5HYKA

Crystal structure of the complex pparalpha/al26-29
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
267
structure length
255
Chain Sequence
DLKSLAKRIYEAYLKNFNMNKVKARVILSPFVIHDMETLCMAEKTLVAKLVNKEAEVRIFHCCQCTSVETVTELTEFAKAIPGFANLDLNDQVTLLKYGVYEAIFAMLSSVMNKDGMLVAYGNGFITREFLKSLRKPFCDIMEPKFDFAMKFNALELDDSDISLFVAAIICCGDRPGLLNVGHIEKMQEGIVHVLRLHLQSNHPDDIFLFPKLLQKMADLRQLVTEHAQLVQIIKKTESDAALHPLLQEIYRDMY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Peroxisome proliferator-activated receptor alpha
publication title Structural basis for PPAR partial or full activation revealed by a novel ligand binding mode.
pubmed doi rcsb
source organism Homo sapiens
total genus 96
structure length 255
sequence length 267
ec nomenclature
pdb deposition date 2016-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 5hykA00
1QKNA 1VJBA 1WM0X 3K6PA 1XVPB 3KPZA 4JL4A 4IVYA 4MDDA 4MG8B 2GTKA 2ZNNA 3ET2A 4OKBA 2YJDA 4WHFA 2AB2A 1SR7A 4J5XC 1RJKA 1NAVA 3F5CB 4R06A 2ZK5A 1XNXA 2ZNQA 4OIUA 2Q70A 4RWVA 4TUZB 5EGVA 1U3QA 5G46A 2OZ7A 3VTBA 2ZASA 3NSQA 1XDKA 3WMHA 4MGAA 3B3KA 4XUMA 2G5OA 4RZEA 1T7RA 3HQ5A 2A3IA 3VJIA 4HEEX 5DMFA 2GIUA 3Q95B 3ET1A 1Q4XA 2OCFA 3OS8A 1A28A 3KFCA 1KV6A 5DKEA 3A78A 2ZBSA 5ACCA 3GZ9A 4OJ9A 3UU7A 1MVCA 2I4ZA 4IA2A 2BAWA 3WT5A 1XP1A 2P1UA 3UUAA 3CS6A 2PIRA 1N46A 1LV2A 1PZLA 3WFFA 1ZH7A 1GS4A 4WVDA 5IAWA 3A9EB 2AX7A 4X1FA 1T5ZA 5DX3B 4ZNSA 3GWXA 3HVLA 4ZO1X 2J7XA 3GYTA 1M13A 2HVCA 4QL8A 1TFCA 1G2NA 5DRJA 5DYBA 5E19A 3VSOA 3WT7A 3IMYA 4QE8A 1PQ6A 2FSZA 3AUNA 3JZCA 5DVSA 2XYWA 3TY0A 1GWQA 5B5BA 5HJPA 2PIVA 1RKHA 2H77A 2O9IA 5EC9A 3UUDA 2ZK6A 1UHLB 4QK4A 5KYAA 1U3RA 3KMRA 3KYTA 1XPCA 3ILZA 5F9BA 1XP6A 5DVCA 5G3JA 4RMCA 2NV7A 1T73A 3N00A 2V7CA 2GWXA 4UDBA 3A2IA 2Q59B 3ADWA 5DKSA 2QR9A 2AX8A 4PP5A 1NQ7A 3OS8C 3VT3A 3WGPA 3W5PA 3PEQA 3F7DA 3B0QA 3G9EA 4QJRA 5DRMA 2ZNPA 5C4OA 3W0IA 2HARA 3DT3A 1FCZA 4JGVA 5IZ0A 5C4UA 5EI1A 5KCCA 4Q13A 5DUGA 1ZAFA 5DWIA 5FQVA 3HC5A 4POJA 4ZJWA 1PQ9A 4NUFA 2QXMA 1YJEA 3IXPD 1M2ZA 2P1TA 5DKBA 3IPSA 4S14A 3WJ5A 4MG7B 2R40A 2HB8A 2ZK3A 2LBDA 2OVHA 1RDTD 5DLRA 4A4WA 1FM6D 3VHWA 2PIXA 4N1YA 5L7HA 1SKXA 4OZRE 2YHDA 4QM0A 2ZK1A 1XLSE 5GT4A 3GD2A 3H0AD 3ERTA 2ZK2A 4ZOMA 5KRLA 1UPVA 2I4PA 4PVUA 4RMEA 4ZI1A 4OJBA 4S0SA 2YJAB 4HLWA 2VV3A 1FBYA 5KRFA 2ATHA 3FUGA 3KMZA 1R1KD 2AA6A 4LSJA 1XNNA 5AZVA 4MG5A 5FQRA 1T7FA 1Y0SA 1E3GA 4P6XA 4LNXA 2P1VA 2Q7KA 2POBA 2JJ3A 3V9YA 4PP3A 4KZMA 4XUHA 2HWQA 1K7LA 2Q8SA 1EXAA 2XYJA 2ZLAA 3FLIA 3KDTA 3CS4A 1P93A 5IXKA 3H52A 2JFAB 1I37A 2PJLA 1N4HA 1K74A 4MG7A 3B65A 4IV2A 4N73A 4NB6A 1XOWA 4WLBA 1T74A 5I4VA 4PXMA 5G43A 3U9QA 3SP9A 4RUPA 4G1YA 3L3XA 2B1VA 1FCXA 3B1MA 4PRGA 1XZXX 2QTUA 4B7WA 5JY3A 2HASA 2ACLB 2I0GA 2Z4BA 4IA3A 1X78A 5E15A 5KRCA 3UP0A 1OSVA 2IOGA 3X36A 2Q1HA 3DCTA 4XHDA 1FCYA 4A2JA 4RZFA 5ICKA 5DU5A 4OKTA 2QZOA 5KCFA 3IA6A 4OEYA 3B66A 3OKIA 3KMGA 1PQCA 4Q50A 3VJTA 5DIEA 4YT1A 1T65A 3GN8A 3L0LA 3A2HA 4APUA 2VV1B 2V0VA 1XAPA 5KR9A 3ADTA 4TV1A 4PLDA 3ET0A 4PPPA 5KRJA 2GPOA 3DR1A 1OVLA 1PDUA 4IU7A 3VT5A 5C4TA 2ZMHA 4NIEA 2AX9A 5B41A 2HBHA 3OLLA 5DWEA 5C4SA 4F9MA 5KCTA 3K8SA 5KYJA 3VRUA 2EWPA 5L7EA 1BSXA 2PIUA 5DUEA 4J26A 1XV9B 3ZRAA 3VT7A 2VSTA 5DZ3A 4ZNTA 2QABA 4UDDA 1S19A 5DP0A 2BJ4A 2XYXA 1XLSA 2QGWA 2ZXMA 4RZGA 5M96A 2P7ZA 4DMAA 1HG4A 3CJWA 4OKWA 3OMOA 1QKUA 3O1DA 4FGYA 1H9UA 5HYKA 5JJMB 4K6IA 4MGCA 4ITFA 3NSPA 4J5WA 4IWFA 2PNUA 4WPFA 3JZBA 2O4JA 1EXXA 5KRKA 1G5YA 1X7JA 4OIVA 5DKGA 3E00D 1XVPA 5L11A 3B5RA 2PIQA 5EHJA 1NQ2A 4MG8A 4E4QA 3W0JA 4A4VA 4EMAA 4MGDB 2YLOA 3CQVA 2AA2A 3F5CA 3R2AA 2J4AA 4OLMA 4R6SA 4TUZA 5FQPA 3VRWA 1I38A 2OVMA 3WJ4A 5LWPA 3R5NA 1YIMA 2PINA 3MNOA 5DTVA 1ERRA 2GL8A 3CDSA 4OK1A 3GWSX 5DXBB 5DXQA 5HJSA 4DOSA 3OGTA 1Y0XX 3FURA 3K23A 1OSHA 2QA8B 2AAXA 2Q3YA 3Q95A 5SYZA 4MG9B 3OAPA 5AYGA 1SJ0A 5DXEA 4CI5A 2AA7A 2PKLA 2Q7LA 2ZXNA 1RKGA 2IOKA 3IPQA 4L96A 4S0TA 4S15A 4WQPA 3P0UA 3ADXA 2VV2A 5EJVA 5FQTA 3W5QA 3ZQTA 4IQRA 2PITA 1DB1A 1FM9A 3W0YA 2HB7A 4XLDA 2VSRA 5DV3A 1IE9A 3B0RA 5E1CA 1YOWA 2AA5A 3VJSA 3V4AA 4OFRA 3A9EA 5E14A 4IWCA 3WT6A 4J5WC 1XP9A 4J24A 2HC4A 5DX3A 4N5GA 3V9VA 3VI8A 2AX6A 4OEZA 5DSHA 5DIGA 3P88A 5GIDA 2PIOA 4JAZA 2REWA 5DVVA 4OHAA 1R20D 2PIWA 2P4YA 1YP0A 2POGA 3RUTA 4MGBB 3WWRA 5L7GA 3S9SA 1UHLA 2Q6JA 3FALB 4IA7A 1XIUA 5AVIA 3AURA 2Q1VA 2ZNOA 3E94A 2Q61A 5E7VA 3OSIA 1G1UA 2ZK4A 3R29A 3KDUA 3RLLA 1DKFB 2VV0A 5KD9A 2R6YA 4ZN7A 4K4JA 1NAXA 3ZRBA 2Q59A 3UUCA 1NQ1A 1S9PA 3HC6A 5G44A 2GPUA 2P15A 3LBDA 3UUDB 4IVWA 3T03A 1U3SA 3CDPA 1T79A 5JI0D 3DZYD 4PPSA 2GPPA 2B23A 3TX7B 5DYDA 5E0XA 5AWJA 1S0ZA 2GPVA 2VV4B 3OZJA 3R5MA 5HCVA 4CI4A 1ZDUA 4IW8A 1U9EA 4KZJA 1K74D 1XQCA 1R6GA 1ZDTA 1RDTA 2JF9A 2Q7IA 2NW4A 2QH6A 2QSEA 3MNPA 4IW6A 1FM6A 1ZKYA 5AK2A 5KRIA 3PBAA 3VJHA 2R6WA 4IV4A 4XT9A 3D6DA 3W5TA 3CLDA 3E7CA 2J7YA 5DY8A 4YPQA 5DUHA 3D57A 5DL4A 5AAVB 4K7AA 3RLJA 1YINA 3H0AA 4E4KA 4M8EA 2XKWA 3SZ1A 4DQMA 3FEJA 4MGBA 3VTCA 2ZLCA 3G8IA 5KCEA 3DZUA 3GYUA 3BQDA 1G50A 2AYRA 3B68A 3L0EA 4R2UA 1X76A 3OKHA 4DK8A 3BEJA 3A2JA 4G1ZA 2G0HA 1R1KA 2ZFXA 4G2IA 4M8HA 4REFA 1HJ1A 2NXXE 2QXSA 1I7GA 4NY9A 4E2JA 2O4RA 1XDKB 1L2JA 4MGAB 3OSAA 4YMQA 4OJ4A 4QE6A 3IPUA 2YLQA 4FHIA 5DI7A 3W5RA 3L0JA 4G20A 4BCRA 1UPWA 2VV4A 4RFWA 5G45A 3R8DA 4N8RA 4POHA 4REEA 4Y29A 3DY6A 3VT8A 2J14A 5KCUA 3UU7B 5CJ6A 2JFAA 5APKA 4P6WA 3VHUA 1TXIA 3OOFA 4G1DA 4RUOX 5LGAA 3L1BA 5AAVA 1Z95A 3VN2A 4OGHA 3OMPA 4PWLA 2ZXZA 4OH6A 3W0CA 5AVLA 4CSJA 3P89A 3ADVA 3OSWA 5DXPA 3AUQA 4G21A 4MG6A 2QW4A 4JYHA 5DXGA 2ACLA 1YOKA 3RUUA 2I0JA 4Q0AC 3VT4A 4OKXA 5E0WA 4DM8A 4PLEA 1YMTA 3K22A 3D24A 3CS8A 5DZ0A 3VT6A 5HJPB 5DWLA 1XJ7A 1P8DA 3BC5A 5G42A 3O1EA 1ILHA 2Q5PA 2G44A 3FEIA 2QE4A 2Z4JA 3W0AA 5DXKA 4OILA 2VV1A 3OLFA 4XI3A 2HCDA 1ZGYA 2IHQA 1YY4A 5KCWA 3TKCA 5KRMA 5AWKA 3VRTA 1R5KA 3B67A 3V9TA 3AFRA 3KBAA 3P8XA 1XB7A 4ONIA 4G2HA 3V3QA 3R8IA 4L98A 2AXAA 3PLZA 2QGTA 1NHZA 1ILGA 3V3EA 4NQAB 2ZY0A 1XV9A 3RVFA 3M7RA 5APHA 2QA6A 2ZMIA 3A3ZX 2QPYA 1FM9D 4EM9A 2P54A 4RUJA 5FQSA 4RMDA 1K4WA 4IUIA 5G5WA 1RK3A 4XTAA 3QT0A 5DMCA 2OM9A 3X31A 5HZCA 2NXXA 5DWGA 5JJMA 3X1HA 3PRGA 3EYBA 1T7TA 3E00A 3OLSA 3OZ0A 4FN9A 3ADUA 5AAUA 3HM1A 1PRGA 3ZR7A 5GIEA 4IS8A 2AM9A 3WTQA 4JYGA 3VHVA 4ZNUA 2R40D 3FS1A 3PCUA 4KZIA 2P7AA 3G0WA 3B0TA 4X1GA 