB 2GPVA 4NUFA 4G1ZA 3HLVA 4N1YA 2YFEA 5E0XA 3OMPA 2Q6SA 3HO0A 1K4WA 2ZY0A 5HYKA 4DQMA 1NQ2A 3ADXA 2YHDA 3LBDA 2AA2A 4DM8A 3SP6A 1FCZA 4G1DA 4HEEX 1I7IA 1A52A 4RUPA 1XLSE 1P93A 3OS8C 4YMQA 3A3ZX 3OLSA 1FM6D 2AMAA 3OKHA 1FM6A 3OZJA 3W0GA 2ZK6A 3P8XA 5DWEA 2QR9A 1PRGA 2YLYA 3GYUA 2AA6A 1R20D 1ILGA 2PKLA 1R20A 2Q70A 1E3GA 4J5WA 4PXMA 2Q8SA 5FQSA 3ZQTA 4NIEA 5KRKA 1NQ1A 3A78A 4MG7A 3DT3A 4MG7B 3AUNA 2NW4A 3MNOA 3EYBA 5LGAA 3FALA 1XP1A 4OH5A 4E4KA 1IE8A 4J24A 1MVCA 3ADVA 3DY6A 3IXPD 1PQ6A 3IXPA 3G8OA 4OKXA 3RY9A 5KRFA 4G2HA 4ITFA 3VJTA 1L2IA 4N73A 3KMGA 5GIDA 3AUQA 3AZ3A 1QKNA 1XZXX 1XIUA 3ET2A 3V9TA 5DX3A 3FC6B 3PO9A 4LNWA 1R1KA 4ZNVA 5DX3B 4J5XC 3G9EA 3RVFA 2Q6RA 1SJ0A 3TKMA 4MG9A 5JJMA 4X1FA 2HASA 3R29A 4ZNSA 3V9YA 4YPQA 1GWXA 3PLZA 1ZDUA 3AURA 4R2UA 4RZGA 5E0WA 5FQVA 4JYIA 5EI1A 4ITEA 1DB1A 1FD0A 5DUGA 3WJ4A 4E4QA 1OVLB 4MGDA 4MGDB 5KCUA 5DKEA 3OS8A 2OAXA 4G21A 5DZ0A 5L7GA 2ZNOA 1OSVA 5AAVA 5AAVB 5DIGA 1T7TA 2W8YA 5DP0A 3KBAA 1X7EA 2IHQA 2E2RA 4PVUA 2Q5SA 5DXGA 5G46A 1ERRA 4OEAA 2QXSA 3H52A 3AZ1A 3G8IA 4REFA 3AX8A 1T76A 4DORA 2GPPA 3WMHA 5EGVA 5DZIA 3V3EA 3W5RA 2OM9A 4OK1A 5DWIA 3NSQA 4KZMA 3R8IA 3PCUA 3UP0A 4CI5A 5E14A 4FN9A 4IV4A 5C4UA 4QE8A 4PP6A 4WVDA 1NDEA 2ZLCA 3W5PA 2QZOB 3AFRA 1FM9D 4J26A 4K6IA 4L98A 1FM9A 1XOWA 3Q95A 5EC9A 3F5CA 1EREA 4OJ9A 1YOWA 2PNUA 1PCGA 4POJA 5KRCA 5EITA 2ZVTA 2P1VA 3GWSX 1UHLA 5DYDA 1UHLB 4PPSA 5H1EA 1GWQA 2ZNPA 5DV6A 4J5XA 3W5TA 3VN2A 2HARA 1LV2A 2HB7A 3JZCA 4X1GA 2H77A 2JF9A 2HC4A 1M2ZA 3VRTA 2A3IA 4RMDA 3RUUA 1K74D 1PZLA 1T63A 4IW8A 4IUIA 4RFWA 5DY8A 1XJ7A 5KCFA 1XV9B 5KRMA 1UOMA 5E19A 5DZ3A 5KYJA 2P1UA 2ZMJA 5DLRA 4FNEA 4OJBA 5F9BA 2QTUA 4JGVA 4MGBA 4MGBB 2Q7JA 2GTKA 3B1MA 4QL8A 3VRWA 3CTBA 2VV0A 1S0ZA 1M7WA 3KMRA 5DWLA 4N8RA 1YIMA 2AX9A 1X78A 1RK3A 3WTQA 3B3KA 3VSPA 1Z5XU 4ZNHA 5DXQA 3W0IA 4LBDA 1YUCA 3IPUA 2P7AA 4LTWA 3K6PA 4XHDA 3OSIA 3R2AA 3SZ1A 5DRJA 2HBHA 1WM0X 1YY4A 1UPVA 3L03A 4QE6A 3RLJA 3VHWA 1ZAFA 3B66A 1FCXA 2HWRA 4UDDA 5DIDA 4IWCA 2ZL9A 3K8SA 5ACCA 1S9PA 2YATA 1TXIA 2PIPL 4MG8A 3P0UA 2GPOA 1BSXA 3KDTA 1YMTA 5JY3A 4LNXA 4YNKA 3L3ZA 1YP0A 3K23A 3QT0A 4FHHA 5AVIA 3E00D 3E00A 3PEQA 5B41A 4MDDA 1EXXA 3TY0A 2HCDA 3VT7A 1S0XA 5KRJA 1X7RA 2ZK1A 2PIQA 4LSJA 3DZYD 2R6YA 4CI4A 3DZYA 1RDTD 1RDTA 4XUHA 3VT3A 1R6GA 4MG6A 5DXKA 3CDSA 1N46A 4MG5A 3WT6A 2VSTA 1FBYA 5KRHA 2AX8A 2QGWA 1Z5XE 5DWJA 3WFGA 4ZOMA 3VT4A 1XQ3A 2O9IA 2ZFXA 4ZN9A 2G5OA 4NY9A 5E15A 5L11A 4QK4A 4Q50A 1XDKB 4RUJA 2AX7A 5HJSA 2AX6A 4O8FA 3FEIA 4POHA 1SQNA 4OKTA 2R6WA 2ZNQA 5CJ6A 5JI0D 3HM1A 2I4ZA 2NXXE 4OFUA 5DXMA 5DWGA 1G5YA 2QSEA 2QW4A 4EM9A 1EXAA 2HWQA 1YJEA 1T5ZA 4XTAA 5KCWA 4ZNTA 1R5KA 3B0QA 2EWPA 2AA7A 1X7BA 3GN8A 3DCTA 1XP6A 1R1KD 2G0HA 2GPUA 2VV1B 2QABA 2YLOA 1YINA 3FC6A 4OKBA 4OEYA 2LBDA 4WHGA 1ZUCA 3O1DA 4QM0A 5L7HA 3HC6A 3GYTA 3R5NA 4KZIA 1PDUA 3ZRAA 4A4WA 1U3RA 2QH6A 4IQRA 3WFFA 4CSJA 1FCYA 5I4VA 5KCTA 3CS8A 4OH6A 3CS6A 3OMOA 4P6WA 5AZVA 1ZEOA 3L0LA 5DUEA 2QA6A 3VTBA 4DM6A 4PLEA 1MV9A 1XB7A 1OVLA 3BEJA 3VRVA 3WWRA 5KCCA 3D6DA 3VT9A 5KRIA 1GWRA 2PRGA 2J4AA 2NV7A 3ADUA 5AVLA 3UU7B 5C4OA 3K22A 3OZ0A 2V0VA 4WHFA 3AN3A 3T03A 1E3KA 2GP7A 2ZK0A 3GBKA 3UP3A 2G44A 3OMMA 1KKQA 4Y29A 4RUOX 2OVHA 3V49A 5B5BA 3LMPA 5IXKA 1U9EA 4PP3A 3WT5A 2AB2A 4TV1A 5G44A 4TV1B 3VTDA 2Q1VA 2J14A 2QMVA 3R5MA 5DXBA 2JFAB 3MNEA 3B5RA 4G2IA 2I0GA 5DXBB 1ZGYA 1K7LA 2XYXA 4ZJWA 2P4YA 3VSOA 2QZOA 3L0EA 5DVCA 4S14A 2OCFA 2ZK3A 4PWLA 1MZNA 4OARA 5KRAA 3NOAA 3VHVA 4RZEA 2P54A 4F9MA 5C4TA 1T65A 4RWVA 5DKGA 1IE9A 1T73A 2ZKCA 5GIEA 4R6SA 3VT5A 2FAIA 2ZMHA 2B1VA 3UUAA 5FQPA 3UUAB 1NYXA 3CS4A 5M96A 1NUOA 2PIUA 2QNVA 4R06A 5DRMA 2PJLA 4G1YA 1ZH7A 4OJ4A 1YA3A 2Q6JA 3OMKA 2XKWA 4IV2A 3OKIA 2PIRA 3OOFA 1U3QA 1VJBA 1XV9A 1NQ7A 5DL4A 4L96A 4S0TA 4A2JA 2YJAB 2BJ4A 3D57A 2BJ4B 3CWDA 2PIOA 5DIEA 3V3QA 1XLSA 2QXMA 3FXVA 4OEDA 4XT9A 3ET0A 3TX7B 2QE4A 2ZK5A 4RZFA 3ADTA 2BAWA 5DXPA 1QKMA 1T7RA 2PITA 3KYTA 4WLBA 5ETHA 2AYRA 4K4JA 5AZTA 1LBDA 3W0CA 4Q0AC 1G50A 4S15A 4KZJA 2R40A 5EHJA 5KR9A 3ADWA 4FHIA 4G20A 5DKSA 5E1CA 5A86A 4OFRA 1SR7A 5HCVA 2J7XA 3GD2A 5G43A 2OZ7A 2G0GA 3P89A 4M8HA 2QA8A 4IA2A 2QA8B 3KDUA 2Z4BA 3FEJA 5DVVA 5FQRA 3VRUA 1DKFA 2ZXNA 1DKFB 2O4RA 4IWFA 1GS4A 3R8AA 3F7DA 1XVPB 4XUMA 3V9VA 2AA5A 2AMBA 2ZASA 3PRGA 4OGHA 4UDBA 2O4JA 5LWPA 3KFCA 2GL8A 5E7VA 1KNUA 5AWJA 5IAWA 2REWA 2P7GA 4M8EA 3VHUA 4OZTE 3VJSA 2XYJA 2ZBSA 2Q7LA 2ZLAA 3OOKA 2OVMA 3AZ2A 1U3SA 3CQVA 4WPFA 3VJIA 2HVCA 1X7JA 2AAXA 1I37A 3B67A 5KYAA 5KCEA 3KMZA 5KROA 4JYGA 3FURA 2IOGA 4XAOA 5DXEA 5AAUA 5IZ0A 3DCUA 5K13A 3M7RA 4Q13A 4YT1A 4E2JA 4B7WA 4OKWA 2ZXMA 3KPZA 1HG4A 5DU5A 1M13A 3H0AD 5APJA 3H0AA 2ZMIA 1XDKA 3W5QA 3HC5A 4IW6A 4OLMA 2YLPA 4APUA 5EJVA 4BCRA 4A4VA 3HZFA 4ONIA 3G0WA 3W0YA 3RUTA 2HAMA 3FUGA 3P88A 1YOKA 1PQ9A 3KWYA 4MGAA 4OHAA 4MGAB 3CDPA 1ILHA 3PBAA 3SP9A 2ZNNA 2ABIA 3A9EA 3A9EB 2QGTA 2Q61A 2P15A 4RE8A 1I38A 2VV1A 3TKCA 2AM9A 3B0WA 3V4AA 3E7CA 2POGA 5KCDA 2J7YA 1T74A 5DI7A 1T7MA 5DYBA 3VT8A 2AWHA 3OAPA 2B1ZA 2OUZA 3OSWA 4QJRA 1XP9A 4FGYA 5DV8A 1S19A 3FALB 1HJ1A 2ZXZA 3HQ5A 1XNXA 3ERTA 4IVYA 3DZUD 4DMAA 3DZUA 1G2NA 1T7FA 4IU7A 3WJ5A 1ZKYA 2Q3YA 4IA1A 3S9SA 4OEZA 3WT7A 3UU7A 1A28A 2Q59A 2Q59B 3FS1A 3OLLA 1QKTA 4RAKA 1NHZA 1PK5A 4NQAB 4OIVA 1P8DA 5KD9A 1RKGA 2B50A 3OS9A 4OZRU 4UDCA 4WQPA 3D5FA 4NB6A 1XPCA 1T79A 3IPSA 3L3XA 4TUZA 3ET3A 4TUZB 2ATHA 3MNPA 4XLDA 5DMFA 4ZI1A 2PINA 3B68A 4MG9B 2AXAA 5JJMB 4EMAA 5HJPA 2JFAA 5HJPB 1XAPA 2P1TA 3ADSA 1L2JA 3FLIA 1QKUA 2Q5PA 1NRLA 5APKA 3IPQA 2ZK4A 3W0JA 4PRGA 1YYEA 4JL4A 2F4BA 2VV2A 1OSHA 3N00A 5DV3A 3VI8A 1N83A 5DK9A 3E94A 3W0AA 4MGCA 2VV3A 2XHSA 2YJDA 4PLDA 5DXRA 3IMYA 5AWKA 3OSAA 3X31A 1I7GA 5DTVA 4K7AA 2FVJA 1Q4XA 3B65A 1RKHA 2Q1HA 3IA6A 1Y9RA 4IA7A 2AO6A 4OC7A 3ET1A 1TFCA 4IA3A 4DK8A 1S9QA 1Z95A 3RLLA 4PP5A 4S0SA 5GT4A 3O1EA 2VSRA 2B23A 3CJWA 1X76A 3GZ9A 4OZRE 1ZDTA 2YLQA 2I4PA 3U9QA 2P7ZA