5A86A 2Q6RA 3OS9A 4OEAA 4OZRU 3AZ1A 3ERDA 1GWXA 4IA1A 1OT7A 1YYEA 3B0WA 5APJA 3UVVB 5DZIA 4MGDA 1MZNA 1L2IA 4ZNHA 4ZO1B 3VSPA 1NYXA 5DIDA 3ADSA 1FD0A 1YUCA 2I4JA 2HWRA 4PF3A 3L03A 4XAOA 3TKMA 4RAKA 2ZKCA 1NRLA 2E2RA 2Q60A 2YLPA 5DXBA 3DZYA 2FVJA 2ABIA 2QA8A 2ZVTA 2ZMJA 4MG9A 4OH5A 3AN4A 1NQ0A 1SQNA 2NPAA 3VT9A 2H79A 2Q5GA 3ET3A 2AO6A 1PK5A 3V49A 1KKQA 1ZUCA 4ZNWA 1NUOA 5GICA 4ZNVA 5DWJA 1NDEA 3PO9A 3CWDA 2FAIA 4OFUA 3IXPA 5DK9A 4ZJRA 1Y9RA 3OMQA 5DZHA 4FHHA 3VTDA 1ZEOA 1R20A 4LTWA 3HODA 5KROA 1A52A 5KRAA 5HYRA 3L3ZA 4UDCA 3UP3A 5KCDA 5EITA 5ETHA 3DCUA 3DZUD 2QZOB 4PP6A 2YLYA 4ZN9A 1XQ3A 4OZTU 2QNVA 3MNEA 3UVVA 3R8AA 3OMKA 4JYIA 1X7RA 3FC6B 2YFEA 3HO0A 5DZ1A 1Z5XU 1QKTA 1X7BA 3FALA 5K13A 3KWYA 2AWHA 1M7WA 1PCGA 4O8FA 1GWRA 3OMMA 2XHSA 1T63A 5DXMA 4YNKA 2B50A 3OOKA 2YATA 4J5XA 4TV1B 3HZFA 2Q6SA 3AZ2A 1DKFA 1OVLB 1YA3A 2PIPL 3AX8A 2OAXA 2P7GA 1UOMA 4FNEA 2OUZA 3RY9A 3AZ3A 3FXVA 1I7IA 3W0GA 1E3KA 1EREA 2HFPA 3GBKA 2HAMA 5AZTA 4UDAA 2B1ZA 4OEDA 2ZK0A 1KNUA 3NOAA 1T76A 2PRGA 4LNWA 3A40X 4RE8A 5DV8A 3VRVA 3X1IA 3AN3A 1MV9A 3SP6A 1T7MA 5DV6A 3LMPA 1S0XA 2BJ4B 1QKMA 1S9QA 2QMVA 4OARA 3CTBA 2AMBA 4OZTE 1LBDA 5H1EA 3W0HA 4DM6A 5KRHA 1IE8A 2AMAA 1X7EA 3D90A 3G8OA 2W8YA 1Z5XE 3D5FA 3UUAB 2Q7JA 4LBDA 2F4BA 4ITEA 3WFGA 2GP7A 4WHGA 2Q5SA 3FC6A 4DORA 2G0GA 3HLVA 5DXRA 4DK7A 2ZL9A 1N83A 4OC7A
chains in the Genus database with same CATH superfamily
1QKNA 1VJBA 1WM0X 3K6PA 1XVPB 3KPZA 4JL4A 4IVYA 4MDDA 4MG8B 2GTKA 2ZNNA 3ET2A 4OKBA 2YJDA 4WHFA 2AB2A 1SR7A 4J5XC 1RJKA 1NAVA 3F5CB 4R06A 2ZK5A 1XNXA 2ZNQA 4OIUA 2Q70A 4RWVA 4TUZB 5EGVA 1U3QA 5G46A 2OZ7A 3VTBA 2ZASA 3NSQA 1XDKA 3WMHA 4MGAA 3B3KA 4XUMA 2G5OA 4RZEA 1T7RA 3HQ5A 2A3IA 3VJIA 4HEEX 5DMFA 2GIUA 3Q95B 3ET1A 1Q4XA 2OCFA 3OS8A 1A28A 3KFCA 1KV6A 5DKEA 3A78A 2ZBSA 5ACCA 3GZ9A 4OJ9A 3UU7A 1MVCA 2I4ZA 4IA2A 2BAWA 3WT5A 1XP1A 2P1UA 3UUAA 3CS6A 2PIRA 1N46A 1LV2A 1PZLA 3WFFA 1ZH7A 1GS4A 4WVDA 5IAWA 3A9EB 2AX7A 4X1FA 1T5ZA 5DX3B 4ZNSA 3GWXA 3HVLA 4ZO1X 2J7XA 3GYTA 1M13A 2HVCA 4QL8A 1TFCA 1G2NA 5DRJA 5DYBA 5E19A 3VSOA 3WT7A 3IMYA 4QE8A 1PQ6A 2FSZA 3AUNA 3JZCA 5DVSA 2XYWA 3TY0A 1GWQA 5B5BA 5HJPA 2PIVA 1RKHA 2H77A 2O9IA 5EC9A 3UUDA 2ZK6A 1UHLB 4QK4A 5KYAA 1U3RA 3KMRA 3KYTA 1XPCA 3ILZA 5F9BA 1XP6A 5DVCA 5G3JA 4RMCA 2NV7A 1T73A 3N00A 2V7CA 2GWXA 4UDBA 3A2IA 2Q59B 3ADWA 5DKSA 2QR9A 2AX8A 4PP5A 1NQ7A 3OS8C 3VT3A 3WGPA 3W5PA 3PEQA 3F7DA 3B0QA 3G9EA 4QJRA 5DRMA 2ZNPA 5C4OA 3W0IA 2HARA 3DT3A 1FCZA 4JGVA 5IZ0A 5C4UA 5EI1A 5KCCA 4Q13A 5DUGA 1ZAFA 5DWIA 5FQVA 3HC5A 4POJA 4ZJWA 1PQ9A 4NUFA 2QXMA 1YJEA 3IXPD 1M2ZA 2P1TA 5DKBA 3IPSA 4S14A 3WJ5A 4MG7B 2R40A 2HB8A 2ZK3A 2LBDA 2OVHA 1RDTD 5DLRA 4A4WA 1FM6D 3VHWA 2PIXA 4N1YA 5L7HA 1SKXA 4OZRE 2YHDA 4QM0A 2ZK1A 1XLSE 5GT4A 3GD2A 3H0AD 3ERTA 2ZK2A 4ZOMA 5KRLA 1UPVA 2I4PA 4PVUA 4RMEA 4ZI1A 4OJBA 4S0SA 2YJAB 4HLWA 2VV3A 1FBYA 5KRFA 2ATHA 3FUGA 3KMZA 1R1KD 2AA6A 4LSJA 1XNNA 5AZVA 4MG5A 5FQRA 1T7FA 1Y0SA 1E3GA 4P6XA 4LNXA 2P1VA 2Q7KA 2POBA 2JJ3A 3V9YA 4PP3A 4KZMA 4XUHA 2HWQA 1K7LA 2Q8SA 1EXAA 2XYJA 2ZLAA 3FLIA 3KDTA 3CS4A 1P93A 5IXKA 3H52A 2JFAB 1I37A 2PJLA 1N4HA 1K74A 4MG7A 3B65A 4IV2A 4N73A 4NB6A 1XOWA 4WLBA 1T74A 5I4VA 4PXMA 5G43A 3U9QA 3SP9A 4RUPA 4G1YA 3L3XA 2B1VA 1FCXA 3B1MA 4PRGA 1XZXX 2QTUA 4B7WA 5JY3A 2HASA 2ACLB 2I0GA 2Z4BA 4IA3A 1X78A 5E15A 5KRCA 3UP0A 1OSVA 2IOGA 3X36A 2Q1HA 3DCTA 4XHDA 1FCYA 4A2JA 4RZFA 5ICKA 5DU5A 4OKTA 2QZOA 5KCFA 3IA6A 4OEYA 3B66A 3OKIA 3KMGA 1PQCA 4Q50A 3VJTA 5DIEA 4YT1A 1T65A 3GN8A 3L0LA 3A2HA 4APUA 2VV1B 2V0VA 1XAPA 5KR9A 3ADTA 4TV1A 4PLDA 3ET0A 4PPPA 5KRJA 2GPOA 3DR1A 1OVLA 1PDUA 4IU7A 3VT5A 5C4TA 2ZMHA 4NIEA 2AX9A 5B41A 2HBHA 3OLLA 5DWEA 5C4SA 4F9MA 5KCTA 3K8SA 5KYJA 3VRUA 2EWPA 5L7EA 1BSXA 2PIUA 5DUEA 4J26A 1XV9B 3ZRAA 3VT7A 2VSTA 5DZ3A 4ZNTA 2QABA 4UDDA 1S19A 5DP0A 2BJ4A 2XYXA 1XLSA 2QGWA 2ZXMA 4RZGA 5M96A 2P7ZA 4DMAA 1HG4A 3CJWA 4OKWA 3OMOA 1QKUA 3O1DA 4FGYA 1H9UA 5HYKA 5JJMB 4K6IA 4MGCA 4ITFA 3NSPA 4J5WA 4IWFA 2PNUA 4WPFA 3JZBA 2O4JA 1EXXA 5KRKA 1G5YA 1X7JA 4OIVA 5DKGA 3E00D 1XVPA 5L11A 3B5RA 2PIQA 5EHJA 1NQ2A 4MG8A 4E4QA 3W0JA 4A4VA 4EMAA 4MGDB 2YLOA 3CQVA 2AA2A 3F5CA 3R2AA 2J4AA 4OLMA 4R6SA 4TUZA 5FQPA 3VRWA 1I38A 2OVMA 3WJ4A 5LWPA 3R5NA 1YIMA 2PINA 3MNOA 5DTVA 1ERRA 2GL8A 3CDSA 4OK1A 3GWSX 5DXBB 5DXQA 5HJSA 4DOSA 3OGTA 1Y0XX 3FURA 3K23A 1OSHA 2QA8B 2AAXA 2Q3YA 3Q95A 5SYZA 4MG9B 3OAPA 5AYGA 1SJ0A 5DXEA 4CI5A 2AA7A 2PKLA 2Q7LA 2ZXNA 1RKGA 2IOKA 3IPQA 4L96A 4S0TA 4S15A 4WQPA 3P0UA 3ADXA 2VV2A 5EJVA 5FQTA 3W5QA 3ZQTA 4IQRA 2PITA 1DB1A 1FM9A 3W0YA 2HB7A 4XLDA 2VSRA 5DV3A 1IE9A 3B0RA 5E1CA 1YOWA 2AA5A 3VJSA 3V4AA 4OFRA 3A9EA 5E14A 4IWCA 3WT6A 4J5WC 1XP9A 4J24A 2HC4A 5DX3A 4N5GA 3V9VA 3VI8A 2AX6A 4OEZA 5DSHA 5DIGA 3P88A 5GIDA 2PIOA 4JAZA 2REWA 5DVVA 4OHAA 1R20D 2PIWA 2P4YA 1YP0A 2POGA 3RUTA 4MGBB 3WWRA 5L7GA 3S9SA 1UHLA 2Q6JA 3FALB 4IA7A 1XIUA 5AVIA 3AURA 2Q1VA 2ZNOA 3E94A 2Q61A 5E7VA 3OSIA 1G1UA 2ZK4A 3R29A 3KDUA 3RLLA 1DKFB 2VV0A 5KD9A 2R6YA 4ZN7A 4K4JA 1NAXA 3ZRBA 2Q59A 3UUCA 1NQ1A 1S9PA 3HC6A 5G44A 2GPUA 2P15A 3LBDA 3UUDB 4IVWA 3T03A 1U3SA 3CDPA 1T79A 5JI0D 3DZYD 4PPSA 2GPPA 2B23A 3TX7B 5DYDA 5E0XA 5AWJA 1S0ZA 2GPVA 2VV4B 3OZJA 3R5MA 5HCVA 4CI4A 1ZDUA 4IW8A 1U9EA 4KZJA 1K74D 1XQCA 1R6GA 1ZDTA 1RDTA 2JF9A 2Q7IA 2NW4A 2QH6A 2QSEA 3MNPA 4IW6A 1FM6A 1ZKYA 5AK2A 5KRIA 3PBAA 3VJHA 2R6WA 4IV4A 4XT9A 3D6DA 3W5TA 3CLDA 3E7CA 2J7YA 5DY8A 4YPQA 5DUHA 3D57A 5DL4A 5AAVB 4K7AA 3RLJA 1YINA 3H0AA 4E4KA 4M8EA 2XKWA 3SZ1A 4DQMA 3FEJA 4MGBA 3VTCA 2ZLCA 3G8IA 5KCEA 3DZUA 3GYUA 3BQDA 1G50A 2AYRA 3B68A 3L0EA 4R2UA 1X76A 3OKHA 4DK8A 3BEJA 3A2JA 4G1ZA 2G0HA 1R1KA 2ZFXA 4G2IA 4M8HA 4REFA 1HJ1A 2NXXE 2QXSA 1I7GA 4NY9A 4E2JA 2O4RA 1XDKB 1L2JA 4MGAB 3OSAA 4YMQA 4OJ4A 4QE6A 3IPUA 2YLQA 4FHIA 5DI7A 3W5RA 3L0JA 4G20A 4BCRA 1UPWA 2VV4A 4RFWA 5G45A 3R8DA 4N8RA 4POHA 4REEA 4Y29A 3DY6A 3VT8A 2J14A 5KCUA 3UU7B 5CJ6A 2JFAA 5APKA 4P6WA 3VHUA 1TXIA 3OOFA 4G1DA 4RUOX 5LGAA 3L1BA 5AAVA 1Z95A 3VN2A 4OGHA 3OMPA 4PWLA 2ZXZA 4OH6A 3W0CA 5AVLA 4CSJA 3P89A 3ADVA 3OSWA 5DXPA 3AUQA 4G21A 4MG6A 2QW4A 4JYHA 5DXGA 2ACLA 1YOKA 3RUUA 2I0JA 4Q0AC 3VT4A 4OKXA 5E0WA 4DM8A 4PLEA 1YMTA 3K22A 3D24A 3CS8A 5DZ0A 3VT6A 5HJPB 5DWLA 1XJ7A 1P8DA 3BC5A 5G42A 3O1EA 1ILHA 2Q5PA 2G44A 3FEIA 2QE4A 2Z4JA 3W0AA 5DXKA 4OILA 2VV1A 3OLFA 4XI3A 2HCDA 1ZGYA 2IHQA 1YY4A 5KCWA 3TKCA 5KRMA 5AWKA 3VRTA 1R5KA 3B67A 3V9TA 3AFRA 3KBAA 3P8XA 1XB7A 4ONIA 4G2HA 3V3QA 3R8IA 4L98A 2AXAA 3PLZA 2QGTA 1NHZA 1ILGA 3V3EA 4NQAB 2ZY0A 1XV9A 3RVFA 3M7RA 5APHA 2QA6A 2ZMIA 3A3ZX 2QPYA 1FM9D 4EM9A 2P54A 4RUJA 5FQSA 4RMDA 1K4WA 4IUIA 5G5WA 1RK3A 4XTAA 3QT0A 5DMCA 2OM9A 3X31A 5HZCA 2NXXA 5DWGA 5JJMA 3X1HA 3PRGA 3EYBA 1T7TA 3E00A 3OLSA 3OZ0A 4FN9A 3ADUA 5AAUA 3HM1A 1PRGA 3ZR7A 5GIEA 4IS8A 2AM9A 3WTQA 4JYGA 3VHVA 4ZNUA 2R40D 3FS1A 3PCUA 4KZIA 2P7AA 3G0WA 3B0TA 4X1GA 5A86A 2Q6RA 3OS9A 4OEAA 4OZRU 3AZ1A 3ERDA 1GWXA 4IA1A 1OT7A 1YYEA 3B0WA 5APJA 3UVVB 5DZIA 4MGDA 1MZNA 1L2IA 4ZNHA 4ZO1B 3VSPA 1NYXA 5DIDA 3ADSA 1FD0A 1YUCA 2I4JA 2HWRA 4PF3A 3L03A 4XAOA 3TKMA 4RAKA 2ZKCA 1NRLA 2E2RA 2Q60A 2YLPA 5DXBA 3DZYA 2FVJA 2ABIA 2QA8A 2ZVTA 2ZMJA 4MG9A 4OH5A 3AN4A 1NQ0A 1SQNA 2NPAA 3VT9A 2H79A 2Q5GA 3ET3A 2AO6A 1PK5A 3V49A 1KKQA 1ZUCA 4ZNWA 1NUOA 5GICA 4ZNVA 5DWJA 1NDEA 3PO9A 3CWDA 2FAIA 4OFUA 3IXPA 5DK9A 4ZJRA 1Y9RA 3OMQA 5DZHA 4FHHA 3VTDA 1ZEOA 1R20A 4LTWA 3HODA 5KROA 1A52A 5KRAA 5HYRA 3L3ZA 4UDCA 3UP3A 5KCDA 5EITA 5ETHA 3DCUA 3DZUD 2QZOB 4PP6A 2YLYA 4ZN9A 1XQ3A 4OZTU 2QNVA 3MNEA 3UVVA 3R8AA 3OMKA 4JYIA 1X7RA 3FC6B 2YFEA 3HO0A 5DZ1A 1Z5XU 1QKTA 1X7BA 3FALA 5K13A 3KWYA 2AWHA 1M7WA 1PCGA 4O8FA 1GWRA 3OMMA 2XHSA 1T63A 5DXMA 4YNKA 2B50A 3OOKA 2YATA 4J5XA 4TV1B 3HZFA 2Q6SA 3AZ2A 1DKFA 1OVLB 1YA3A 2PIPL 3AX8A 2OAXA 2P7GA 1UOMA 4FNEA 2OUZA 3RY9A 3AZ3A 3FXVA 1I7IA 3W0GA 1E3KA 1EREA 2HFPA 3GBKA 2HAMA 5AZTA 4UDAA 2B1ZA 4OEDA 2ZK0A 1KNUA 3NOAA 1T76A 2PRGA 4LNWA 3A40X 4RE8A 5DV8A 3VRVA 3X1IA 3AN3A 1MV9A 3SP6A 1T7MA 5DV6A 3LMPA 1S0XA 2BJ4B 1QKMA 1S9QA 2QMVA 4OARA 3CTBA 2AMBA 4OZTE 1LBDA 5H1EA 3W0HA 4DM6A 5KRHA 1IE8A 2AMAA 1X7EA 3D90A 3G8OA 2W8YA 1Z5XE 3D5FA 3UUAB 2Q7JA 4LBDA 2F4BA 4ITEA 3WFGA 2GP7A 4WHGA 2Q5SA 3FC6A 4DORA 2G0GA 3HLVA 5DXRA 4DK7A 2ZL9A 1N83A 4OC7A
chains in the Genus database with same CATH topology
1QKNA 1VJBA 1WM0X 3K6PA 1XVPB 3KPZA 4JL4A 4IVYA 4MDDA 4MG8B 2GTKA 2ZNNA 3ET2A 4OKBA 2YJDA 4WHFA 2AB2A 1SR7A 4J5XC 1RJKA 1NAVA 3F5CB 4R06A 2ZK5A 1XNXA 2ZNQA 4OIUA 2Q70A 4RWVA 4TUZB 5EGVA 1U3QA 5G46A 2OZ7A 3VTBA 2ZASA 3NSQA 1XDKA 3WMHA 4MGAA 3B3KA 4XUMA 2G5OA 4RZEA 1T7RA 3HQ5A 2A3IA 3VJIA 4HEEX 5DMFA 2GIUA 3Q95B 3ET1A 1Q4XA 2OCFA 3OS8A 1A28A 3KFCA 1KV6A 5DKEA 3A78A 2ZBSA 5ACCA 3GZ9A 4OJ9A 3UU7A 1MVCA 2I4ZA 4IA2A 2BAWA 3WT5A 1XP1A 2P1UA 3UUAA 3CS6A 2PIRA 1N46A 1LV2A 1PZLA 3WFFA 1ZH7A 1GS4A 4WVDA 5IAWA 3A9EB 2AX7A 4X1FA 1T5ZA 5DX3B 4ZNSA 3GWXA 3HVLA 4ZO1X 2J7XA 3GYTA 1M13A 2HVCA 4QL8A 1TFCA 1G2NA 5DRJA 5DYBA 5E19A 3VSOA 3WT7A 3IMYA 4QE8A 1PQ6A 2FSZA 3AUNA 3JZCA 5DVSA 2XYWA 3TY0A 1GWQA 5B5BA 5HJPA 2PIVA 1RKHA 2H77A 2O9IA 5EC9A 3UUDA 2ZK6A 1UHLB 4QK4A 5KYAA 1U3RA 3KMRA 3KYTA 1XPCA 3ILZA 5F9BA 1XP6A 5DVCA 5G3JA 4RMCA 2NV7A 1T73A 3N00A 2V7CA 2GWXA 4UDBA 3A2IA 2Q59B 3ADWA 5DKSA 2QR9A 2AX8A 4PP5A 1NQ7A 3OS8C 3VT3A 3WGPA 3W5PA 3PEQA 3F7DA 3B0QA 3G9EA 4QJRA 5DRMA 2ZNPA 5C4OA 3W0IA 2HARA 3DT3A 1FCZA 4JGVA 5IZ0A 5C4UA 5EI1A 5KCCA 4Q13A 5DUGA 1ZAFA 5DWIA 5FQVA 3HC5A 4POJA 4ZJWA 1PQ9A 4NUFA 2QXMA 1YJEA 3IXPD 1M2ZA 2P1TA 5DKBA 3IPSA 4S14A 3WJ5A 4MG7B 2R40A 2HB8A 2ZK3A 2LBDA 2OVHA 1RDTD 5DLRA 4A4WA 1FM6D 3VHWA 2PIXA 4N1YA 5L7HA 1SKXA 4OZRE 2YHDA 4QM0A 2ZK1A 1XLSE 5GT4A 3GD2A 3H0AD 3ERTA 2ZK2A 4ZOMA 5KRLA 1UPVA 2I4PA 4PVUA 4RMEA 4ZI1A 4OJBA 4S0SA 2YJAB 4HLWA 2VV3A 1FBYA 5KRFA 2ATHA 3FUGA 3KMZA 1R1KD 2AA6A 4LSJA 1XNNA 5AZVA 4MG5A 5FQRA 1T7FA 1Y0SA 1E3GA 4P6XA 4LNXA 2P1VA 2Q7KA 2POBA 2JJ3A 3V9YA 4PP3A 4KZMA 4XUHA 2HWQA 1K7LA 2Q8SA 1EXAA 2XYJA 2ZLAA 3FLIA 3KDTA 3CS4A 1P93A 5IXKA 3H52A 2JFAB 1I37A 2PJLA 1N4HA 1K74A 4MG7A 3B65A 4IV2A 4N73A 4NB6A 1XOWA 4WLBA 1T74A 5I4VA 4PXMA 5G43A 3U9QA 3SP9A 4RUPA 4G1YA 3L3XA 2B1VA 1FCXA 3B1MA 4PRGA 1XZXX 2QTUA 4B7WA 5JY3A 2HASA 2ACLB 2I0GA 2Z4BA 4IA3A 1X78A 5E15A 5KRCA 3UP0A 1OSVA 2IOGA 3X36A 2Q1HA 3DCTA 4XHDA 1FCYA 4A2JA 4RZFA 5ICKA 5DU5A 4OKTA 2QZOA 5KCFA 3IA6A 4OEYA 3B66A 3OKIA 3KMGA 1PQCA 4Q50A 3VJTA 5DIEA 4YT1A 1T65A 3GN8A 3L0LA 3A2HA 4APUA 2VV1B 2V0VA 1XAPA 5KR9A 3ADTA 4TV1A 4PLDA 3ET0A 4PPPA 5KRJA 2GPOA 3DR1A 1OVLA 1PDUA 4IU7A 3VT5A 5C4TA 2ZMHA 4NIEA 2AX9A 5B41A 2HBHA 3OLLA 5DWEA 5C4SA 4F9MA 5KCTA 3K8SA 5KYJA 3VRUA 2EWPA 5L7EA 1BSXA 2PIUA 5DUEA 4J26A 1XV9B 3ZRAA 3VT7A 2VSTA 5DZ3A 4ZNTA 2QABA 4UDDA 1S19A 5DP0A 2BJ4A 2XYXA 1XLSA 2QGWA 2ZXMA 4RZGA 5M96A 2P7ZA 4DMAA 1HG4A 3CJWA 4OKWA 3OMOA 1QKUA 3O1DA 4FGYA 1H9UA 5HYKA 5JJMB 4K6IA 4MGCA 4ITFA 3NSPA 4J5WA 4IWFA 2PNUA 4WPFA 3JZBA 2O4JA 1EXXA 5KRKA 1G5YA 1X7JA 4OIVA 5DKGA 3E00D 1XVPA 5L11A 3B5RA 2PIQA 5EHJA 1NQ2A 4MG8A 4E4QA 3W0JA 4A4VA 4EMAA 4MGDB 2YLOA 3CQVA 2AA2A 3F5CA 3R2AA 2J4AA 4OLMA 4R6SA 4TUZA 5FQPA 3VRWA 1I38A 2OVMA 3WJ4A 5LWPA 3R5NA 1YIMA 2PINA 3MNOA 5DTVA 1ERRA 2GL8A 3CDSA 4OK1A 3GWSX 5DXBB 5DXQA 5HJSA 4DOSA 3OGTA 1Y0XX 3FURA 3K23A 1OSHA 2QA8B 2AAXA 2Q3YA 3Q95A 5SYZA 4MG9B 3OAPA 5AYGA 1SJ0A 5DXEA 4CI5A 2AA7A 2PKLA 2Q7LA 2ZXNA 1RKGA 2IOKA 3IPQA 4L96A 4S0TA 4S15A 4WQPA 3P0UA 3ADXA 2VV2A 5EJVA 5FQTA 3W5QA 3ZQTA 4IQRA 2PITA 1DB1A 1FM9A 3W0YA 2HB7A 4XLDA 2VSRA 5DV3A 1IE9A 3B0RA 5E1CA 1YOWA 2AA5A 3VJSA 3V4AA 4OFRA 3A9EA 5E14A 4IWCA 3WT6A 4J5WC 1XP9A 4J24A 2HC4A 5DX3A 4N5GA 3V9VA 3VI8A 2AX6A 4OEZA 5DSHA 5DIGA 3P88A 5GIDA 2PIOA 4JAZA 2REWA 5DVVA 4OHAA 1R20D 2PIWA 2P4YA 1YP0A 2POGA 3RUTA 4MGBB 3WWRA 5L7GA 3S9SA 1UHLA 2Q6JA 3FALB 4IA7A 1XIUA 5AVIA 3AURA 2Q1VA 2ZNOA 3E94A 2Q61A 5E7VA 3OSIA 1G1UA 2ZK4A 3R29A 3KDUA 3RLLA 1DKFB 2VV0A 5KD9A 2R6YA 4ZN7A 4K4JA 1NAXA 3ZRBA 2Q59A 3UUCA 1NQ1A 1S9PA 3HC6A 5G44A 2GPUA 2P15A 3LBDA 3UUDB 4IVWA 3T03A 1U3SA 3CDPA 1T79A 5JI0D 3DZYD 4PPSA 2GPPA 2B23A 3TX7B 5DYDA 5E0XA 5AWJA 1S0ZA 2GPVA 2VV4B 3OZJA 3R5MA 5HCVA 4CI4A 1ZDUA 4IW8A 1U9EA 4KZJA 1K74D 1XQCA 1R6GA 1ZDTA 1RDTA 2JF9A 2Q7IA 2NW4A 2QH6A 2QSEA 3MNPA 4IW6A 1FM6A 1ZKYA 5AK2A 5KRIA 3PBAA 3VJHA 2R6WA 4IV4A 4XT9A 3D6DA 3W5TA 3CLDA 3E7CA 2J7YA 5DY8A 4YPQA 5DUHA 3D57A 5DL4A 5AAVB 4K7AA 3RLJA 1YINA 3H0AA 4E4KA 4M8EA 2XKWA 3SZ1A 4DQMA 3FEJA 4MGBA 3VTCA 2ZLCA 3G8IA 5KCEA 3DZUA 3GYUA 3BQDA 1G50A 2AYRA 3B68A 3L0EA 4R2UA 1X76A 3OKHA 4DK8A 3BEJA 3A2JA 4G1ZA 2G0HA 1R1KA 2ZFXA 4G2IA 4M8HA 4REFA 1HJ1A 2NXXE 2QXSA 1I7GA 4NY9A 4E2JA 2O4RA 1XDKB 1L2JA 4MGAB 3OSAA 4YMQA 