chains in the Genus database with same CATH topology
1NAVA 3Q95B 5G42A 3UVVA 3UVVB 4DOSA 3F5CB 3A2JA 3D24A 5DMCA 5DSHA 4HLWA 2ACLA 2ACLB 1XNNA 2Q7KA 3NSPA 4OZTU 5DZHA 3D90A 2PIVA 3CLDA 5C4SA 3OMQA 3VJHA 3OGTA 4PPPA 4ZO1X 2GWXA 5GICA 5DKBA 2PIWA 1KV6A 2IOKA 2R40D 2I4JA 2XYWA 3A2IA 5AK2A 1UPWA 3R8DA 3VT6A 3W0HA 3JZBA 1K74A 3ZR7A 1OT7A 4IVWA 4N5GA 2GIUA 2HFPA 5G45A 2HB8A 5KRLA 2I0JA 2V7CA 4ZJRA 2NXXA 1PQCA 1NQ0A 3X36A 4IS8A 5ICKA 4RMEA 4OIUA 1H9UA 3BC5A 3L1BA 3AN4A 1Y0XX 4OILA 2Q60A 3B0RA 3VTCA 3X1HA 3HODA 1RJKA 1XVPA 1Y0SA 3B0TA 4J5WC 2H79A 4ZN7A 2FSZA 3ZRBA 4JAZA 4REEA 5HZCA 2QPYA 4RMCA 3A40X 5DZ1A 1SKXA 3GWXA 3X1IA 4ZNWA 5HYRA 1NAXA 5DUHA 2PIXA 2NPAA 2VV4A 1XQCA 2JJ3A 2VV4B 2Q5GA 3A2HA 3ERDA 3ILZA 4ZNUA 5AYGA 2POBA 2Q7IA 3BQDA 4PF3A 5G3JA 5SYZA 1G1UA 3OLFA 5DVSA 2ZK2A 3UUCA 4XI3A 1N4HA 5G5WA 4ZO1B 4JYHA 3HVLA 5L7EA 4P6XA 3L0JA 3WGPA 5APHA 5FQTA 3DR1A 4MG8B 4DK7A 2Z4JA 4UDAA 3UUDA 3UUDB 2GPVA 4NUFA 4G1ZA 3HLVA 4N1YA 2YFEA 5E0XA 3OMPA 2Q6SA 3HO0A 1K4WA 2ZY0A 5HYKA 4DQMA 1NQ2A 3ADXA 2YHDA 3LBDA 2AA2A 4DM8A 3SP6A 1FCZA 4G1DA 4HEEX 1I7IA 1A52A 4RUPA 1XLSE 1P93A 3OS8C 4YMQA 3A3ZX 3OLSA 1FM6D 2AMAA 3OKHA 1FM6A 3OZJA 3W0GA 2ZK6A 3P8XA 5DWEA 2QR9A 1PRGA 2YLYA 3GYUA 2AA6A 1R20D 1ILGA 2PKLA 1R20A 2Q70A 1E3GA 4J5WA 4PXMA 2Q8SA 5FQSA 3ZQTA 4NIEA 5KRKA 1NQ1A 3A78A 4MG7A 3DT3A 4MG7B 3AUNA 2NW4A 3MNOA 3EYBA 5LGAA 3FALA 1XP1A 4OH5A 4E4KA 1IE8A 4J24A 1MVCA 3ADVA 3DY6A 3IXPD 1PQ6A 3IXPA 3G8OA 4OKXA 3RY9A 5KRFA 4G2HA 4ITFA 3VJTA 1L2IA 4N73A 3KMGA 5GIDA 3AUQA 3AZ3A 1QKNA 1XZXX 1XIUA 3ET2A 3V9TA 5DX3A 3FC6B 3PO9A 4LNWA 1R1KA 4ZNVA 5DX3B 4J5XC 3G9EA 3RVFA 2Q6RA 1SJ0A 3TKMA 4MG9A 5JJMA 4X1FA 2HASA 3R29A 4ZNSA 3V9YA 4YPQA 1GWXA 3PLZA 1ZDUA 3AURA 4R2UA 4RZGA 5E0WA 5FQVA 4JYIA 5EI1A 4ITEA 1DB1A 1FD0A 5DUGA 3WJ4A 4E4QA 1OVLB 4MGDA 4MGDB 5KCUA 5DKEA 3OS8A 2OAXA 4G21A 5DZ0A 5L7GA 2ZNOA 1OSVA 5AAVA 5AAVB 5DIGA 1T7TA 2W8YA 5DP0A 3KBAA 1X7EA 2IHQA 2E2RA 4PVUA 2Q5SA 5DXGA 5G46A 1ERRA 4OEAA 2QXSA 3H52A 3AZ1A 3G8IA 4REFA 3AX8A 1T76A 4DORA 2GPPA 3WMHA 5EGVA 5DZIA 3V3EA 3W5RA 2OM9A 4OK1A 5DWIA 3NSQA 4KZMA 3R8IA 3PCUA 3UP0A 4CI5A 5E14A 4FN9A 4IV4A 5C4UA 4QE8A 4PP6A 4WVDA 1NDEA 2ZLCA 3W5PA 2QZOB 3AFRA 1FM9D 4J26A 4K6IA 4L98A 1FM9A 1XOWA 3Q95A 5EC9A 3F5CA 1EREA 4OJ9A 1YOWA 2PNUA 1PCGA 4POJA 5KRCA 5EITA 2ZVTA 2P1VA 3GWSX 1UHLA 5DYDA 1UHLB 4PPSA 5H1EA 1GWQA 2ZNPA 5DV6A 4J5XA 3W5TA 3VN2A 2HARA 1LV2A 2HB7A 3JZCA 4X1GA 2H77A 2JF9A 2HC4A 1M2ZA 3VRTA 2A3IA 4RMDA 3RUUA 1K74D 1PZLA 1T63A 4IW8A 4IUIA 4RFWA 5DY8A 1XJ7A 5KCFA 1XV9B 5KRMA 1UOMA 5E19A 5DZ3A 5KYJA 2P1UA 2ZMJA 5DLRA 4FNEA 4OJBA 5F9BA 2QTUA 4JGVA 4MGBA 4MGBB 2Q7JA 2GTKA 3B1MA 4QL8A 3VRWA 3CTBA 2VV0A 1S0ZA 1M7WA 3KMRA 5DWLA 4N8RA 1YIMA 2AX9A 1X78A 1RK3A 3WTQA 3B3KA 3VSPA 1Z5XU 4ZNHA 5DXQA 3W0IA 4LBDA 1YUCA 3IPUA 2P7AA 4LTWA 3K6PA 4XHDA 3OSIA 3R2AA 3SZ1A 5DRJA 2HBHA 1WM0X 1YY4A 1UPVA 3L03A 4QE6A 3RLJA 3VHWA 1ZAFA 3B66A 1FCXA 2HWRA 4UDDA 5DIDA 4IWCA 2ZL9A 3K8SA 5ACCA 1S9PA 2YATA 1TXIA 2PIPL 4MG8A 3P0UA 2GPOA 1BSXA 3KDTA 1YMTA 5JY3A 4LNXA 4YNKA 3L3ZA 1YP0A 3K23A 3QT0A 4FHHA 5AVIA 3E00D 3E00A 3PEQA 5B41A 4MDDA 1EXXA 3TY0A 2HCDA 3VT7A 1S0XA 5KRJA 1X7RA 2ZK1A 2PIQA 4LSJA 3DZYD 2R6YA 4CI4A 3DZYA 1RDTD 1RDTA 4XUHA 3VT3A 1R6GA 4MG6A 5DXKA 3CDSA 1N46A 4MG5A 3WT6A 2VSTA 1FBYA 5KRHA 2AX8A 2QGWA 1Z5XE 5DWJA 3WFGA 4ZOMA 3VT4A 1XQ3A 2O9IA 2ZFXA 4ZN9A 2G5OA 4NY9A 5E15A 5L11A 4QK4A 4Q50A 1XDKB 4RUJA 2AX7A 5HJSA 2AX6A 4O8FA 3FEIA 4POHA 1SQNA 4OKTA 2R6WA 2ZNQA 5CJ6A 5JI0D 3HM1A 2I4ZA 2NXXE 4OFUA 5DXMA 5DWGA 1G5YA 2QSEA 2QW4A 4EM9A 1EXAA 2HWQA 1YJEA 1T5ZA 4XTAA 5KCWA 4ZNTA 1R5KA 3B0QA 2EWPA 2AA7A 1X7BA 3GN8A 3DCTA 1XP6A 1R1KD 2G0HA 2GPUA 2VV1B 2QABA 2YLOA 1YINA 3FC6A 4OKBA 4OEYA 2LBDA 4WHGA 1ZUCA 3O1DA 4QM0A 5L7HA 3HC6A 3GYTA 3R5NA 4KZIA 1PDUA 3ZRAA 4A4WA 1U3RA 2QH6A 4IQRA 3WFFA 4CSJA 1FCYA 5I4VA 5KCTA 3CS8A 4OH6A 3CS6A 3OMOA 4P6WA 5AZVA 1ZEOA 3L0LA 5DUEA 2QA6A 3VTBA 4DM6A 4PLEA 1MV9A 1XB7A 1OVLA 3BEJA 3VRVA 3WWRA 5KCCA 3D6DA 3VT9A 5KRIA 1GWRA 2PRGA 2J4AA 2NV7A 3ADUA 5AVLA 3UU7B 5C4OA 3K22A 3OZ0A 2V0VA 4WHFA 3AN3A 3T03A 1E3KA 2GP7A 2ZK0A 3GBKA 3UP3A 2G44A 3OMMA 1KKQA 4Y29A 4RUOX 2OVHA 3V49A 5B5BA 3LMPA 5IXKA 1U9EA 4PP3A 3WT5A 2AB2A 4TV1A 5G44A 4TV1B 3VTDA 2Q1VA 2J14A 2QMVA 3R5MA 5DXBA 2JFAB 3MNEA 3B5RA 4G2IA 2I0GA 5DXBB 1ZGYA 1K7LA 2XYXA 4ZJWA 2P4YA 3VSOA 2QZOA 3L0EA 5DVCA 4S14A 2OCFA 2ZK3A 4PWLA 1MZNA 4OARA 5KRAA 3NOAA 3VHVA 4RZEA 2P54A 4F9MA 5C4TA 1T65A 4RWVA 5DKGA 1IE9A 1T73A 2ZKCA 5GIEA 4R6SA 3VT5A 2FAIA 2ZMHA 2B1VA 3UUAA 5FQPA 3UUAB 1NYXA 3CS4A 5M96A 1NUOA 2PIUA 2QNVA 4R06A 5DRMA 2PJLA 4G1YA 1ZH7A 4OJ4A 1YA3A 2Q6JA 3OMKA 2XKWA 4IV2A 3OKIA 2PIRA 3OOFA 1U3QA 1VJBA 1XV9A 1NQ7A 5DL4A 4L96A 4S0TA 4A2JA 2YJAB 2BJ4A 3D57A 2BJ4B 3CWDA 2PIOA 5DIEA 3V3QA 1XLSA 2QXMA 3FXVA 4OEDA 4XT9A 3ET0A 3TX7B 2QE4A 2ZK5A 4RZFA 3ADTA 2BAWA 5DXPA 1QKMA 1T7RA 2PITA 3KYTA 4WLBA 5ETHA 2AYRA 4K4JA 5AZTA 1LBDA 3W0CA 4Q0AC 1G50A 4S15A 4KZJA 2R40A 5EHJA 5KR9A 