4OJ4A 4QE6A 3IPUA 2YLQA 4FHIA 5DI7A 3W5RA 3L0JA 4G20A 4BCRA 1UPWA 2VV4A 4RFWA 5G45A 3R8DA 4N8RA 4POHA 4REEA 4Y29A 3DY6A 3VT8A 2J14A 5KCUA 3UU7B 5CJ6A 2JFAA 5APKA 4P6WA 3VHUA 1TXIA 3OOFA 4G1DA 4RUOX 5LGAA 3L1BA 5AAVA 1Z95A 3VN2A 4OGHA 3OMPA 4PWLA 2ZXZA 4OH6A 3W0CA 5AVLA 4CSJA 3P89A 3ADVA 3OSWA 5DXPA 3AUQA 4G21A 4MG6A 2QW4A 4JYHA 5DXGA 2ACLA 1YOKA 3RUUA 2I0JA 4Q0AC 3VT4A 4OKXA 5E0WA 4DM8A 4PLEA 1YMTA 3K22A 3D24A 3CS8A 5DZ0A 3VT6A 5HJPB 5DWLA 1XJ7A 1P8DA 3BC5A 5G42A 3O1EA 1ILHA 2Q5PA 2G44A 3FEIA 2QE4A 2Z4JA 3W0AA 5DXKA 4OILA 2VV1A 3OLFA 4XI3A 2HCDA 1ZGYA 2IHQA 1YY4A 5KCWA 3TKCA 5KRMA 5AWKA 3VRTA 1R5KA 3B67A 3V9TA 3AFRA 3KBAA 3P8XA 1XB7A 4ONIA 4G2HA 3V3QA 3R8IA 4L98A 2AXAA 3PLZA 2QGTA 1NHZA 1ILGA 3V3EA 4NQAB 2ZY0A 1XV9A 3RVFA 3M7RA 5APHA 2QA6A 2ZMIA 3A3ZX 2QPYA 1FM9D 4EM9A 2P54A 4RUJA 5FQSA 4RMDA 1K4WA 4IUIA 5G5WA 1RK3A 4XTAA 3QT0A 5DMCA 2OM9A 3X31A 5HZCA 2NXXA 5DWGA 5JJMA 3X1HA 3PRGA 3EYBA 1T7TA 3E00A 3OLSA 3OZ0A 4FN9A 3ADUA 5AAUA 3HM1A 1PRGA 3ZR7A 5GIEA 4IS8A 2AM9A 3WTQA 4JYGA 3VHVA 4ZNUA 2R40D 3FS1A 3PCUA 4KZIA 2P7AA 3G0WA 3B0TA 4X1GA 5A86A 2Q6RA 3OS9A 4OEAA 4OZRU 3AZ1A 3ERDA 1GWXA 4IA1A 1OT7A 1YYEA 3B0WA 5APJA 3UVVB 5DZIA 4MGDA 1MZNA 1L2IA 4ZNHA 4ZO1B 3VSPA 1NYXA 5DIDA 3ADSA 1FD0A 1YUCA 2I4JA 2HWRA 4PF3A 3L03A 4XAOA 3TKMA 4RAKA 2ZKCA 1NRLA 2E2RA 2Q60A 2YLPA 5DXBA 3DZYA 2FVJA 2ABIA 2QA8A 2ZVTA 2ZMJA 4MG9A 4OH5A 3AN4A 1NQ0A 1SQNA 2NPAA 3VT9A 2H79A 2Q5GA 3ET3A 2AO6A 1PK5A 3V49A 1KKQA 1ZUCA 4ZNWA 1NUOA 5GICA 4ZNVA 5DWJA 1NDEA 3PO9A 3CWDA 2FAIA 4OFUA 3IXPA 5DK9A 4ZJRA 1Y9RA 3OMQA 5DZHA 4FHHA 3VTDA 1ZEOA 1R20A 4LTWA 3HODA 5KROA 1A52A 5KRAA 5HYRA 3L3ZA 4UDCA 3UP3A 5KCDA 5EITA 5ETHA 3DCUA 3DZUD 2QZOB 4PP6A 2YLYA 4ZN9A 1XQ3A 4OZTU 2QNVA 3MNEA 3UVVA 3R8AA 3OMKA 4JYIA 1X7RA 3FC6B 2YFEA 3HO0A 5DZ1A 1Z5XU 1QKTA 1X7BA 3FALA 5K13A 3KWYA 2AWHA 1M7WA 1PCGA 4O8FA 1GWRA 3OMMA 2XHSA 1T63A 5DXMA 4YNKA 2B50A 3OOKA 2YATA 4J5XA 4TV1B 3HZFA 2Q6SA 3AZ2A 1DKFA 1OVLB 1YA3A 2PIPL 3AX8A 2OAXA 2P7GA 1UOMA 4FNEA 2OUZA 3RY9A 3AZ3A 3FXVA 1I7IA 3W0GA 1E3KA 1EREA 2HFPA 3GBKA 2HAMA 5AZTA 4UDAA 2B1ZA 4OEDA 2ZK0A 1KNUA 3NOAA 1T76A 2PRGA 4LNWA 3A40X 4RE8A 5DV8A 3VRVA 3X1IA 3AN3A 1MV9A 3SP6A 1T7MA 5DV6A 3LMPA 1S0XA 2BJ4B 1QKMA 1S9QA 2QMVA 4OARA 3CTBA 2AMBA 4OZTE 1LBDA 5H1EA 3W0HA 4DM6A 5KRHA 1IE8A 2AMAA 1X7EA 3D90A 3G8OA 2W8YA 1Z5XE 3D5FA 3UUAB 2Q7JA 4LBDA 2F4BA 4ITEA 3WFGA 2GP7A 4WHGA 2Q5SA 3FC6A 4DORA 2G0GA 3HLVA 5DXRA 4DK7A 2ZL9A 1N83A 4OC7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QKN A;  1VJB A;  1WM0 X;  3K6P A;  1XVP B;  3KPZ A;  4JL4 A;  4IVY A;  4MDD A;  4MG8 B;  2GTK A;  2ZNN A;  3ET2 A;  4OKB A;  2YJD A;  4WHF A;  2AB2 A;  1SR7 A;  4J5X C;  1RJK A;  1NAV A;  3F5C B;  4R06 A;  2ZK5 A;  1XNX A;  2ZNQ A;  4OIU A;  2Q70 A;  4RWV A;  4TUZ B;  5EGV A;  1U3Q A;  5G46 A;  2OZ7 A;  3VTB A;  2ZAS A;  3NSQ A;  1XDK A;  3WMH A;  4MGA A;  3B3K A;  4XUM A;  2G5O A;  4RZE A;  1T7R A;  3HQ5 A;  2A3I A;  3VJI A;  4HEE X;  5DMF A;  2GIU A;  3Q95 B;  3ET1 A;  1Q4X A;  2OCF A;  3OS8 A;  1A28 A;  3KFC A;  1KV6 A;  5DKE A;  3A78 A;  2ZBS A;  5ACC A;  3GZ9 A;  4OJ9 A;  3UU7 A;  1MVC A;  2I4Z A;  4IA2 A;  2BAW A;  3WT5 A;  1XP1 A;  2P1U A;  3UUA A;  3CS6 A;  2PIR A;  1N46 A;  1LV2 A;  1PZL A;  3WFF A;  1ZH7 A;  1GS4 A;  4WVD A;  5IAW A;  3A9E B;  2AX7 A;  4X1F A;  1T5Z A;  5DX3 B;  4ZNS A;  3GWX A;  3HVL A;  4ZO1 X;  2J7X A;  3GYT A;  1M13 A;  2HVC A;  4QL8 A;  1TFC A;  1G2N A;  5DRJ A;  5DYB A;  5E19 A;  3VSO A;  3WT7 A;  3IMY A;  4QE8 A;  1PQ6 A;  2FSZ A;  3AUN A;  3JZC A;  5DVS A;  2XYW A;  3TY0 A;  1GWQ A;  5B5B A;  5HJP A;  2PIV A;  1RKH A;  2H77 A;  2O9I A;  5EC9 A;  3UUD A;  2ZK6 A;  1UHL B;  4QK4 A;  5KYA A;  1U3R A;  3KMR A;  3KYT A;  1XPC A;  3ILZ A;  5F9B A;  1XP6 A;  5DVC A;  5G3J A;  4RMC A;  2NV7 A;  1T73 A;  3N00 A;  2V7C A;  2GWX A;  4UDB A;  3A2I A;  2Q59 B;  3ADW A;  5DKS A;  2QR9 A;  2AX8 A;  4PP5 A;  1NQ7 A;  3OS8 C;  3VT3 A;  3WGP A;  3W5P A;  3PEQ A;  3F7D A;  3B0Q A;  3G9E A;  4QJR A;  5DRM A;  2ZNP A;  5C4O A;  3W0I A;  2HAR A;  3DT3 A;  1FCZ A;  4JGV A;  5IZ0 A;  5C4U A;  5EI1 A;  5KCC A;  4Q13 A;  5DUG A;  1ZAF A;  5DWI A;  5FQV A;  3HC5 A;  4POJ A;  4ZJW A;  1PQ9 A;  4NUF A;  2QXM A;  1YJE A;  3IXP D;  1M2Z A;  2P1T A;  5DKB A;  3IPS A;  4S14 A;  3WJ5 A;  4MG7 B;  2R40 A;  2HB8 A;  2ZK3 A;  2LBD A;  2OVH A;  1RDT D;  5DLR A;  4A4W A;  1FM6 D;  3VHW A;  2PIX A;  4N1Y A;  5L7H A;  1SKX A;  4OZR E;  2YHD A;  4QM0 A;  2ZK1 A;  1XLS E;  5GT4 A;  3GD2 A;  3H0A D;  3ERT A;  2ZK2 A;  4ZOM A;  5KRL A;  1UPV A;  2I4P A;  4PVU A;  4RME A;  4ZI1 A;  4OJB A;  4S0S A;  2YJA B;  4HLW A;  2VV3 A;  1FBY A;  5KRF A;  2ATH A;  3FUG A;  3KMZ A;  1R1K D;  2AA6 A;  4LSJ A;  1XNN A;  5AZV A;  4MG5 A;  5FQR A;  1T7F A;  1Y0S A;  1E3G A;  4P6X A;  4LNX A;  2P1V A;  2Q7K A;  2POB A;  2JJ3 A;  3V9Y A;  4PP3 A;  4KZM A;  4XUH A;  2HWQ A;  1K7L A;  2Q8S A;  1EXA A;  2XYJ A;  2ZLA A;  3FLI A;  3KDT A;  3CS4 A;  1P93 A;  5IXK A;  3H52 A;  2JFA B;  1I37 A;  2PJL A;  1N4H A;  1K74 A;  4MG7 A;  3B65 A;  4IV2 A;  4N73 A;  4NB6 A;  1XOW A;  4WLB A;  1T74 A;  5I4V A;  4PXM A;  5G43 A;  3U9Q A;  3SP9 A;  4RUP A;  4G1Y A;  3L3X A;  2B1V A;  1FCX A;  3B1M A;  4PRG A;  1XZX X;  2QTU A;  4B7W A;  5JY3 A;  2HAS A;  2ACL B;  2I0G A;  2Z4B A;  4IA3 A;  1X78 A;  5E15 A;  5KRC A;  3UP0 A;  1OSV A;  2IOG A;  3X36 A;  2Q1H A;  3DCT A;  4XHD A;  1FCY A;  4A2J A;  4RZF A;  5ICK A;  5DU5 A;  4OKT A;  2QZO A;  5KCF A;  3IA6 A;  4OEY A;  3B66 A;  3OKI A;  3KMG A;  1PQC A;  4Q50 A;  3VJT A;  5DIE A;  4YT1 A;  1T65 A;  3GN8 A;  3L0L A;  3A2H A;  4APU A;  2VV1 B;  2V0V A;  1XAP A;  5KR9 A;  3ADT A;  4TV1 A;  4PLD A;  3ET0 A;  4PPP A;  5KRJ A;  2GPO A;  3DR1 A;  1OVL A;  1PDU A;  4IU7 A;  3VT5 A;  5C4T A;  2ZMH A;  4NIE A;  2AX9 A;  5B41 A;  2HBH A;  3OLL A;  5DWE A;  5C4S A;  4F9M A;  5KCT A;  3K8S A;  5KYJ A;  3VRU A;  2EWP A;  5L7E A;  1BSX A;  2PIU A;  5DUE A;  4J26 A;  1XV9 B;  3ZRA A;  3VT7 A;  2VST A;  5DZ3 A;  4ZNT A;  2QAB A;  4UDD A;  1S19 A;  5DP0 A;  2BJ4 A;  2XYX A;  1XLS A;  2QGW A;  2ZXM A;  4RZG A;  5M96 A;  2P7Z A;  4DMA A;  1HG4 A;  3CJW A;  4OKW A;  3OMO A;  1QKU A;  3O1D A;  4FGY A;  1H9U A;  5HYK A;  5JJM B;  4K6I A;  4MGC A;  4ITF A;  3NSP A;  4J5W A;  4IWF A;  2PNU A;  4WPF A;  3JZB A;  2O4J A;  1EXX A;  5KRK A;  1G5Y A;  1X7J A;  4OIV A;  5DKG A;  3E00 D;  1XVP A;  5L11 A;  3B5R A;  2PIQ A;  5EHJ A;  1NQ2 A;  4MG8 A;  4E4Q A;  3W0J A;  4A4V A;  4EMA A;  4MGD B;  2YLO A;  3CQV A;  2AA2 A;  3F5C A;  3R2A A;  2J4A A;  4OLM A;  4R6S A;  4TUZ A;  5FQP A;  3VRW A;  1I38 A;  2OVM A;  3WJ4 A;  5LWP A;  3R5N A;  1YIM A;  2PIN A;  3MNO A;  5DTV A;  1ERR A;  2GL8 A;  3CDS A;  4OK1 A;  3GWS X;  5DXB B;  5DXQ A;  5HJS A;  4DOS A;  3OGT A;  1Y0X X;  3FUR A;  3K23 A;  1OSH A;  2QA8 B;  2AAX A;  2Q3Y A;  3Q95 A;  5SYZ A;  4MG9 B;  3OAP A;  5AYG A;  1SJ0 A;  5DXE A;  4CI5 A;  2AA7 A;  2PKL A;  2Q7L A;  2ZXN A;  1RKG A;  2IOK A;  3IPQ A;  4L96 A;  4S0T A;  4S15 A;  4WQP A;  3P0U A;  3ADX A;  2VV2 A;  5EJV A;  5FQT A;  3W5Q A;  3ZQT A;  4IQR A;  2PIT A;  1DB1 A;  1FM9 A;  3W0Y A;  2HB7 A;  4XLD A;  2VSR A;  5DV3 A;  1IE9 A;  3B0R A;  5E1C A;  1YOW A;  2AA5 A;  3VJS A;  3V4A A;  4OFR A;  3A9E A;  5E14 A;  4IWC A;  3WT6 A;  4J5W C;  1XP9 A;  4J24 A;  2HC4 A;  5DX3 A;  4N5G A;  3V9V A;  3VI8 A;  2AX6 A;  4OEZ A;  5DSH A;  5DIG A;  3P88 A;  5GID A;  2PIO A;  4JAZ A;  2REW A;  5DVV A;  4OHA A;  1R20 D;  2PIW A;  2P4Y A;  1YP0 A;  2POG A;  3RUT A;  4MGB B;  3WWR A;  5L7G A;  3S9S A;  1UHL A;  2Q6J A;  3FAL B;  4IA7 A;  1XIU A;  5AVI A;  3AUR A;  2Q1V A;  2ZNO A;  3E94 A;  2Q61 A;  5E7V A;  3OSI A;  1G1U A;  2ZK4 A;  3R29 A;  3KDU A;  3RLL A;  1DKF B;  2VV0 A;  5KD9 A;  2R6Y A;  4ZN7 A;  4K4J A;  1NAX A;  3ZRB A;  2Q59 A;  3UUC A;  1NQ1 A;  1S9P A;  3HC6 A;  5G44 A;  2GPU A;  2P15 A;  3LBD A;  3UUD B;  4IVW A;  3T03 A;  1U3S A;  3CDP A;  1T79 A;  5JI0 D;  3DZY D;  4PPS A;  2GPP A;  2B23 A;  3TX7 B;  5DYD A;  5E0X A;  5AWJ A;  1S0Z A;  2GPV A;  2VV4 B;  3OZJ A;  3R5M A;  5HCV A;  4CI4 A;  1ZDU A;  4IW8 A;  1U9E A;  4KZJ A;  1K74 D;  1XQC A;  1R6G A;  1ZDT A;  1RDT A;  2JF9 A;  2Q7I A;  2NW4 A;  2QH6 A;  2QSE A;  3MNP A;  4IW6 A;  1FM6 A;  1ZKY A;  5AK2 A;  5KRI A;  3PBA A;  3VJH A;  2R6W A;  4IV4 A;  4XT9 A;  3D6D A;  3W5T A;  3CLD A;  3E7C A;  2J7Y A;  5DY8 A;  4YPQ A;  5DUH A;  3D57 A;  5DL4 A;  5AAV B;  4K7A A;  3RLJ A;  1YIN A;  3H0A A;  4E4K A;  4M8E A;  2XKW A;  3SZ1 A;  4DQM A;  3FEJ A;  4MGB A;  3VTC A;  2ZLC A;  3G8I A;  5KCE A;  3DZU A;  3GYU A;  3BQD A;  1G50 A;  2AYR A;  3B68 A;  3L0E A;  4R2U A;  1X76 A;  3OKH A;  4DK8 A;  3BEJ A;  3A2J A;  4G1Z A;  2G0H A;  1R1K A;  2ZFX A;  4G2I A;  4M8H A;  4REF A;  1HJ1 A;  2NXX E;  2QXS A;  1I7G A;  4NY9 A;  4E2J A;  2O4R A;  1XDK B;  1L2J A;  4MGA B;  3OSA A;  4YMQ A;  4OJ4 A;  4QE6 A;  3IPU A;  2YLQ A;  4FHI A;  5DI7 A;  3W5R A;  3L0J A;  4G20 A;  4BCR A;  1UPW A;  2VV4 A;  4RFW A;  5G45 A;  3R8D A;  4N8R A;  4POH A;  4REE A;  4Y29 A;  3DY6 A;  3VT8 A;  2J14 A;  5KCU A;  3UU7 B;  5CJ6 A;  2JFA A;  5APK A;  4P6W A;  3VHU A;  1TXI A;  3OOF A;  4G1D A;  4RUO X;  5LGA A;  3L1B A;  5AAV A;  1Z95 A;  3VN2 A;  4OGH A;  3OMP A;  4PWL A;  2ZXZ A;  4OH6 A;  3W0C A;  5AVL A;  4CSJ A;  3P89 A;  3ADV A;  3OSW A;  5DXP A;  3AUQ A;  4G21 A;  4MG6 A;  2QW4 A;  4JYH A;  5DXG A;  2ACL A;  1YOK A;  3RUU A;  2I0J A;  4Q0A C;  3VT4 A;  4OKX A;  5E0W A;  4DM8 A;  4PLE A;  1YMT A;  3K22 A;  3D24 A;  3CS8 A;  5DZ0 A;  3VT6 A;  5HJP B;  5DWL A;  1XJ7 A;  1P8D A;  3BC5 A;  5G42 A;  3O1E A;  1ILH A;  2Q5P A;  2G44 A;  3FEI A;  2QE4 A;  2Z4J A;  3W0A A;  5DXK A;  4OIL A;  2VV1 A;  3OLF A;  4XI3 A;  2HCD A;  1ZGY A;  2IHQ A;  1YY4 A;  5KCW A;  3TKC A;  5KRM A;  5AWK A;  3VRT A;  1R5K A;  3B67 A;  3V9T A;  3AFR A;  3KBA A;  3P8X A;  1XB7 A;  4ONI A;  4G2H A;  3V3Q A;  3R8I A;  4L98 A;  2AXA A;  3PLZ A;  2QGT A;  1NHZ A;  1ILG A;  3V3E A;  4NQA B;  2ZY0 A;  1XV9 A;  3RVF A;  3M7R A;  5APH A;  2QA6 A;  2ZMI A;  3A3Z X;  2QPY A;  1FM9 D;  4EM9 A;  2P54 A;  4RUJ A;  5FQS A;  4RMD A;  1K4W A;  4IUI A;  5G5W A;  1RK3 A;  4XTA A;  3QT0 A;  5DMC A;  2OM9 A;  3X31 A;  5HZC A;  2NXX A;  5DWG A;  5JJM A;  3X1H A;  3PRG A;  3EYB A;  1T7T A;  3E00 A;  3OLS A;  3OZ0 A;  4FN9 A;  3ADU A;  5AAU A;  3HM1 A;  1PRG A;  3ZR7 A;  5GIE A;  4IS8 A;  2AM9 A;  3WTQ A;  4JYG A;  3VHV A;  4ZNU A;  2R40 D;  3FS1 A;  3PCU A;  4KZI A;  2P7A A;  3G0W A;  3B0T A;  4X1G A;  5A86 A;  2Q6R A;  3OS9 A;  4OEA A;  4OZR U;  3AZ1 A;  3ERD A;  1GWX A;  4IA1 A;  1OT7 A;  1YYE A;  3B0W A;  5APJ A;  3UVV B;  5DZI A;  4MGD A;  1MZN A;  1L2I A;  4ZNH A;  4ZO1 B;  3VSP A;  1NYX A;  5DID A;  3ADS A;  1FD0 A;  1YUC A;  2I4J A;  2HWR A;  4PF3 A;  3L03 A;  4XAO A;  3TKM A;  4RAK A;  2ZKC A;  1NRL A;  2E2R A;  2Q60 A;  2YLP A;  5DXB A;  3DZY A;  2FVJ A;  2ABI A;  2QA8 A;  2ZVT A;  2ZMJ A;  4MG9 A;  4OH5 A;  3AN4 A;  1NQ0 A;  1SQN A;  2NPA A;  3VT9 A;  2H79 A;  2Q5G A;  3ET3 A;  2AO6 A;  1PK5 A;  3V49 A;  1KKQ A;  1ZUC A;  4ZNW A;  1NUO A;  5GIC A;  4ZNV A;  5DWJ A;  1NDE A;  3PO9 A;  3CWD A;  2FAI A;  4OFU A;  3IXP A;  5DK9 A;  4ZJR A;  1Y9R A;  3OMQ A;  5DZH A;  4FHH A;  3VTD A;  1ZEO A;  1R20 A;  4LTW A;  3HOD A;  5KRO A;  1A52 A;  5KRA A;  5HYR A;  3L3Z A;  4UDC A;  3UP3 A;  5KCD A;  5EIT A;  5ETH A;  3DCU A;  3DZU D;  2QZO B;  4PP6 A;  2YLY A;  4ZN9 A;  1XQ3 A;  4OZT U;  2QNV A;  3MNE A;  3UVV A;  3R8A A;  3OMK A;  4JYI A;  1X7R A;  3FC6 B;  2YFE A;  3HO0 A;  5DZ1 A;  1Z5X U;  1QKT A;  1X7B A;  3FAL A;  5K13 A;  3KWY A;  2AWH A;  1M7W A;  1PCG A;  4O8F A;  1GWR A;  3OMM A;  2XHS A;  1T63 A;  5DXM A;  4YNK A;  2B50 A;  3OOK A;  2YAT A;  4J5X A;  4TV1 B;  3HZF A;  2Q6S A;  3AZ2 A;  1DKF A;  1OVL B;  1YA3 A;  2PIP L;  3AX8 A;  2OAX A;  2P7G A;  1UOM A;  4FNE A;  2OUZ A;  3RY9 A;  3AZ3 A;  3FXV A;  1I7I A;  3W0G A;  1E3K A;  1ERE A;  2HFP A;  3GBK A;  2HAM A;  5AZT A;  4UDA A;  2B1Z A;  4OED A;  2ZK0 A;  1KNU A;  3NOA A;  1T76 A;  2PRG A;  4LNW A;  3A40 X;  4RE8 A;  5DV8 A;  3VRV A;  3X1I A;  3AN3 A;  1MV9 A;  3SP6 A;  1T7M A;  5DV6 A;  3LMP A;  1S0X A;  2BJ4 B;  1QKM A;  1S9Q A;  2QMV A;  4OAR A;  3CTB A;  2AMB A;  4OZT E;  1LBD A;  5H1E A;  3W0H A;  4DM6 A;  5KRH A;  1IE8 A;  2AMA A;  1X7E A;  3D90 A;  3G8O A;  2W8Y A;  1Z5X E;  3D5F A;  3UUA B;  2Q7J A;  4LBD A;  2F4B A;  4ITE A;  3WFG A;  2GP7 A;  4WHG A;  2Q5S A;  3FC6 A;  4DOR A;  2G0G A;  3HLV A;  5DXR A;  4DK7 A;  2ZL9 A;  1N83 A;  4OC7 A; 