3ADWA 4FHIA 4G20A 5DKSA 5E1CA 5A86A 4OFRA 1SR7A 5HCVA 2J7XA 3GD2A 5G43A 2OZ7A 2G0GA 3P89A 4M8HA 2QA8A 4IA2A 2QA8B 3KDUA 2Z4BA 3FEJA 5DVVA 5FQRA 3VRUA 1DKFA 2ZXNA 1DKFB 2O4RA 4IWFA 1GS4A 3R8AA 3F7DA 1XVPB 4XUMA 3V9VA 2AA5A 2AMBA 2ZASA 3PRGA 4OGHA 4UDBA 2O4JA 5LWPA 3KFCA 2GL8A 5E7VA 1KNUA 5AWJA 5IAWA 2REWA 2P7GA 4M8EA 3VHUA 4OZTE 3VJSA 2XYJA 2ZBSA 2Q7LA 2ZLAA 3OOKA 2OVMA 3AZ2A 1U3SA 3CQVA 4WPFA 3VJIA 2HVCA 1X7JA 2AAXA 1I37A 3B67A 5KYAA 5KCEA 3KMZA 5KROA 4JYGA 3FURA 2IOGA 4XAOA 5DXEA 5AAUA 5IZ0A 3DCUA 5K13A 3M7RA 4Q13A 4YT1A 4E2JA 4B7WA 4OKWA 2ZXMA 3KPZA 1HG4A 5DU5A 1M13A 3H0AD 5APJA 3H0AA 2ZMIA 1XDKA 3W5QA 3HC5A 4IW6A 4OLMA 2YLPA 4APUA 5EJVA 4BCRA 4A4VA 3HZFA 4ONIA 3G0WA 3W0YA 3RUTA 2HAMA 3FUGA 3P88A 1YOKA 1PQ9A 3KWYA 4MGAA 4OHAA 4MGAB 3CDPA 1ILHA 3PBAA 3SP9A 2ZNNA 2ABIA 3A9EA 3A9EB 2QGTA 2Q61A 2P15A 4RE8A 1I38A 2VV1A 3TKCA 2AM9A 3B0WA 3V4AA 3E7CA 2POGA 5KCDA 2J7YA 1T74A 5DI7A 1T7MA 5DYBA 3VT8A 2AWHA 3OAPA 2B1ZA 2OUZA 3OSWA 4QJRA 1XP9A 4FGYA 5DV8A 1S19A 3FALB 1HJ1A 2ZXZA 3HQ5A 1XNXA 3ERTA 4IVYA 3DZUD 4DMAA 3DZUA 1G2NA 1T7FA 4IU7A 3WJ5A 1ZKYA 2Q3YA 4IA1A 3S9SA 4OEZA 3WT7A 3UU7A 1A28A 2Q59A 2Q59B 3FS1A 3OLLA 1QKTA 4RAKA 1NHZA 1PK5A 4NQAB 4OIVA 1P8DA 5KD9A 1RKGA 2B50A 3OS9A 4OZRU 4UDCA 4WQPA 3D5FA 4NB6A 1XPCA 1T79A 3IPSA 3L3XA 4TUZA 3ET3A 4TUZB 2ATHA 3MNPA 4XLDA 5DMFA 4ZI1A 2PINA 3B68A 4MG9B 2AXAA 5JJMB 4EMAA 5HJPA 2JFAA 5HJPB 1XAPA 2P1TA 3ADSA 1L2JA 3FLIA 1QKUA 2Q5PA 1NRLA 5APKA 3IPQA 2ZK4A 3W0JA 4PRGA 1YYEA 4JL4A 2F4BA 2VV2A 1OSHA 3N00A 5DV3A 3VI8A 1N83A 5DK9A 3E94A 3W0AA 4MGCA 2VV3A 2XHSA 2YJDA 4PLDA 5DXRA 3IMYA 5AWKA 3OSAA 3X31A 1I7GA 5DTVA 4K7AA 2FVJA 1Q4XA 3B65A 1RKHA 2Q1HA 3IA6A 1Y9RA 4IA7A 2AO6A 4OC7A 3ET1A 1TFCA 4IA3A 4DK8A 1S9QA 1Z95A 3RLLA 4PP5A 4S0SA 5GT4A 3O1EA 2VSRA 2B23A 3CJWA 1X76A 3GZ9A 4OZRE 1ZDTA 2YLQA 2I4PA 3U9QA 2P7ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NAV A;  3Q95 B;  5G42 A;  3UVV A;  3UVV B;  4DOS A;  3F5C B;  3A2J A;  3D24 A;  5DMC A;  5DSH A;  4HLW A;  2ACL A;  2ACL B;  1XNN A;  2Q7K A;  3NSP A;  4OZT U;  5DZH A;  3D90 A;  2PIV A;  3CLD A;  5C4S A;  3OMQ A;  3VJH A;  3OGT A;  4PPP A;  4ZO1 X;  2GWX A;  5GIC A;  5DKB A;  2PIW A;  1KV6 A;  2IOK A;  2R40 D;  2I4J A;  2XYW A;  3A2I A;  5AK2 A;  1UPW A;  3R8D A;  3VT6 A;  3W0H A;  3JZB A;  1K74 A;  3ZR7 A;  1OT7 A;  4IVW A;  4N5G A;  2GIU A;  2HFP A;  5G45 A;  2HB8 A;  5KRL A;  2I0J A;  2V7C A;  4ZJR A;  2NXX A;  1PQC A;  1NQ0 A;  3X36 A;  4IS8 A;  5ICK A;  4RME A;  4OIU A;  1H9U A;  3BC5 A;  3L1B A;  3AN4 A;  1Y0X X;  4OIL A;  2Q60 A;  3B0R A;  3VTC A;  3X1H A;  3HOD A;  1RJK A;  1XVP A;  1Y0S A;  3B0T A;  4J5W C;  2H79 A;  4ZN7 A;  2FSZ A;  3ZRB A;  4JAZ A;  4REE A;  5HZC A;  2QPY A;  4RMC A;  3A40 X;  5DZ1 A;  1SKX A;  3GWX A;  3X1I A;  4ZNW A;  5HYR A;  1NAX A;  5DUH A;  2PIX A;  2NPA A;  2VV4 A;  1XQC A;  2JJ3 A;  2VV4 B;  2Q5G A;  3A2H A;  3ERD A;  3ILZ A;  4ZNU A;  5AYG A;  2POB A;  2Q7I A;  3BQD A;  4PF3 A;  5G3J A;  5SYZ A;  1G1U A;  3OLF A;  5DVS A;  2ZK2 A;  3UUC A;  4XI3 A;  1N4H A;  5G5W A;  4ZO1 B;  4JYH A;  3HVL A;  5L7E A;  4P6X A;  3L0J A;  3WGP A;  5APH A;  5FQT A;  3DR1 A;  4MG8 B;  4DK7 A;  2Z4J A;  4UDA A;  3UUD A;  3UUD B;  2GPV A;  4NUF A;  4G1Z A;  3HLV A;  4N1Y A;  2YFE A;  5E0X A;  3OMP A;  2Q6S A;  3HO0 A;  1K4W A;  2ZY0 A;  5HYK A;  4DQM A;  1NQ2 A;  3ADX A;  2YHD A;  3LBD A;  2AA2 A;  4DM8 A;  3SP6 A;  1FCZ A;  4G1D A;  4HEE X;  1I7I A;  1A52 A;  4RUP A;  1XLS E;  1P93 A;  3OS8 C;  4YMQ A;  3A3Z X;  3OLS A;  1FM6 D;  2AMA A;  3OKH A;  1FM6 A;  3OZJ A;  3W0G A;  2ZK6 A;  3P8X A;  5DWE A;  2QR9 A;  1PRG A;  2YLY A;  3GYU A;  2AA6 A;  1R20 D;  1ILG A;  2PKL A;  1R20 A;  2Q70 A;  1E3G A;  4J5W A;  4PXM A;  2Q8S A;  5FQS A;  3ZQT A;  4NIE A;  5KRK A;  1NQ1 A;  3A78 A;  4MG7 A;  3DT3 A;  4MG7 B;  3AUN A;  2NW4 A;  3MNO A;  3EYB A;  5LGA A;  3FAL A;  1XP1 A;  4OH5 A;  4E4K A;  1IE8 A;  4J24 A;  1MVC A;  3ADV A;  3DY6 A;  3IXP D;  1PQ6 A;  3IXP A;  3G8O A;  4OKX A;  3RY9 A;  5KRF A;  4G2H A;  4ITF A;  3VJT A;  1L2I A;  4N73 A;  3KMG A;  5GID A;  3AUQ A;  3AZ3 A;  1QKN A;  1XZX X;  1XIU A;  3ET2 A;  3V9T A;  5DX3 A;  3FC6 B;  3PO9 A;  4LNW A;  1R1K A;  4ZNV A;  5DX3 B;  4J5X C;  3G9E A;  3RVF A;  2Q6R A;  1SJ0 A;  3TKM A;  4MG9 A;  5JJM A;  4X1F A;  2HAS A;  3R29 A;  4ZNS A;  3V9Y A;  4YPQ A;  1GWX A;  3PLZ A;  1ZDU A;  3AUR A;  4R2U A;  4RZG A;  5E0W A;  5FQV A;  4JYI A;  5EI1 A;  4ITE A;  1DB1 A;  1FD0 A;  5DUG A;  3WJ4 A;  4E4Q A;  1OVL B;  4MGD A;  4MGD B;  5KCU A;  5DKE A;  3OS8 A;  2OAX A;  4G21 A;  5DZ0 A;  5L7G A;  2ZNO A;  1OSV A;  5AAV A;  5AAV B;  5DIG A;  1T7T A;  2W8Y A;  5DP0 A;  3KBA A;  1X7E A;  2IHQ A;  2E2R A;  4PVU A;  2Q5S A;  5DXG A;  5G46 A;  1ERR A;  4OEA A;  2QXS A;  3H52 A;  3AZ1 A;  3G8I A;  4REF A;  3AX8 A;  1T76 A;  4DOR A;  2GPP A;  3WMH A;  5EGV A;  5DZI A;  3V3E A;  3W5R A;  2OM9 A;  4OK1 A;  5DWI A;  3NSQ A;  4KZM A;  3R8I A;  3PCU A;  3UP0 A;  4CI5 A;  5E14 A;  4FN9 A;  4IV4 A;  5C4U A;  4QE8 A;  4PP6 A;  4WVD A;  1NDE A;  2ZLC A;  3W5P A;  2QZO B;  3AFR A;  1FM9 D;  4J26 A;  4K6I A;  4L98 A;  1FM9 A;  1XOW A;  3Q95 A;  5EC9 A;  3F5C A;  1ERE A;  4OJ9 A;  1YOW A;  2PNU A;  1PCG A;  4POJ A;  5KRC A;  5EIT A;  2ZVT A;  2P1V A;  3GWS X;  1UHL A;  5DYD A;  1UHL B;  4PPS A;  5H1E A;  1GWQ A;  2ZNP A;  5DV6 A;  4J5X A;  3W5T A;  3VN2 A;  2HAR A;  1LV2 A;  2HB7 A;  3JZC A;  4X1G A;  2H77 A;  2JF9 A;  2HC4 A;  1M2Z A;  3VRT A;  2A3I A;  4RMD A;  3RUU A;  1K74 D;  1PZL A;  1T63 A;  4IW8 A;  4IUI A;  4RFW A;  5DY8 A;  1XJ7 A;  5KCF A;  1XV9 B;  5KRM A;  1UOM A;  5E19 A;  5DZ3 A;  5KYJ A;  2P1U A;  2ZMJ A;  5DLR A;  4FNE A;  4OJB A;  5F9B A;  2QTU A;  4JGV A;  4MGB A;  4MGB B;  2Q7J A;  2GTK A;  3B1M A;  4QL8 A;  3VRW A;  3CTB A;  2VV0 A;  1S0Z A;  1M7W A;  3KMR A;  5DWL A;  4N8R A;  1YIM A;  2AX9 A;  1X78 A;  1RK3 A;  3WTQ A;  3B3K A;  3VSP A;  1Z5X U;  4ZNH A;  5DXQ A;  3W0I A;  4LBD A;  1YUC A;  3IPU A;  2P7A A;  4LTW A;  3K6P A;  4XHD A;  3OSI A;  3R2A A;  3SZ1 A;  5DRJ A;  2HBH A;  1WM0 X;  1YY4 A;  1UPV A;  3L03 A;  4QE6 A;  3RLJ A;  3VHW A;  1ZAF A;  3B66 A;  1FCX A;  2HWR A;  4UDD A;  5DID A;  4IWC A;  2ZL9 A;  3K8S A;  5ACC A;  1S9P A;  2YAT A;  1TXI A;  2PIP L;  4MG8 A;  3P0U A;  2GPO A;  1BSX A;  3KDT A;  1YMT A;  5JY3 A;  4LNX A;  4YNK A;  3L3Z A;  1YP0 A;  3K23 A;  3QT0 A;  4FHH A;  5AVI A;  3E00 D;  3E00 A;  3PEQ A;  5B41 A;  4MDD A;  1EXX A;  3TY0 A;  2HCD A;  3VT7 A;  1S0X A;  5KRJ A;  1X7R A;  2ZK1 A;  2PIQ A;  4LSJ A;  3DZY D;  2R6Y A;  4CI4 A;  3DZY A;  1RDT D;  1RDT A;  4XUH A;  3VT3 A;  1R6G A;  4MG6 A;  5DXK A;  3CDS A;  1N46 A;  4MG5 A;  3WT6 A;  2VST A;  1FBY A;  5KRH A;  2AX8 A;  2QGW A;  1Z5X E;  5DWJ A;  3WFG A;  4ZOM A;  3VT4 A;  1XQ3 A;  2O9I A;  2ZFX A;  4ZN9 A;  2G5O A;  4NY9 A;  5E15 A;  5L11 A;  4QK4 A;  4Q50 A;  1XDK B;  4RUJ A;  2AX7 A;  5HJS A;  2AX6 A;  4O8F A;  3FEI A;  4POH A;  1SQN A;  4OKT A;  2R6W A;  2ZNQ A;  5CJ6 A;  5JI0 D;  3HM1 A;  2I4Z A;  2NXX E;  4OFU A;  5DXM A;  5DWG A;  1G5Y A;  2QSE A;  2QW4 A;  4EM9 A;  1EXA A;  2HWQ A;  1YJE A;  1T5Z A;  4XTA A;  5KCW A;  4ZNT A;  1R5K A;  3B0Q A;  2EWP A;  2AA7 A;  1X7B A;  3GN8 A;  3DCT A;  1XP6 A;  1R1K D;  2G0H A;  2GPU A;  2VV1 B;  2QAB A;  2YLO A;  1YIN A;  3FC6 A;  4OKB A;  4OEY A;  2LBD A;  4WHG A;  1ZUC A;  3O1D A;  4QM0 A;  5L7H A;  3HC6 A;  3GYT A;  3R5N A;  4KZI A;  1PDU A;  3ZRA A;  4A4W A;  1U3R A;  2QH6 A;  4IQR A;  3WFF A;  4CSJ A;  1FCY A;  5I4V A;  5KCT A;  3CS8 A;  4OH6 A;  3CS6 A;  3OMO A;  4P6W A;  5AZV A;  1ZEO A;  3L0L A;  5DUE A;  2QA6 A;  3VTB A;  4DM6 A;  4PLE A;  1MV9 A;  1XB7 A;  1OVL A;  3BEJ A;  3VRV A;  3WWR A;  5KCC A;  3D6D A;  3VT9 A;  5KRI A;  1GWR A;  2PRG A;  2J4A A;  2NV7 A;  3ADU A;  5AVL A;  3UU7 B;  5C4O A;  3K22 A;  3OZ0 A;  2V0V A;  4WHF A;  3AN3 A;  3T03 A;  1E3K A;  2GP7 A;  2ZK0 A;  3GBK A;  3UP3 A;  2G44 A;  3OMM A;  1KKQ A;  4Y29 A;  4RUO X;  2OVH A;  3V49 A;  5B5B A;  3LMP A;  5IXK A;  1U9E A;  4PP3 A;  3WT5 A;  2AB2 A;  4TV1 A;  5G44 A;  4TV1 B;  3VTD A;  2Q1V A;  2J14 A;  2QMV A;  3R5M A;  5DXB A;  2JFA B;  3MNE A;  3B5R A;  4G2I A;  2I0G A;  5DXB B;  1ZGY A;  1K7L A;  2XYX A;  4ZJW A;  2P4Y A;  3VSO A;  2QZO A;  3L0E A;  5DVC A;  4S14 A;  2OCF A;  2ZK3 A;  4PWL A;  1MZN A;  4OAR A;  5KRA A;  3NOA A;  3VHV A;  4RZE A;  2P54 A;  4F9M A;  5C4T A;  1T65 A;  4RWV A;  5DKG A;  1IE9 A;  1T73 A;  2ZKC A;  5GIE A;  4R6S A;  3VT5 A;  2FAI A;  2ZMH A;  2B1V A;  3UUA A;  5FQP A;  3UUA B;  1NYX A;  3CS4 A;  5M96 A;  1NUO A;  2PIU A;  2QNV A;  4R06 A;  5DRM A;  2PJL A;  4G1Y A;  1ZH7 A;  4OJ4 A;  1YA3 A;  2Q6J A;  3OMK A;  2XKW A;  4IV2 A;  3OKI A;  2PIR A;  3OOF A;  1U3Q A;  1VJB A;  1XV9 A;  1NQ7 A;  5DL4 A;  4L96 A;  4S0T A;  4A2J A;  2YJA B;  2BJ4 A;  3D57 A;  2BJ4 B;  3CWD A;  2PIO A;  5DIE A;  3V3Q A;  1XLS A;  2QXM A;  3FXV A;  4OED A;  4XT9 A;  3ET0 A;  3TX7 B;  2QE4 A;  2ZK5 A;  4RZF A;  3ADT A;  2BAW A;  5DXP A;  1QKM A;  1T7R A;  2PIT A;  3KYT A;  4WLB A;  5ETH A;  2AYR A;  4K4J A;  5AZT A;  1LBD A;  3W0C A;  4Q0A C;  1G50 A;  4S15 A;  4KZJ A;  2R40 A;  5EHJ A;  5KR9 A;  3ADW A;  4FHI A;  4G20 A;  5DKS A;  5E1C A;  5A86 A;  4OFR A;  1SR7 A;  5HCV A;  2J7X A;  3GD2 A;  5G43 A;  2OZ7 A;  2G0G A;  3P89 A;  4M8H A;  2QA8 A;  4IA2 A;  2QA8 B;  3KDU A;  2Z4B A;  3FEJ A;  5DVV A;  5FQR A;  3VRU A;  1DKF A;  2ZXN A;  1DKF B;  2O4R A;  4IWF A;  1GS4 A;  3R8A A;  3F7D A;  1XVP B;  4XUM A;  3V9V A;  2AA5 A;  2AMB A;  2ZAS A;  3PRG A;  4OGH A;  4UDB A;  2O4J A;  5LWP A;  3KFC A;  2GL8 A;  5E7V A;  1KNU A;  5AWJ A;  5IAW A;  2REW A;  2P7G A;  4M8E A;  3VHU A;  4OZT E;  3VJS A;  2XYJ A;  2ZBS A;  2Q7L A;  2ZLA A;  3OOK A;  2OVM A;  3AZ2 A;  1U3S A;  3CQV A;  4WPF A;  3VJI A;  2HVC A;  1X7J A;  2AAX A;  1I37 A;  3B67 A;  5KYA A;  5KCE A;  3KMZ A;  5KRO A;  4JYG A;  3FUR A;  2IOG A;  4XAO A;  5DXE A;  5AAU A;  5IZ0 A;  3DCU A;  5K13 A;  3M7R A;  4Q13 A;  4YT1 A;  4E2J A;  4B7W A;  4OKW A;  2ZXM A;  3KPZ A;  1HG4 A;  5DU5 A;  1M13 A;  3H0A D;  5APJ A;  3H0A A;  2ZMI A;  1XDK A;  3W5Q A;  3HC5 A;  4IW6 A;  4OLM A;  2YLP A;  4APU A;  5EJV A;  4BCR A;  4A4V A;  3HZF A;  4ONI A;  3G0W A;  3W0Y A;  3RUT A;  2HAM A;  3FUG A;  3P88 A;  1YOK A;  1PQ9 A;  3KWY A;  4MGA A;  4OHA A;  4MGA B;  3CDP A;  1ILH A;  3PBA A;  3SP9 A;  2ZNN A;  2ABI A;  3A9E A;  3A9E B;  2QGT A;  2Q61 A;  2P15 A;  4RE8 A;  1I38 A;  2VV1 A;  3TKC A;  2AM9 A;  3B0W A;  3V4A A;  3E7C A;  2POG A;  5KCD A;  2J7Y A;  1T74 A;  5DI7 A;  1T7M A;  5DYB A;  3VT8 A;  2AWH A;  3OAP A;  2B1Z A;  2OUZ A;  3OSW A;  4QJR A;  1XP9 A;  4FGY A;  5DV8 A;  1S19 A;  3FAL B;  1HJ1 A;  2ZXZ A;  3HQ5 A;  1XNX