#chains in the Genus database with same CATH topology
 1QKN A;  1VJB A;  1WM0 X;  3K6P A;  1XVP B;  3KPZ A;  4JL4 A;  4IVY A;  4MDD A;  4MG8 B;  2GTK A;  2ZNN A;  3ET2 A;  4OKB A;  2YJD A;  4WHF A;  2AB2 A;  1SR7 A;  4J5X C;  1RJK A;  1NAV A;  3F5C B;  4R06 A;  2ZK5 A;  1XNX A;  2ZNQ A;  4OIU A;  2Q70 A;  4RWV A;  4TUZ B;  5EGV A;  1U3Q A;  5G46 A;  2OZ7 A;  3VTB A;  2ZAS A;  3NSQ A;  1XDK A;  3WMH A;  4MGA A;  3B3K A;  4XUM A;  2G5O A;  4RZE A;  1T7R A;  3HQ5 A;  2A3I A;  3VJI A;  4HEE X;  5DMF A;  2GIU A;  3Q95 B;  3ET1 A;  1Q4X A;  2OCF A;  3OS8 A;  1A28 A;  3KFC A;  1KV6 A;  5DKE A;  3A78 A;  2ZBS A;  5ACC A;  3GZ9 A;  4OJ9 A;  3UU7 A;  1MVC A;  2I4Z A;  4IA2 A;  2BAW A;  3WT5 A;  1XP1 A;  2P1U A;  3UUA A;  3CS6 A;  2PIR A;  1N46 A;  1LV2 A;  1PZL A;  3WFF A;  1ZH7 A;  1GS4 A;  4WVD A;  5IAW A;  3A9E B;  2AX7 A;  4X1F A;  1T5Z A;  5DX3 B;  4ZNS A;  3GWX A;  3HVL A;  4ZO1 X;  2J7X A;  3GYT A;  1M13 A;  2HVC A;  4QL8 A;  1TFC A;  1G2N A;  5DRJ A;  5DYB A;  5E19 A;  3VSO A;  3WT7 A;  3IMY A;  4QE8 A;  1PQ6 A;  2FSZ A;  3AUN A;  3JZC A;  5DVS A;  2XYW A;  3TY0 A;  1GWQ A;  5B5B A;  5HJP A;  2PIV A;  1RKH A;  2H77 A;  2O9I A;  5EC9 A;  3UUD A;  2ZK6 A;  1UHL B;  4QK4 A;  5KYA A;  1U3R A;  3KMR A;  3KYT A;  1XPC A;  3ILZ A;  5F9B A;  1XP6 A;  5DVC A;  5G3J A;  4RMC A;  2NV7 A;  1T73 A;  3N00 A;  2V7C A;  2GWX A;  4UDB A;  3A2I A;  2Q59 B;  3ADW A;  5DKS A;  2QR9 A;  2AX8 A;  4PP5 A;  1NQ7 A;  3OS8 C;  3VT3 A;  3WGP A;  3W5P A;  3PEQ A;  3F7D A;  3B0Q A;  3G9E A;  4QJR A;  5DRM A;  2ZNP A;  5C4O A;  3W0I A;  2HAR A;  3DT3 A;  1FCZ A;  4JGV A;  5IZ0 A;  5C4U A;  5EI1 A;  5KCC A;  4Q13 A;  5DUG A;  1ZAF A;  5DWI A;  5FQV A;  3HC5 A;  4POJ A;  4ZJW A;  1PQ9 A;  4NUF A;  2QXM A;  1YJE A;  3IXP D;  1M2Z A;  2P1T A;  5DKB A;  3IPS A;  4S14 A;  3WJ5 A;  4MG7 B;  2R40 A;  2HB8 A;  2ZK3 A;  2LBD A;  2OVH A;  1RDT D;  5DLR A;  4A4W A;  1FM6 D;  3VHW A;  2PIX A;  4N1Y A;  5L7H A;  1SKX A;  4OZR E;  2YHD A;  4QM0 A;  2ZK1 A;  1XLS E;  5GT4 A;  3GD2 A;  3H0A D;  3ERT A;  2ZK2 A;  4ZOM A;  5KRL A;  1UPV A;  2I4P A;  4PVU A;  4RME A;  4ZI1 A;  4OJB A;  4S0S A;  2YJA B;  4HLW A;  2VV3 A;  1FBY A;  5KRF A;  2ATH A;  3FUG A;  3KMZ A;  1R1K D;  2AA6 A;  4LSJ A;  1XNN A;  5AZV A;  4MG5 A;  5FQR A;  1T7F A;  1Y0S A;  1E3G A;  4P6X A;  4LNX A;  2P1V A;  2Q7K A;  2POB A;  2JJ3 A;  3V9Y A;  4PP3 A;  4KZM A;  4XUH A;  2HWQ A;  1K7L A;  2Q8S A;  1EXA A;  2XYJ A;  2ZLA A;  3FLI A;  3KDT A;  3CS4 A;  1P93 A;  5IXK A;  3H52 A;  2JFA B;  1I37 A;  2PJL A;  1N4H A;  1K74 A;  4MG7 A;  3B65 A;  4IV2 A;  4N73 A;  4NB6 A;  1XOW A;  4WLB A;  1T74 A;  5I4V A;  4PXM A;  5G43 A;  3U9Q A;  3SP9 A;  4RUP A;  4G1Y A;  3L3X A;  2B1V A;  1FCX A;  3B1M A;  4PRG A;  1XZX X;  2QTU A;  4B7W A;  5JY3 A;  2HAS A;  2ACL B;  2I0G A;  2Z4B A;  4IA3 A;  1X78 A;  5E15 A;  5KRC A;  3UP0 A;  1OSV A;  2IOG A;  3X36 A;  2Q1H A;  3DCT A;  4XHD A;  1FCY A;  4A2J A;  4RZF A;  5ICK A;  5DU5 A;  4OKT A;  2QZO A;  5KCF A;  3IA6 A;  4OEY A;  3B66 A;  3OKI A;  3KMG A;  1PQC A;  4Q50 A;  3VJT A;  5DIE A;  4YT1 A;  1T65 A;  3GN8 A;  3L0L A;  3A2H A;  4APU A;  2VV1 B;  2V0V A;  1XAP A;  5KR9 A;  3ADT A;  4TV1 A;  4PLD A;  3ET0 A;  4PPP A;  5KRJ A;  2GPO A;  3DR1 A;  1OVL A;  1PDU A;  4IU7 A;  3VT5 A;  5C4T A;  2ZMH A;  4NIE A;  2AX9 A;  5B41 A;  2HBH A;  3OLL A;  5DWE A;  5C4S A;  4F9M A;  5KCT A;  3K8S A;  5KYJ A;  3VRU A;  2EWP A;  5L7E A;  1BSX A;  2PIU A;  5DUE A;  4J26 A;  1XV9 B;  3ZRA A;  3VT7 A;  2VST A;  5DZ3 A;  4ZNT A;  2QAB A;  4UDD A;  1S19 A;  5DP0 A;  2BJ4 A;  2XYX A;  1XLS A;  2QGW A;  2ZXM A;  4RZG A;  5M96 A;  2P7Z A;  4DMA A;  1HG4 A;  3CJW A;  4OKW A;  3OMO A;  1QKU A;  3O1D A;  4FGY A;  1H9U A;  5HYK A;  5JJM B;  4K6I A;  4MGC A;  4ITF A;  3NSP A;  4J5W A;  4IWF A;  2PNU A;  4WPF A;  3JZB A;  2O4J A;  1EXX A;  5KRK A;  1G5Y A;  1X7J A;  4OIV A;  5DKG A;  3E00 D;  1XVP A;  5L11 A;  3B5R A;  2PIQ A;  5EHJ A;  1NQ2 A;  4MG8 A;  4E4Q A;  3W0J A;  4A4V A;  4EMA A;  4MGD B;  2YLO A;  3CQV A;  2AA2 A;  3F5C A;  3R2A A;  2J4A A;  4OLM A;  4R6S A;  4TUZ A;  5FQP A;  3VRW A;  1I38 A;  2OVM A;  3WJ4 A;  5LWP A;  3R5N A;  1YIM A;  2PIN A;  3MNO A;  5DTV A;  1ERR A;  2GL8 A;  3CDS A;  4OK1 A;  3GWS X;  5DXB B;  5DXQ A;  5HJS A;  4DOS A;  3OGT A;  1Y0X X;  3FUR A;  3K23 A;  1OSH A;  2QA8 B;  2AAX A;  2Q3Y A;  3Q95 A;  5SYZ A;  4MG9 B;  3OAP A;  5AYG A;  1SJ0 A;  5DXE A;  4CI5 A;  2AA7 A;  2PKL A;  2Q7L A;  2ZXN A;  1RKG A;  2IOK A;  3IPQ A;  4L96 A;  4S0T A;  4S15 A;  4WQP A;  3P0U A;  3ADX A;  2VV2 A;  5EJV A;  5FQT A;  3W5Q A;  3ZQT A;  4IQR A;  2PIT A;  1DB1 A;  1FM9 A;  3W0Y A;  2HB7 A;  4XLD A;  2VSR A;  5DV3 A;  1IE9 A;  3B0R A;  5E1C A;  1YOW A;  2AA5 A;  3VJS A;  3V4A A;  4OFR A;  3A9E A;  5E14 A;  4IWC A;  3WT6 A;  4J5W C;  1XP9 A;  4J24 A;  2HC4 A;  5DX3 A;  4N5G A;  3V9V A;  3VI8 A;  2AX6 A;  4OEZ A;  5DSH A;  5DIG A;  3P88 A;  5GID A;  2PIO A;  4JAZ A;  2REW A;  5DVV A;  4OHA A;  1R20 D;  2PIW A;  2P4Y A;  1YP0 A;  2POG A;  3RUT A;  4MGB B;  3WWR A;  5L7G A;  3S9S A;  1UHL A;  2Q6J A;  3FAL B;  4IA7 A;  1XIU A;  5AVI A;  3AUR A;  2Q1V A;  2ZNO A;  3E94 A;  2Q61 A;  5E7V A;  3OSI A;  1G1U A;  2ZK4 A;  3R29 A;  3KDU A;  3RLL A;  1DKF B;  2VV0 A;  5KD9 A;  2R6Y A;  4ZN7 A;  4K4J A;  1NAX A;  3ZRB A;  2Q59 A;  3UUC A;  1NQ1 A;  1S9P A;  3HC6 A;  5G44 A;  2GPU A;  2P15 A;  3LBD A;  3UUD B;  4IVW A;  3T03 A;  1U3S A;  3CDP A;  1T79 A;  5JI0 D;  3DZY D;  4PPS A;  2GPP A;  2B23 A;  3TX7 B;  5DYD A;  5E0X A;  5AWJ A;  1S0Z A;  2GPV A;  2VV4 B;  3OZJ A;  3R5M A;  5HCV A;  4CI4 A;  1ZDU A;  4IW8 A;  1U9E A;  4KZJ A;  1K74 D;  1XQC A;  1R6G A;  1ZDT A;  1RDT A;  2JF9 A;  2Q7I A;  2NW4 A;  2QH6 A;  2QSE A;  3MNP A;  4IW6 A;  1FM6 A;  1ZKY A;  5AK2 A;  5KRI A;  3PBA A;  3VJH A;  2R6W A;  4IV4 A;  4XT9 A;  3D6D A;  3W5T A;  3CLD A;  3E7C A;  2J7Y A;  5DY8 A;  4YPQ A;  5DUH A;  3D57 A;  5DL4 A;  5AAV B;  4K7A A;  3RLJ A;  1YIN A;  3H0A A;  4E4K A;  4M8E A;  2XKW A;  3SZ1 A;  4DQM A;  