A;  3ERT A;  4IVY A;  3DZU D;  4DMA A;  3DZU A;  1G2N A;  1T7F A;  4IU7 A;  3WJ5 A;  1ZKY A;  2Q3Y A;  4IA1 A;  3S9S A;  4OEZ A;  3WT7 A;  3UU7 A;  1A28 A;  2Q59 A;  2Q59 B;  3FS1 A;  3OLL A;  1QKT A;  4RAK A;  1NHZ A;  1PK5 A;  4NQA B;  4OIV A;  1P8D A;  5KD9 A;  1RKG A;  2B50 A;  3OS9 A;  4OZR U;  4UDC A;  4WQP A;  3D5F A;  4NB6 A;  1XPC A;  1T79 A;  3IPS A;  3L3X A;  4TUZ A;  3ET3 A;  4TUZ B;  2ATH A;  3MNP A;  4XLD A;  5DMF A;  4ZI1 A;  2PIN A;  3B68 A;  4MG9 B;  2AXA A;  5JJM B;  4EMA A;  5HJP A;  2JFA A;  5HJP B;  1XAP A;  2P1T A;  3ADS A;  1L2J A;  3FLI A;  1QKU A;  2Q5P A;  1NRL A;  5APK A;  3IPQ A;  2ZK4 A;  3W0J A;  4PRG A;  1YYE A;  4JL4 A;  2F4B A;  2VV2 A;  1OSH A;  3N00 A;  5DV3 A;  3VI8 A;  1N83 A;  5DK9 A;  3E94 A;  3W0A A;  4MGC A;  2VV3 A;  2XHS A;  2YJD A;  4PLD A;  5DXR A;  3IMY A;  5AWK A;  3OSA A;  3X31 A;  1I7G A;  5DTV A;  4K7A A;  2FVJ A;  1Q4X A;  3B65 A;  1RKH A;  2Q1H A;  3IA6 A;  1Y9R A;  4IA7 A;  2AO6 A;  4OC7 A;  3ET1 A;  1TFC A;  4IA3 A;  4DK8 A;  1S9Q A;  1Z95 A;  3RLL A;  4PP5 A;  4S0S A;  5GT4 A;  3O1E A;  2VSR A;  2B23 A;  3CJW A;  1X76 A;  3GZ9 A;  4OZR E;  1ZDT A;  2YLQ A;  2I4P A;  3U9Q A;  2P7Z A; 
#chains in the Genus database with same CATH topology
 1NAV A;  3Q95 B;  5G42 A;  3UVV A;  3UVV B;  4DOS A;  3F5C B;  3A2J A;  3D24 A;  5DMC A;  5DSH A;  4HLW A;  2ACL A;  2ACL B;  1XNN A;  2Q7K A;  3NSP A;  4OZT U;  5DZH A;  3D90 A;  2PIV A;  3CLD A;  5C4S A;  3OMQ A;  3VJH A;  3OGT A;  4PPP A;  4ZO1 X;  2GWX A;  5GIC A;  5DKB A;  2PIW A;  1KV6 A;  2IOK A;  2R40 D;  2I4J A;  2XYW A;  3A2I A;  5AK2 A;  1UPW A;  3R8D A;  3VT6 A;  3W0H A;  3JZB A;  1K74 A;  3ZR7 A;  1OT7 A;  4IVW A;  4N5G A;  2GIU A;  2HFP A;  5G45 A;  2HB8 A;  5KRL A;  2I0J A;  2V7C A;  4ZJR A;  2NXX A;  1PQC A;  1NQ0 A;  3X36 A;  4IS8 A;  5ICK A;  4RME A;  4OIU A;  1H9U A;  3BC5 A;  3L1B A;  3AN4 A;  1Y0X X;  4OIL A;  2Q60 A;  3B0R A;  3VTC A;  3X1H A;  3HOD A;  1RJK A;  1XVP A;  1Y0S A;  3B0T A;  4J5W C;  2H79 A;  4ZN7 A;  2FSZ A;  3ZRB A;  4JAZ A;  4REE A;  5HZC A;  2QPY A;  4RMC A;  3A40 X;  5DZ1 A;  1SKX A;  3GWX A;  3X1I A;  4ZNW A;  5HYR A;  1NAX A;  5DUH A;  2PIX A;  2NPA A;  2VV4 A;  1XQC A;  2JJ3 A;  2VV4 B;  2Q5G A;  3A2H A;  3ERD A;  3ILZ A;  4ZNU A;  5AYG A;  2POB A;  2Q7I A;  3BQD A;  4PF3 A;  5G3J A;  5SYZ A;  1G1U A;  3OLF A;  5DVS A;  2ZK2 A;  3UUC A;  4XI3 A;  1N4H A;  5G5W A;  4ZO1 B;  4JYH A;  3HVL A;  5L7E A;  4P6X A;  3L0J A;  3WGP A;  5APH A;  5FQT A;  3DR1 A;  4MG8 B;  4DK7 A;  2Z4J A;  4UDA A;  3UUD A;  3UUD B;  2GPV A;  4NUF A;  4G1Z A;  3HLV A;  4N1Y A;  2YFE A;  5E0X A;  3OMP A;  2Q6S A;  3HO0 A;  1K4W A;  2ZY0 A;  5HYK A;  4DQM A;  1NQ2 A;  3ADX A;  2YHD A;  3LBD A;  2AA2 A;  4DM8 A;  3SP6 A;  1FCZ A;  4G1D A;  4HEE X;  1I7I A;  1A52 A;  4RUP A;  1XLS E;  1P93 A;  3OS8 C;  4YMQ A;  3A3Z X;  3OLS A;  1FM6 D;  2AMA A;  3OKH A;  1FM6 A;  3OZJ A;  3W0G A;  2ZK6 A;  3P8X A;  5DWE A;  2QR9 A;  1PRG A;  2YLY A;  3GYU A;  2AA6 A;  1R20 D;  1ILG A;  2PKL A;  1R20 A;  2Q70 A;  1E3G A;  4J5W A;  4PXM A;  2Q8S A;  5FQS A;  3ZQT A;  4NIE A;  5KRK A;  1NQ1 A;  3A78 A;  4MG7 A;  3DT3 A;  4MG7 B;  3AUN A;  2NW4 A;  3MNO A;  3EYB A;  5LGA A;  3FAL A;  1XP1 A;  4OH5 A;  4E4K A;  1IE8 A;  4J24 A;  1MVC A;  3ADV A;  3DY6 A;  3IXP D;  1PQ6 A;  3IXP A;  3G8O A;  4OKX A;  3RY9 A;  5KRF A;  4G2H A;  4ITF A;  3VJT A;  1L2I A;  4N73 A;  3KMG A;  5GID A;  3AUQ A;  3AZ3 A;  1QKN A;  1XZX X;  1XIU A;  3ET2 A;  3V9T A;  5DX3 A;  3FC6 B;  3PO9 A;  4LNW A;  1R1K A;  4ZNV A;  5DX3 B;  4J5X C;  3G9E A;  3RVF A;  2Q6R A;  1SJ0 A;  3TKM A;  4MG9 A;  5JJM A;  4X1F A;  2HAS A;  3R29 A;  4ZNS A;  3V9Y A;  4YPQ A;  1GWX A;  3PLZ A;  1ZDU A;  3AUR A;  4R2U A;  4RZG A;  5E0W A;  5FQV A;  4JYI A;  5EI1 A;  4ITE A;  1DB1 A;  1FD0 A;  5DUG A;  3WJ4 A;  4E4Q A;  1OVL B;  4MGD A;  4MGD B;  5KCU A;  5DKE A;  3OS8 A;  2OAX A;  4G21 A;  5DZ0 A;  5L7G A;  2ZNO A;  1OSV A;  5AAV A;  5AAV B;  5DIG A;  1T7T A;  2W8Y A;  5DP0 A;  3KBA A;  1X7E A;  2IHQ A;  2E2R A;  4PVU A;  2Q5S A;  5DXG A;  5G46 A;  1ERR A;  4OEA A;  2QXS A;  3H52 A;  3AZ1 A;  3G8I A;  4REF A;  3AX8 A;  1T76 A;  4DOR A;  2GPP A;  3WMH A;  5EGV A;  5DZI A;  3V3E A;  3W5R A;  2OM9 A;  4OK1 A;  5DWI A;  3NSQ A;  4KZM A;  3R8I A;  3PCU A;  3UP0 A;  4CI5 A;  5E14 A;  4FN9 A;  4IV4 A;  5C4U A;  4QE8 A;  4PP6 A;  4WVD A;  1NDE A;  2ZLC A;  3W5P A;  2QZO B;  3AFR A;  1FM9 D;  4J26 A;  4K6I A;  4L98 A;  1FM9 A;  1XOW A;  3Q95 A;  5EC9 A;  3F5C A;  1ERE A;  4OJ9 A;  1YOW A;  2PNU A;  1PCG A;  4POJ A;  5KRC A;  5EIT A;  2ZVT A;  2P1V A;  3GWS X;  1UHL A;  5DYD A;  1UHL B;  4PPS A;  5H1E A;  1GWQ A;  2ZNP A;  5DV6 A;  4J5X A;  3W5T A;  3VN2 A;  2HAR A;  1LV2 A;  2HB7 A;  3JZC A;  4X1G A;  2H77 A;  2JF9 A;  2HC4 A;  1M2Z A;  3VRT A;  2A3I A;  4RMD A;  3RUU A;  1K74 D;  1PZL A;  1T63 A;  4IW8 A;  4IUI A;  4RFW A;  5DY8 A;  1XJ7 A;  5KCF A;  1XV9 B;  5KRM A;  1UOM A;  5E19 A;  5DZ3 A;  5KYJ A;  2P1U A;  2ZMJ A;  5DLR A;  4FNE A;  4OJB A;  5F9B A;  2QTU A;  4JGV A;  4MGB A;  4MGB B;  2Q7J A;  2GTK A;  3B1M A;  4QL8 A;  3VRW A;  3CTB A;  2VV0 A;  1S0Z A;  1M7W A;  3KMR A;  5DWL A;  4N8R A;  1YIM A;  2AX9 A;  1X78 A;  1RK3 A;  3WTQ A;  3B3K A;  3VSP A;  1Z5X U;  4ZNH A;  5DXQ A;  3W0I A;  4LBD A;  1YUC A;  3IPU A;  2P7A A;  4LTW A;  3K6P A;  4XHD A;  3OSI A;  3R2A A;  3SZ1 A;  5DRJ A;  2HBH A;  1WM0 X;  1YY4 A;  1UPV A;  3L03 A;  4QE6 A;  3RLJ A;  3VHW A;  1ZAF A;  3B66 A;  1FCX A;  2HWR A;  4UDD A;  5DID A;  4IWC A;  2ZL9 A;  3K8S A;  5ACC A;  1S9P A;  2YAT A;  1TXI A;  2PIP L;  4MG8 A;  3P0U A;  2GPO A;  1BSX A;  3KDT A;  1YMT A;  5JY3 A;  4LNX A;  4YNK A;  3L3Z A;  1YP0 A;  3K23 A;  3QT0 A;  4FHH A;  5AVI A;  3E00 D;  3E00 A;  3PEQ A;  5B41 A;  4MDD A;  1EXX A;  3TY0 A;  2HCD A;  3VT7 A;  1S0X A;  5KRJ A;  1X7R A;  2ZK1 A;  2PIQ A;  4LSJ A;  3DZY D;  2R6Y A;  4CI4 A;  3DZY A;  1RDT D;  1RDT A;  4XUH A;  3VT3 A;  1R6G A;  4MG6 A;  5DXK A;  3CDS A;  1N46 A;  4MG5 A;  3WT6 A;  2VST A;  1FBY A;  5KRH A;  2AX8 A;  2QGW A;  1Z5X E;  5DWJ A;  3WFG A;  4ZOM A;  3VT4 A;  1XQ3 A;  2O9I A;  2ZFX A;  4ZN9 A;  2G5O A;  4NY9 A;  5E15 A;  5L11 A;  4QK4 A;  4Q50 A;  1XDK B;  4RUJ A;  2AX7 A;  5HJS A;  2AX6 A;  4O8F A;  3FEI A;  4POH A;  1SQN A;  4OKT A;  2R6W A;  2ZNQ A;  5CJ6 A;  5JI0 D;  3HM1 A;  2I4Z A;  2NXX E;  4OFU A;  5DXM A;  5DWG A;  1G5Y A;  2QSE A;  2QW4 A;  4EM9 A;  1EXA A;  2HWQ A;  1YJE A;  1T5Z A;  4XTA A;  5KCW A;  4ZNT A;  1R5K A;  3B0Q A;  2EWP A;  2AA7 A;  1X7B A;  3GN8 A;  3DCT A;  1XP6 A;  1R1K D;  2G0H A;  2GPU A;  2VV1 B;  2QAB A;  2YLO A;  1YIN A;  3FC6 A;  4OKB A;  4OEY A;  2LBD A;  4WHG A;  1ZUC A;  3O1D A;  4QM0 A;  5L7H A;  3HC6 A;  3GYT A;  3R5N A;  4KZI A;  1PDU A;  3ZRA A;  4A4W A;  1U3R A;  2QH6 A;  4IQR A;  3WFF A;  4CSJ A;  1FCY A;  5I4V A;  5KCT A;  3CS8 A;  4OH6 A;  3CS6 A;  3OMO A;  4P6W A;  5AZV A;  1ZEO A;  3L0L A;  5DUE A;  2QA6 A;  3VTB A;  4DM6 A;  4PLE A;  1MV9 A;  1XB7 A;  1OVL A;  3BEJ A;  3VRV A;  3WWR A;  5KCC A;  3D6D A;  3VT9 A;  5KRI A;  1GWR A;  2PRG A;  2J4A A;  2NV7 A;  3ADU A;  5AVL A;  3UU7 B;  5C4O A;  3K22 A;  3OZ0 A;  2V0V A;  4WHF A;  3AN3 A;  3T03 A;  1E3K A;  2GP7 A;  2ZK0 A;  3GBK A;  3UP3 A;  2G44 A;  3OMM A;  1KKQ A;  4Y29 A;  4RUO X;  2OVH A;  3V49 A;  5B5B A;  3LMP A;  5IXK A;  1U9E A;  4PP3 A;  3WT5 A;  2AB2 A;  4TV1 A;  5G44 A;  4TV1 B;  3VTD A;  2Q1V A;  2J14 A;  2QMV A;  3R5M A;  5DXB A;  2JFA B;  3MNE A;  3B5R A;  4G2I A;  2I0G A;  5DXB B;  1ZGY A;  1K7L A;  2XYX A;  4ZJW A;  2P4Y A;  3VSO A;  2QZO A;  3L0E A;  5DVC A;  4S14 A;  2OCF A;  2ZK3 A;  4PWL A;  1MZN A;  4OAR A;  5KRA A;  3NOA A;  3VHV A;  4RZE A;  2P54 A;  4F9M A;  5C4T A;  1T65 A;  4RWV A;  5DKG A;  1IE9 A;  1T73 A;  2ZKC A;  5GIE A;  4R6S A;  3VT5 A;  2FAI A;  2ZMH A;  2B1V A;  3UUA A;  5FQP A;  3UUA B;  1NYX A;  3CS4 A;  5M96 A;  1NUO A;  2PIU A;  2QNV A;  4R06 A;  5DRM A;  2PJL A;  4G1Y A;  1ZH7 A;  4OJ4 A;  1YA3 A;  2Q6J A;  3OMK A;  2XKW A;  4IV2 A;  3OKI A;  2PIR A;  3OOF A;  1U3Q A;  1VJB A;  1XV9 A;  1NQ7 A;  5DL4 A;  4L96 A;  4S0T A;  4A2J A;  2YJA B;  2BJ4 A;  3D57 A;  2BJ4 B;  3CWD A;  2PIO A;  5DIE A;  3V3Q A;  1XLS A;  2QXM A;  3FXV A;  4OED A;  4XT9 A;  3ET0 A;  3TX7 B;  2QE4 A;  2ZK5 A;  4RZF A;  3ADT A;  2BAW A;  5DXP A;  1QKM A;  1T7R A;  2PIT A;  3KYT A;  4WLB A;  5ETH A;  2AYR A;  4K4J A;  5AZT A;  1LBD A;  3W0C A;  4Q0A C;  1G50 A;  4S15 A;  4KZJ A;  2R40 A;  5EHJ A;  5KR9 A;  3ADW A;  4FHI A;  4G20 A;  5DKS A;  5E1C A;  5A86 A;  4OFR A;  1SR7 A;  5HCV A;  2J7X A;  3GD2 A;  5G43 A;  2OZ7 A;  2G0G A;  3P89 A;  4M8H A;  2QA8 A;  4IA2 A;  2QA8 B;  3KDU A;  2Z4B A;  3FEJ A;  5DVV A;  5FQR A;  3VRU A;  1DKF A;  2ZXN A;  1DKF B;  2O4R A;  4IWF A;  1GS4 A;  3R8A A;  3F7D A;  1XVP B;  4XUM A;  3V9V A;  2AA5 A;  2AMB A;  2ZAS A;  3PRG A;  4OGH A;  4UDB A;  2O4J A;  5LWP A;  3KFC A;  2GL8 A;  5E7V A;  1KNU A;  5AWJ A;  5IAW A;  2REW A;  2P7G A;  4M8E A;  3VHU A;  4OZT E;  3VJS A;  2XYJ A;  2ZBS A;  2Q7L A;  2ZLA A;  3OOK A;  2OVM A;  3AZ2 A;  1U3S A;  3CQV A;  4WPF A;  3VJI A;  2HVC A;  1X7J A;  2AAX A;  1I37 A;  3B67 A;  5KYA A;  5KCE A;  3KMZ A;  5KRO A;  4JYG A;  3FUR A;  2IOG A;  4XAO A;  5DXE A;  5AAU A;  5IZ0 A;  3DCU A;  5K13 A;  3M7R A;  4Q13 A;  4YT1 A;  4E2J A;  4B7W A;  4OKW A;  2ZXM A;  3KPZ A;  1HG4 A;  5DU5 A;  1M13 A;  3H0A D;  5APJ A;  3H0A A;  2ZMI A;  1XDK A;  3W5Q A;  3HC5 A;  4IW6 A;  4OLM A;  2YLP A;  4APU A;  5EJV A;  4BCR A;  4A4V A;  3HZF A;  4ONI A;  3G0W A;  3W0Y A;  3RUT A;  2HAM A;  3FUG A;  3P88 A;  1YOK A;  1PQ9 A;  3KWY A;  4MGA A;  4OHA A;  4MGA B;  3CDP A;  1ILH A;  3PBA A;  3SP9 A;  2ZNN A;  2ABI A;  3A9E A;  3A9E B;  2QGT A;  2Q61 A;  2P15 A;  4RE8 A;  1I38 A;  2VV1 A;  3TKC A;  2AM9 A;  3B0W A;  3V4A A;  3E7C A;  2POG A;  5KCD A;  2J7Y A;  1T74 A;  5DI7 A;  1T7M A;  5DYB A;  3VT8 A;  2AWH A;  3OAP A;  2B1Z A;  2OUZ A;  3OSW A;  4QJR A;  1XP9 A;  4FGY A;  5DV8 A;  1S19 A;  3FAL B;  1HJ1 A;  2ZXZ A;  3HQ5 A;  1XNX A;  3ERT A;  4IVY A;  3DZU D;  4DMA A;  3DZU A;  1G2N A;  1T7F A;  4IU7 A;  3WJ5 A;  1ZKY A;  2Q3Y A;  4IA1 A;  3S9S A;  4OEZ A;  3WT7 A;  3UU7 A;  1A28 A;  2Q59 A;  2Q59 B;  3FS1 A;  3OLL A;  1QKT A;  4RAK A;  1NHZ A;  1PK5 A;  4NQA B;  4OIV A;  1P8D A;  5KD9 A;  1RKG A;  2B50 A;  3OS9 A;  4OZR U;  4UDC A;  4WQP A;  3D5F A;  4NB6 A;  1XPC A;  1T79 A;  3IPS A;  3L3X A;  4TUZ A;  3ET3 A;  4TUZ B;  2ATH A;  3MNP A;  4XLD A;  5DMF A;  4ZI1 A;  2PIN A;  3B68 A;  4MG9 B;  2AXA A;  5JJM B;  4EMA A;  5HJP A;  2JFA A;  5HJP B;  1XAP A;  2P1T A;  3ADS A;  1L2J A;  3FLI A;  1QKU A;  2Q5P A;  1NRL A;  5APK A;  3IPQ A;  2ZK4 A;  3W0J A;  4PRG A;  1YYE A;  4JL4 A;  2F4B A;  2VV2 A;  1OSH A;  3N00 A;  5DV3 A;  3VI8 A;  1N83 A;  5DK9 A;  3E94 A;  3W0A A;  4MGC A;  2VV3 A;  2XHS A;  2YJD A;  4PLD A;  5DXR A;  3IMY A;  5AWK A;  3OSA A;  3X31 A;  1I7G A;  5DTV A;  4K7A A;  2FVJ A;  1Q4X A;  3B65 A;  1RKH A;  2Q1H A;  3IA6 A;  1Y9R A;  4IA7 A;  2AO6 A;  4OC7 A;  3ET1 A;  1TFC A;  4IA3 A;  4DK8 A;  1S9Q A;  1Z95 A;  3RLL A;  4PP5 A;  4S0S A;  5GT4 A;  3O1E A;  2VSR A;  2B23 A;  3CJW A;  1X76 A;  3GZ9 A;  4OZR E;  1ZDT A;  2YLQ A;  2I4P A;  3U9Q A;  2P7Z A; 