3FEJ A;  4MGB A;  3VTC A;  2ZLC A;  3G8I A;  5KCE A;  3DZU A;  3GYU A;  3BQD A;  1G50 A;  2AYR A;  3B68 A;  3L0E A;  4R2U A;  1X76 A;  3OKH A;  4DK8 A;  3BEJ A;  3A2J A;  4G1Z A;  2G0H A;  1R1K A;  2ZFX A;  4G2I A;  4M8H A;  4REF A;  1HJ1 A;  2NXX E;  2QXS A;  1I7G A;  4NY9 A;  4E2J A;  2O4R A;  1XDK B;  1L2J A;  4MGA B;  3OSA A;  4YMQ A;  4OJ4 A;  4QE6 A;  3IPU A;  2YLQ A;  4FHI A;  5DI7 A;  3W5R A;  3L0J A;  4G20 A;  4BCR A;  1UPW A;  2VV4 A;  4RFW A;  5G45 A;  3R8D A;  4N8R A;  4POH A;  4REE A;  4Y29 A;  3DY6 A;  3VT8 A;  2J14 A;  5KCU A;  3UU7 B;  5CJ6 A;  2JFA A;  5APK A;  4P6W A;  3VHU A;  1TXI A;  3OOF A;  4G1D A;  4RUO X;  5LGA A;  3L1B A;  5AAV A;  1Z95 A;  3VN2 A;  4OGH A;  3OMP A;  4PWL A;  2ZXZ A;  4OH6 A;  3W0C A;  5AVL A;  4CSJ A;  3P89 A;  3ADV A;  3OSW A;  5DXP A;  3AUQ A;  4G21 A;  4MG6 A;  2QW4 A;  4JYH A;  5DXG A;  2ACL A;  1YOK A;  3RUU A;  2I0J A;  4Q0A C;  3VT4 A;  4OKX A;  5E0W A;  4DM8 A;  4PLE A;  1YMT A;  3K22 A;  3D24 A;  3CS8 A;  5DZ0 A;  3VT6 A;  5HJP B;  5DWL A;  1XJ7 A;  1P8D A;  3BC5 A;  5G42 A;  3O1E A;  1ILH A;  2Q5P A;  2G44 A;  3FEI A;  2QE4 A;  2Z4J A;  3W0A A;  5DXK A;  4OIL A;  2VV1 A;  3OLF A;  4XI3 A;  2HCD A;  1ZGY A;  2IHQ A;  1YY4 A;  5KCW A;  3TKC A;  5KRM A;  5AWK A;  3VRT A;  1R5K A;  3B67 A;  3V9T A;  3AFR A;  3KBA A;  3P8X A;  1XB7 A;  4ONI A;  4G2H A;  3V3Q A;  3R8I A;  4L98 A;  2AXA A;  3PLZ A;  2QGT A;  1NHZ A;  1ILG A;  3V3E A;  4NQA B;  2ZY0 A;  1XV9 A;  3RVF A;  3M7R A;  5APH A;  2QA6 A;  2ZMI A;  3A3Z X;  2QPY A;  1FM9 D;  4EM9 A;  2P54 A;  4RUJ A;  5FQS A;  4RMD A;  1K4W A;  4IUI A;  5G5W A;  1RK3 A;  4XTA A;  3QT0 A;  5DMC A;  2OM9 A;  3X31 A;  5HZC A;  2NXX A;  5DWG A;  5JJM A;  3X1H A;  3PRG A;  3EYB A;  1T7T A;  3E00 A;  3OLS A;  3OZ0 A;  4FN9 A;  3ADU A;  5AAU A;  3HM1 A;  1PRG A;  3ZR7 A;  5GIE A;  4IS8 A;  2AM9 A;  3WTQ A;  4JYG A;  3VHV A;  4ZNU A;  2R40 D;  3FS1 A;  3PCU A;  4KZI A;  2P7A A;  3G0W A;  3B0T A;  4X1G A;  5A86 A;  2Q6R A;  3OS9 A;  4OEA A;  4OZR U;  3AZ1 A;  3ERD A;  1GWX A;  4IA1 A;  1OT7 A;  1YYE A;  3B0W A;  5APJ A;  3UVV B;  5DZI A;  4MGD A;  1MZN A;  1L2I A;  4ZNH A;  4ZO1 B;  3VSP A;  1NYX A;  5DID A;  3ADS A;  1FD0 A;  1YUC A;  2I4J A;  2HWR A;  4PF3 A;  3L03 A;  4XAO A;  3TKM A;  4RAK A;  2ZKC A;  1NRL A;  2E2R A;  2Q60 A;  2YLP A;  5DXB A;  3DZY A;  2FVJ A;  2ABI A;  2QA8 A;  2ZVT A;  2ZMJ A;  4MG9 A;  4OH5 A;  3AN4 A;  1NQ0 A;  1SQN A;  2NPA A;  3VT9 A;  2H79 A;  2Q5G A;  3ET3 A;  2AO6 A;  1PK5 A;  3V49 A;  1KKQ A;  1ZUC A;  4ZNW A;  1NUO A;  5GIC A;  4ZNV A;  5DWJ A;  1NDE A;  3PO9 A;  3CWD A;  2FAI A;  4OFU A;  3IXP A;  5DK9 A;  4ZJR A;  1Y9R A;  3OMQ A;  5DZH A;  4FHH A;  3VTD A;  1ZEO A;  1R20 A;  4LTW A;  3HOD A;  5KRO A;  1A52 A;  5KRA A;  5HYR A;  3L3Z A;  4UDC A;  3UP3 A;  5KCD A;  5EIT A;  5ETH A;  3DCU A;  3DZU D;  2QZO B;  4PP6 A;  2YLY A;  4ZN9 A;  1XQ3 A;  4OZT U;  2QNV A;  3MNE A;  3UVV A;  3R8A A;  3OMK A;  4JYI A;  1X7R A;  3FC6 B;  2YFE A;  3HO0 A;  5DZ1 A;  1Z5X U;  1QKT A;  1X7B A;  3FAL A;  5K13 A;  3KWY A;  2AWH A;  1M7W A;  1PCG A;  4O8F A;  1GWR A;  3OMM A;  2XHS A;  1T63 A;  5DXM A;  4YNK A;  2B50 A;  3OOK A;  2YAT A;  4J5X A;  4TV1 B;  3HZF A;  2Q6S A;  3AZ2 A;  1DKF A;  1OVL B;  1YA3 A;  2PIP L;  3AX8 A;  2OAX A;  2P7G A;  1UOM A;  4FNE A;  2OUZ A;  3RY9 A;  3AZ3 A;  3FXV A;  1I7I A;  3W0G A;  1E3K A;  1ERE A;  2HFP A;  3GBK A;  2HAM A;  5AZT A;  4UDA A;  2B1Z A;  4OED A;  2ZK0 A;  1KNU A;  3NOA A;  1T76 A;  2PRG A;  4LNW A;  3A40 X;  4RE8 A;  5DV8 A;  3VRV A;  3X1I A;  3AN3 A;  1MV9 A;  3SP6 A;  1T7M A;  5DV6 A;  3LMP A;  1S0X A;  2BJ4 B;  1QKM A;  1S9Q A;  2QMV A;  4OAR A;  3CTB A;  2AMB A;  4OZT E;  1LBD A;  5H1E A;  3W0H A;  4DM6 A;  5KRH A;  1IE8 A;  2AMA A;  1X7E A;  3D90 A;  3G8O A;  2W8Y A;  1Z5X E;  3D5F A;  3UUA B;  2Q7J A;  4LBD A;  2F4B A;  4ITE A;  3WFG A;  2GP7 A;  4WHG A;  2Q5S A;  3FC6 A;  4DOR A;  2G0G A;  3HLV A;  5DXR A;  4DK7 A;  2ZL9 A;  1N83 A;  4OC7 A; 
#chains in the Genus database with same CATH homology
 1QKN A;  1VJB A;  1WM0 X;  3K6P A;  1XVP B;  3KPZ A;  4JL4 A;  4IVY A;  4MDD A;  4MG8 B;  2GTK A;  2ZNN A;  3ET2 A;  4OKB A;  2YJD A;  4WHF A;  2AB2 A;  1SR7 A;  4J5X C;  1RJK A;  1NAV A;  3F5C B;  4R06 A;  2ZK5 A;  1XNX A;  2ZNQ A;  4OIU A;  2Q70 A;  4RWV A;  4TUZ B;  5EGV A;  1U3Q A;  5G46 A;  2OZ7 A;  3VTB A;  2ZAS A;  3NSQ A;  1XDK A;  3WMH A;  4MGA A;  3B3K A;  4XUM A;  2G5O A;  4RZE A;  1T7R A;  3HQ5 A;  2A3I A;  3VJI A;  4HEE X;  5DMF A;  2GIU A;  3Q95 B;  3ET1 A;  1Q4X A;  2OCF A;  3OS8 A;  1A28 A;  3KFC A;  1KV6 A;  5DKE A;  3A78 A;  2ZBS A;  5ACC A;  3GZ9 A;  4OJ9 A;  3UU7 A;  1MVC A;  2I4Z A;  4IA2 A;  2BAW A;  3WT5 A;  1XP1 A;  2P1U A;  3UUA A;  3CS6 A;  2PIR A;  1N46 A;  1LV2 A;  1PZL A;  3WFF A;  1ZH7 A;  1GS4 A;  4WVD A;  5IAW A;  3A9E B;  2AX7 A;  4X1F A;  1T5Z A;  5DX3 B;  4ZNS A;  3GWX A;  3HVL A;  4ZO1 X;  2J7X A;  3GYT A;  1M13 A;  2HVC A;  4QL8 A;  1TFC A;  1G2N A;  5DRJ A;  5DYB A;  5E19 A;  3VSO A;  3WT7 A;  3IMY A;  4QE8 A;  1PQ6 A;  2FSZ A;  3AUN A;  3JZC A;  5DVS A;  2XYW A;  3TY0 A;  1GWQ A;  5B5B A;  5HJP A;  2PIV A;  1RKH A;  2H77 A;  2O9I A;  5EC9 A;  3UUD A;  2ZK6 A;  1UHL B;  4QK4 A;  5KYA A;  1U3R A;  3KMR A;  3KYT A;  1XPC A;  3ILZ A;  5F9B A;  1XP6 A;  5DVC A;  5G3J A;  4RMC A;  2NV7 A;  1T73 A;  3N00 A;  2V7C A;  2GWX A;  4UDB A;  3A2I A;  2Q59 B;  3ADW A;  5DKS A;  2QR9 A;  2AX8 A;  4PP5 A;  1NQ7 A;  3OS8 C;  3VT3 A;  3WGP A;  3W5P A;  3PEQ A;  3F7D A;  3B0Q A;  3G9E A;  4QJR A;  5DRM A;  2ZNP A;  5C4O A;  3W0I A;  2HAR A;  3DT3 A;  1FCZ A;  4JGV A;  5IZ0 A;  5C4U A;  5EI1 A;  5KCC A;  4Q13 A;  5DUG A;  1ZAF A;  5DWI A;  5FQV A;  3HC5 A;  4POJ A;  4ZJW A;  1PQ9 A;  4NUF A;  2QXM A;  1YJE A;  3IXP D;  1M2Z A;  2P1T A;  5DKB A;  3IPS A;  4S14 A;  3WJ5 A;  4MG7 B;  2R40 A;  2HB8 A;  2ZK3 A;  2LBD A;  2OVH A;  1RDT D;  5DLR A;  4A4W A;  1FM6 D;  3VHW A;  2PIX A;  4N1Y A;  5L7H A;  1SKX A;  4OZR E;  2YHD A;  4QM0 A;  2ZK1 A;  1XLS E;  5GT4 A;  3GD2 A;  3H0A D;  3ERT A;  2ZK2 A;  4ZOM A;  5KRL A;  1UPV A;  2I4P A;  4PVU A;  4RME A;  4ZI1 A;  4OJB A;  4S0S A;  2YJA B;  