#chains in the Genus database with same CATH homology
 1NAV A;  3Q95 B;  5G42 A;  3UVV A;  3UVV B;  4DOS A;  3F5C B;  3A2J A;  3D24 A;  5DMC A;  5DSH A;  4HLW A;  2ACL A;  2ACL B;  1XNN A;  2Q7K A;  3NSP A;  4OZT U;  5DZH A;  3D90 A;  2PIV A;  3CLD A;  5C4S A;  3OMQ A;  3VJH A;  3OGT A;  4PPP A;  4ZO1 X;  2GWX A;  5GIC A;  5DKB A;  2PIW A;  1KV6 A;  2IOK A;  2R40 D;  2I4J A;  2XYW A;  3A2I A;  5AK2 A;  1UPW A;  3R8D A;  3VT6 A;  3W0H A;  3JZB A;  1K74 A;  3ZR7 A;  1OT7 A;  4IVW A;  4N5G A;  2GIU A;  2HFP A;  5G45 A;  2HB8 A;  5KRL A;  2I0J A;  2V7C A;  4ZJR A;  2NXX A;  1PQC A;  1NQ0 A;  3X36 A;  4IS8 A;  5ICK A;  4RME A;  4OIU A;  1H9U A;  3BC5 A;  3L1B A;  3AN4 A;  1Y0X X;  4OIL A;  2Q60 A;  3B0R A;  3VTC A;  3X1H A;  3HOD A;  1RJK A;  1XVP A;  1Y0S A;  3B0T A;  4J5W C;  2H79 A;  4ZN7 A;  2FSZ A;  3ZRB A;  4JAZ A;  4REE A;  5HZC A;  2QPY A;  4RMC A;  3A40 X;  5DZ1 A;  1SKX A;  3GWX A;  3X1I A;  4ZNW A;  5HYR A;  1NAX A;  5DUH A;  2PIX A;  2NPA A;  2VV4 A;  1XQC A;  2JJ3 A;  2VV4 B;  2Q5G A;  3A2H A;  3ERD A;  3ILZ A;  4ZNU A;  5AYG A;  2POB A;  2Q7I A;  3BQD A;  4PF3 A;  5G3J A;  5SYZ A;  1G1U A;  3OLF A;  5DVS A;  2ZK2 A;  3UUC A;  4XI3 A;  1N4H A;  5G5W A;  4ZO1 B;  4JYH A;  3HVL A;  5L7E A;  4P6X A;  3L0J A;  3WGP A;  5APH A;  5FQT A;  3DR1 A;  4MG8 B;  4DK7 A;  2Z4J A;  4UDA A;  3UUD A;  3UUD B;  2GPV A;  4NUF A;  4G1Z A;  3HLV A;  4N1Y A;  2YFE A;  5E0X A;  3OMP A;  2Q6S A;  3HO0 A;  1K4W A;  2ZY0 A;  5HYK A;  4DQM A;  1NQ2 A;  3ADX A;  2YHD A;  3LBD A;  2AA2 A;  4DM8 A;  3SP6 A;  1FCZ A;  4G1D A;  4HEE X;  1I7I A;  1A52 A;  4RUP A;  1XLS E;  1P93 A;  3OS8 C;  4YMQ A;  3A3Z X;  3OLS A;  1FM6 D;  2AMA A;  3OKH A;  1FM6 A;  3OZJ A;  3W0G A;  2ZK6 A;  3P8X A;  5DWE A;  2QR9 A;  1PRG A;  2YLY A;  3GYU A;  2AA6 A;  1R20 D;  1ILG A;  2PKL A;  1R20 A;  2Q70 A;  1E3G A;  4J5W A;  4PXM A;  2Q8S A;  5FQS A;  3ZQT A;  4NIE A;  5KRK A;  1NQ1 A;  3A78 A;  4MG7 A;  3DT3 A;  4MG7 B;  3AUN A;  2NW4 A;  3MNO A;  3EYB A;  5LGA A;  3FAL A;  1XP1 A;  4OH5 A;  4E4K A;  1IE8 A;  4J24 A;  1MVC A;  3ADV A;  3DY6 A;  3IXP D;  1PQ6 A;  3IXP A;  3G8O A;  4OKX A;  3RY9 A;  5KRF A;  4G2H A;  4ITF A;  3VJT A;  1L2I A;  4N73 A;  3KMG A;  5GID A;  3AUQ A;  3AZ3 A;  1QKN A;  1XZX X;  1XIU A;  3ET2 A;  3V9T A;  5DX3 A;  3FC6 B;  3PO9 A;  4LNW A;  1R1K A;  4ZNV A;  5DX3 B;  4J5X C;  3G9E A;  3RVF A;  2Q6R A;  1SJ0 A;  3TKM A;  4MG9 A;  5JJM A;  4X1F A;  2HAS A;  3R29 A;  4ZNS A;  3V9Y A;  4YPQ A;  1GWX A;  3PLZ A;  1ZDU A;  3AUR A;  4R2U A;  4RZG A;  5E0W A;  5FQV A;  4JYI A;  5EI1 A;  4ITE A;  1DB1 A;  1FD0 A;  5DUG A;  3WJ4 A;  4E4Q A;  1OVL B;  4MGD A;  4MGD B;  5KCU A;  5DKE A;  3OS8 A;  2OAX A;  4G21 A;  5DZ0 A;  5L7G A;  2ZNO A;  1OSV A;  5AAV A;  5AAV B;  5DIG A;  1T7T A;  2W8Y A;  5DP0 A;  3KBA A;  1X7E A;  2IHQ A;  2E2R A;  4PVU A;  2Q5S A;  5DXG A;  5G46 A;  1ERR A;  4OEA A;  2QXS A;  3H52 A;  3AZ1 A;  3G8I A;  4REF A;  3AX8 A;  1T76 A;  4DOR A;  2GPP A;  3WMH A;  5EGV A;  5DZI A;  3V3E A;  3W5R A;  2OM9 A;  4OK1 A;  5DWI A;  3NSQ A;  4KZM A;  3R8I A;  3PCU A;  3UP0 A;  4CI5 A;  5E14 A;  4FN9 A;  4IV4 A;  5C4U A;  4QE8 A;  4PP6 A;  4WVD A;  1NDE A;  2ZLC A;  3W5P A;  2QZO B;  3AFR A;  1FM9 D;  4J26 A;  4K6I A;  4L98 A;  1FM9 A;  1XOW A;  3Q95 A;  5EC9 A;  3F5C A;  1ERE A;  4OJ9 A;  1YOW A;  2PNU A;  1PCG A;  4POJ A;  5KRC A;  5EIT A;  2ZVT A;  2P1V A;  3GWS X;  1UHL A;  5DYD A;  1UHL B;  4PPS A;  5H1E A;  1GWQ A;  2ZNP A;  5DV6 A;  4J5X A;  3W5T A;  3VN2 A;  2HAR A;  1LV2 A;  2HB7 A;  3JZC A;  4X1G A;  2H77 A;  2JF9 A;  2HC4 A;  1M2Z A;  3VRT A;  2A3I A;  4RMD A;  3RUU A;  1K74 D;  1PZL A;  1T63 A;  4IW8 A;  4IUI A;  4RFW A;  5DY8 A;  1XJ7 A;  5KCF A;  1XV9 B;  5KRM A;  1UOM A;  5E19 A;  5DZ3 A;  5KYJ A;  2P1U A;  2ZMJ A;  5DLR A;  4FNE A;  4OJB A;  5F9B A;  2QTU A;  4JGV A;  4MGB A;  4MGB B;  2Q7J A;  2GTK A;  3B1M A;  4QL8 A;  3VRW A;  3CTB A;  2VV0 A;  1S0Z A;  1M7W A;  3KMR A;  5DWL A;  4N8R A;  1YIM A;  2AX9 A;  1X78 A;  1RK3 A;  3WTQ A;  3B3K A;  3VSP A;  1Z5X U;  4ZNH A;  5DXQ A;  3W0I A;  4LBD A;  1YUC A;  3IPU A;  2P7A A;  4LTW A;  3K6P A;  4XHD A;  3OSI A;  3R2A A;  3SZ1 A;  5DRJ A;  2HBH A;  1WM0 X;  1YY4 A;  1UPV A;  3L03 A;  4QE6 A;  3RLJ A;  3VHW A;  1ZAF A;  3B66 A;  1FCX A;  2HWR A;  4UDD A;  5DID A;  4IWC A;  2ZL9 A;  3K8S A;  5ACC A;  1S9P A;  2YAT A;  1TXI A;  2PIP L;  4MG8 A;  3P0U A;  2GPO A;  1BSX A;  3KDT A;  1YMT A;  5JY3 A;  4LNX A;  4YNK A;  3L3Z A;  1YP0 A;  3K23 A;  3QT0 A;  4FHH A;  5AVI A;  3E00 D;  3E00 A;  3PEQ A;  5B41 A;  4MDD A;  1EXX A;  3TY0 A;  2HCD A;  3VT7 A;  1S0X A;  5KRJ A;  1X7R A;  2ZK1 A;  2PIQ A;  4LSJ A;  3DZY D;  2R6Y A;  4CI4 A;  3DZY A;  1RDT D;  1RDT A;  4XUH A;  3VT3 A;  1R6G A;  4MG6 A;  5DXK A;  3CDS A;  1N46 A;  4MG5 A;  3WT6 A;  2VST A;  1FBY A;  5KRH A;  2AX8 A;  2QGW A;  1Z5X E;  5DWJ A;  3WFG A;  4ZOM A;  3VT4 A;  1XQ3 A;  2O9I A;  2ZFX A;  4ZN9 A;  2G5O A;  4NY9 A;  5E15 A;  5L11 A;  4QK4 A;  4Q50 A;  1XDK B;  4RUJ A;  2AX7 A;  5HJS A;  2AX6 A;  4O8F A;  3FEI A;  4POH A;  1SQN A;  4OKT A;  2R6W A;  2ZNQ A;  5CJ6 A;  5JI0 D;  3HM1 A;  2I4Z A;  2NXX E;  4OFU A;  5DXM A;  5DWG A;  1G5Y A;  2QSE A;  2QW4 A;  4EM9 A;  1EXA A;  2HWQ A;  1YJE A;  1T5Z A;  4XTA A;  5KCW A;  4ZNT A;  1R5K A;  3B0Q A;  2EWP A;  2AA7 A;  1X7B A;  3GN8 A;  3DCT A;  1XP6 A;  1R1K D;  2G0H A;  2GPU A;  2VV1 B;  2QAB A;  2YLO A;  1YIN A;  3FC6 A;  4OKB A;  4OEY A;  2LBD A;  4WHG A;  1ZUC A;  3O1D A;  4QM0 A;  5L7H A;  3HC6 A;  3GYT A;  3R5N A;  4KZI A;  1PDU A;  3ZRA A;  4A4W A;  1U3R A;  2QH6 A;  4IQR A;  3WFF A;  4CSJ A;  1FCY A;  5I4V A;  5KCT A;  3CS8 A;  4OH6 A;  3CS6 A;  3OMO A;  4P6W A;  5AZV A;  1ZEO A;  3L0L A;  5DUE A;  2QA6 A;  3VTB A;  4DM6 A;  4PLE A;  1MV9 A;  1XB7 A;  1OVL A;  3BEJ A;  3VRV A;  3WWR A;  5KCC A;  3D6D A;  3VT9 A;  5KRI A;  1GWR A;  2PRG A;  2J4A A;  2NV7 A;  3ADU A;  5AVL A;  3UU7 B;  5C4O A;  3K22 A;  3OZ0 A;  2V0V A;  4WHF A;  3AN3 A;  3T03 A;  1E3K A;  2GP7 A;  2ZK0 A;  3GBK A;  3UP3 A;  2G44 A;  3OMM A;  1KKQ A;  4Y29 A;  4RUO X;  2OVH A;  3V49 A;  5B5B A;  3LMP A;  5IXK A;  1U9E A;  4PP3 A;  3WT5 A;  2AB2 A;  4TV1 A;  5G44 A;  4TV1 B;  3VTD A;  2Q1V A;  2J14 A;  2QMV A;  3R5M A;  5DXB A;  2JFA B;  3MNE A;  3B5R A;  4G2I A;  2I0G A;  5DXB B;  1ZGY A;  1K7L A;  2XYX A;  4ZJW A;  2P4Y A;  3VSO A;  2QZO A;  3L0E A;  5DVC A;  4S14 A;  2OCF A;  2ZK3 A;  4PWL A;  1MZN A;  4OAR A;  5KRA A;  3NOA A;  3VHV A;  4RZE A;  2P54 A;  4F9M A;  5C4T A;  1T65 A;  4RWV A;  5DKG A;  1IE9 A;  1T73 A;  2ZKC A;  5GIE A;  4R6S A;  3VT5 A;  2FAI A;  2ZMH A;  2B1V A;  3UUA A;  5FQP A;  3UUA B;  1NYX A;  3CS4 A;  5M96 A;  1NUO A;  2PIU A;  2QNV A;  4R06 A;  5DRM A;  2PJL A;  4G1Y A;  1ZH7 A;  4OJ4 A;  1YA3 A;  2Q6J A;  3OMK A;  2XKW A;  4IV2 A;  3OKI A;  2PIR A;  3OOF A;  1U3Q A;  1VJB A;  1XV9 A;  1NQ7 A;  5DL4 A;  4L96 A;  4S0T A;  4A2J A;  2YJA B;  2BJ4 A;  3D57 A;  2BJ4 B;  3CWD A;  2PIO A;  5DIE A;  3V3Q A;  1XLS A;  2QXM A;  3FXV A;  4OED A;  4XT9 A;  3ET0 A;  3TX7 B;  2QE4 A;  2ZK5 A;  4RZF A;  3ADT A;  2BAW A;  5DXP A;  1QKM A;  1T7R A;  2PIT A;  3KYT A;  4WLB A;  5ETH A;  2AYR A;  4K4J A;  5AZT A;  1LBD A;  3W0C A;  4Q0A C;  1G50 A;  4S15 A;  4KZJ A;  2R40 A;  5EHJ A;  5KR9 A;  3ADW A;  4FHI A;  4G20 A;  5DKS A;  5E1C A;  5A86 A;  4OFR A;  1SR7 A;  5HCV A;  2J7X A;  3GD2 A;  5G43 A;  2OZ7 A;  2G0G A;  3P89 A;  4M8H A;  2QA8 A;  4IA2 A;  2QA8 B;  3KDU A;  2Z4B A;  3FEJ A;  5DVV A;  5FQR A;  3VRU A;  1DKF A;  2ZXN A;  1DKF B;  2O4R A;  4IWF A;  1GS4 A;  3R8A A;  3F7D A;  1XVP B;  4XUM A;  3V9V A;  2AA5 A;  2AMB A;  2ZAS A;  3PRG A;  4OGH A;  4UDB A;  2O4J A;  5LWP A;  3KFC A;  2GL8 A;  5E7V A;  1KNU A;  5AWJ A;  5IAW A;  2REW A;  2P7G A;  4M8E A;  3VHU A;  4OZT E;  3VJS A;  2XYJ A;  2ZBS A;  2Q7L A;  2ZLA A;  3OOK A;  2OVM A;  3AZ2 A;  1U3S A;  3CQV A;  4WPF A;  3VJI A;  2HVC A;  1X7J A;  2AAX A;  1I37 A;  3B67 A;  5KYA A;  5KCE A;  3KMZ A;  5KRO A;  4JYG A;  3FUR A;  2IOG A;  4XAO A;  5DXE A;  5AAU A;  5IZ0 A;  3DCU A;  5K13 A;  3M7R A;  4Q13 A;  4YT1 A;  4E2J A;  4B7W A;  4OKW A;  2ZXM A;  3KPZ A;  1HG4 A;  5DU5 A;  1M13 A;  3H0A D;  5APJ A;  3H0A A;  2ZMI A;  1XDK A;  3W5Q A;  3HC5 A;  4IW6 A;  4OLM A;  2YLP A;  4APU A;  5EJV A;  4BCR A;  4A4V A;  3HZF A;  4ONI A;  3G0W A;  3W0Y A;  3RUT A;  2HAM A;  3FUG A;  3P88 A;  1YOK A;  1PQ9 A;  3KWY A;  4MGA A;  4OHA A;  4MGA B;  3CDP A;  1ILH A;  3PBA A;  3SP9 A;  2ZNN A;  2ABI A;  3A9E A;  3A9E B;  2QGT A;  2Q61 A;  2P15 A;  4RE8 A;  1I38 A;  2VV1 A;  3TKC A;  2AM9 A;  3B0W A;  3V4A A;  3E7C A;  2POG A;  5KCD A;  2J7Y A;  1T74 A;  5DI7 A;  1T7M A;  5DYB A;  3VT8 A;  2AWH A;  3OAP A;  2B1Z A;  2OUZ A;  3OSW A;  4QJR A;  1XP9 A;  4FGY A;  5DV8 A;  1S19 A;  3FAL B;  1HJ1 A;  2ZXZ A;  3HQ5 A;  1XNX A;  3ERT A;  4IVY A;  3DZU D;  4DMA A;  3DZU A;  1G2N A;  1T7F A;  4IU7 A;  3WJ5 A;  1ZKY A;  2Q3Y A;  4IA1 A;  3S9S A;  4OEZ A;  3WT7 A;  3UU7 A;  1A28 A;  2Q59 A;  2Q59 B;  3FS1 A;  3OLL A;  1QKT A;  4RAK A;  1NHZ A;  1PK5 A;  4NQA B;  4OIV A;  1P8D A;  5KD9 A;  1RKG A;  2B50 A;  3OS9 A;  4OZR U;  4UDC A;  4WQP A;  3D5F A;  4NB6 A;  1XPC A;  1T79 A;  3IPS A;  3L3X A;  4TUZ A;  3ET3 A;  4TUZ B;  2ATH A;  3MNP A;  4XLD A;  5DMF A;  4ZI1 A;  2PIN A;  3B68 A;  4MG9 B;  2AXA A;  5JJM B;  4EMA A;  5HJP A;  2JFA A;  5HJP B;  1XAP A;  2P1T A;  3ADS A;  1L2J A;  3FLI A;  1QKU A;  2Q5P A;  1NRL A;  5APK A;  3IPQ A;  2ZK4 A;  3W0J A;  4PRG A;  1YYE A;  4JL4 A;  2F4B A;  2VV2 A;  1OSH A;  3N00 A;  5DV3 A;  3VI8 A;  1N83 A;  5DK9 A;  3E94 A;  3W0A A;  4MGC A;  2VV3 A;  2XHS A;  2YJD A;  4PLD A;  5DXR A;  3IMY A;  5AWK A;  3OSA A;  3X31 A;  1I7G A;  5DTV A;  4K7A A;  2FVJ A;  1Q4X A;  3B65 A;  1RKH A;  2Q1H A;  3IA6 A;  1Y9R A;  4IA7 A;  2AO6 A;  4OC7 A;  3ET1 A;  1TFC A;  4IA3 A;  4DK8 A;  1S9Q A;  1Z95 A;  3RLL A;  4PP5 A;  4S0S A;  5GT4 A;  3O1E A;  2VSR A;  2B23 A;  3CJW A;  1X76 A;  3GZ9 A;  4OZR E;  1ZDT A;  2YLQ A;  2I4P A;  3U9Q A;  2P7Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...