4HLW A;  2VV3 A;  1FBY A;  5KRF A;  2ATH A;  3FUG A;  3KMZ A;  1R1K D;  2AA6 A;  4LSJ A;  1XNN A;  5AZV A;  4MG5 A;  5FQR A;  1T7F A;  1Y0S A;  1E3G A;  4P6X A;  4LNX A;  2P1V A;  2Q7K A;  2POB A;  2JJ3 A;  3V9Y A;  4PP3 A;  4KZM A;  4XUH A;  2HWQ A;  1K7L A;  2Q8S A;  1EXA A;  2XYJ A;  2ZLA A;  3FLI A;  3KDT A;  3CS4 A;  1P93 A;  5IXK A;  3H52 A;  2JFA B;  1I37 A;  2PJL A;  1N4H A;  1K74 A;  4MG7 A;  3B65 A;  4IV2 A;  4N73 A;  4NB6 A;  1XOW A;  4WLB A;  1T74 A;  5I4V A;  4PXM A;  5G43 A;  3U9Q A;  3SP9 A;  4RUP A;  4G1Y A;  3L3X A;  2B1V A;  1FCX A;  3B1M A;  4PRG A;  1XZX X;  2QTU A;  4B7W A;  5JY3 A;  2HAS A;  2ACL B;  2I0G A;  2Z4B A;  4IA3 A;  1X78 A;  5E15 A;  5KRC A;  3UP0 A;  1OSV A;  2IOG A;  3X36 A;  2Q1H A;  3DCT A;  4XHD A;  1FCY A;  4A2J A;  4RZF A;  5ICK A;  5DU5 A;  4OKT A;  2QZO A;  5KCF A;  3IA6 A;  4OEY A;  3B66 A;  3OKI A;  3KMG A;  1PQC A;  4Q50 A;  3VJT A;  5DIE A;  4YT1 A;  1T65 A;  3GN8 A;  3L0L A;  3A2H A;  4APU A;  2VV1 B;  2V0V A;  1XAP A;  5KR9 A;  3ADT A;  4TV1 A;  4PLD A;  3ET0 A;  4PPP A;  5KRJ A;  2GPO A;  3DR1 A;  1OVL A;  1PDU A;  4IU7 A;  3VT5 A;  5C4T A;  2ZMH A;  4NIE A;  2AX9 A;  5B41 A;  2HBH A;  3OLL A;  5DWE A;  5C4S A;  4F9M A;  5KCT A;  3K8S A;  5KYJ A;  3VRU A;  2EWP A;  5L7E A;  1BSX A;  2PIU A;  5DUE A;  4J26 A;  1XV9 B;  3ZRA A;  3VT7 A;  2VST A;  5DZ3 A;  4ZNT A;  2QAB A;  4UDD A;  1S19 A;  5DP0 A;  2BJ4 A;  2XYX A;  1XLS A;  2QGW A;  2ZXM A;  4RZG A;  5M96 A;  2P7Z A;  4DMA A;  1HG4 A;  3CJW A;  4OKW A;  3OMO A;  1QKU A;  3O1D A;  4FGY A;  1H9U A;  5HYK A;  5JJM B;  4K6I A;  4MGC A;  4ITF A;  3NSP A;  4J5W A;  4IWF A;  2PNU A;  4WPF A;  3JZB A;  2O4J A;  1EXX A;  5KRK A;  1G5Y A;  1X7J A;  4OIV A;  5DKG A;  3E00 D;  1XVP A;  5L11 A;  3B5R A;  2PIQ A;  5EHJ A;  1NQ2 A;  4MG8 A;  4E4Q A;  3W0J A;  4A4V A;  4EMA A;  4MGD B;  2YLO A;  3CQV A;  2AA2 A;  3F5C A;  3R2A A;  2J4A A;  4OLM A;  4R6S A;  4TUZ A;  5FQP A;  3VRW A;  1I38 A;  2OVM A;  3WJ4 A;  5LWP A;  3R5N A;  1YIM A;  2PIN A;  3MNO A;  5DTV A;  1ERR A;  2GL8 A;  3CDS A;  4OK1 A;  3GWS X;  5DXB B;  5DXQ A;  5HJS A;  4DOS A;  3OGT A;  1Y0X X;  3FUR A;  3K23 A;  1OSH A;  2QA8 B;  2AAX A;  2Q3Y A;  3Q95 A;  5SYZ A;  4MG9 B;  3OAP A;  5AYG A;  1SJ0 A;  5DXE A;  4CI5 A;  2AA7 A;  2PKL A;  2Q7L A;  2ZXN A;  1RKG A;  2IOK A;  3IPQ A;  4L96 A;  4S0T A;  4S15 A;  4WQP A;  3P0U A;  3ADX A;  2VV2 A;  5EJV A;  5FQT A;  3W5Q A;  3ZQT A;  4IQR A;  2PIT A;  1DB1 A;  1FM9 A;  3W0Y A;  2HB7 A;  4XLD A;  2VSR A;  5DV3 A;  1IE9 A;  3B0R A;  5E1C A;  1YOW A;  2AA5 A;  3VJS A;  3V4A A;  4OFR A;  3A9E A;  5E14 A;  4IWC A;  3WT6 A;  4J5W C;  1XP9 A;  4J24 A;  2HC4 A;  5DX3 A;  4N5G A;  3V9V A;  3VI8 A;  2AX6 A;  4OEZ A;  5DSH A;  5DIG A;  3P88 A;  5GID A;  2PIO A;  4JAZ A;  2REW A;  5DVV A;  4OHA A;  1R20 D;  2PIW A;  2P4Y A;  1YP0 A;  2POG A;  3RUT A;  4MGB B;  3WWR A;  5L7G A;  3S9S A;  1UHL A;  2Q6J A;  3FAL B;  4IA7 A;  1XIU A;  5AVI A;  3AUR A;  2Q1V A;  2ZNO A;  3E94 A;  2Q61 A;  5E7V A;  3OSI A;  1G1U A;  2ZK4 A;  3R29 A;  3KDU A;  3RLL A;  1DKF B;  2VV0 A;  5KD9 A;  2R6Y A;  4ZN7 A;  4K4J A;  1NAX A;  3ZRB A;  2Q59 A;  3UUC A;  1NQ1 A;  1S9P A;  3HC6 A;  5G44 A;  2GPU A;  2P15 A;  3LBD A;  3UUD B;  4IVW A;  3T03 A;  1U3S A;  3CDP A;  1T79 A;  5JI0 D;  3DZY D;  4PPS A;  2GPP A;  2B23 A;  3TX7 B;  5DYD A;  5E0X A;  5AWJ A;  1S0Z A;  2GPV A;  2VV4 B;  3OZJ A;  3R5M A;  5HCV A;  4CI4 A;  1ZDU A;  4IW8 A;  1U9E A;  4KZJ A;  1K74 D;  1XQC A;  1R6G A;  1ZDT A;  1RDT A;  2JF9 A;  2Q7I A;  2NW4 A;  2QH6 A;  2QSE A;  3MNP A;  4IW6 A;  1FM6 A;  1ZKY A;  5AK2 A;  5KRI A;  3PBA A;  3VJH A;  2R6W A;  4IV4 A;  4XT9 A;  3D6D A;  3W5T A;  3CLD A;  3E7C A;  2J7Y A;  5DY8 A;  4YPQ A;  5DUH A;  3D57 A;  5DL4 A;  5AAV B;  4K7A A;  3RLJ A;  1YIN A;  3H0A A;  4E4K A;  4M8E A;  2XKW A;  3SZ1 A;  4DQM A;  3FEJ A;  4MGB A;  3VTC A;  2ZLC A;  3G8I A;  5KCE A;  3DZU A;  3GYU A;  3BQD A;  1G50 A;  2AYR A;  3B68 A;  3L0E A;  4R2U A;  1X76 A;  3OKH A;  4DK8 A;  3BEJ A;  3A2J A;  4G1Z A;  2G0H A;  1R1K A;  2ZFX A;  4G2I A;  4M8H A;  4REF A;  1HJ1 A;  2NXX E;  2QXS A;  1I7G A;  4NY9 A;  4E2J A;  2O4R A;  1XDK B;  1L2J A;  4MGA B;  3OSA A;  4YMQ A;  4OJ4 A;  4QE6 A;  3IPU A;  2YLQ A;  4FHI A;  5DI7 A;  3W5R A;  3L0J A;  4G20 A;  4BCR A;  1UPW A;  2VV4 A;  4RFW A;  5G45 A;  3R8D A;  4N8R A;  4POH A;  4REE A;  4Y29 A;  3DY6 A;  3VT8 A;  2J14 A;  5KCU A;  3UU7 B;  5CJ6 A;  2JFA A;  5APK A;  4P6W A;  3VHU A;  1TXI A;  3OOF A;  4G1D A;  4RUO X;  5LGA A;  3L1B A;  5AAV A;  1Z95 A;  3VN2 A;  4OGH A;  3OMP A;  4PWL A;  2ZXZ A;  4OH6 A;  3W0C A;  5AVL A;  4CSJ A;  3P89 A;  3ADV A;  3OSW A;  5DXP A;  3AUQ A;  4G21 A;  4MG6 A;  2QW4 A;  4JYH A;  5DXG A;  2ACL A;  1YOK A;  3RUU A;  2I0J A;  4Q0A C;  3VT4 A;  4OKX A;  5E0W A;  4DM8 A;  4PLE A;  1YMT A;  3K22 A;  3D24 A;  3CS8 A;  5DZ0 A;  3VT6 A;  5HJP B;  5DWL A;  1XJ7 A;  1P8D A;  3BC5 A;  5G42 A;  3O1E A;  1ILH A;  2Q5P A;  2G44 A;  3FEI A;  2QE4 A;  2Z4J A;  3W0A A;  5DXK A;  4OIL A;  2VV1 A;  3OLF A;  4XI3 A;  2HCD A;  1ZGY A;  2IHQ A;  1YY4 A;  5KCW A;  3TKC A;  5KRM A;  5AWK A;  3VRT A;  1R5K A;  3B67 A;  3V9T A;  3AFR A;  3KBA A;  3P8X A;  1XB7 A;  4ONI A;  4G2H A;  3V3Q A;  3R8I A;  4L98 A;  2AXA A;  3PLZ A;  2QGT A;  1NHZ A;  1ILG A;  3V3E A;  4NQA B;  2ZY0 A;  1XV9 A;  3RVF A;  3M7R A;  5APH A;  2QA6 A;  2ZMI A;  3A3Z X;  2QPY A;  1FM9 D;  4EM9 A;  2P54 A;  4RUJ A;  5FQS A;  4RMD A;  1K4W A;  4IUI A;  5G5W A;  1RK3 A;  4XTA A;  3QT0 A;  5DMC A;  2OM9 A;  3X31 A;  5HZC A;  2NXX A;  5DWG A;  5JJM A;  3X1H A;  3PRG A;  3EYB A;  1T7T A;  3E00 A;  3OLS A;  3OZ0 A;  4FN9 A;  3ADU A;  5AAU A;  3HM1 A;  1PRG A;  3ZR7 A;  5GIE A;  4IS8 A;  2AM9 A;  3WTQ A;  4JYG A;  3VHV A;  4ZNU A;  2R40 D;  3FS1 A;  3PCU A;  4KZI A;  2P7A A;  3G0W A;  3B0T A;  4X1G A;  5A86 A;  2Q6R A;  3OS9 A;  4OEA A;  4OZR U;  3AZ1 A;  3ERD A;  1GWX A;  4IA1 A;  1OT7 A;  1YYE A;  3B0W A;  5APJ A;  3UVV B;  5DZI A;  4MGD A;  1MZN A;  1L2I A;  4ZNH A;  4ZO1 B;  3VSP A;  1NYX A;  5DID A;  3ADS A;  1FD0 A;  1YUC A;  2I4J A;  2HWR A;  4PF3 A;  3L03 A;  4XAO A;  3TKM A;  4RAK A;  2ZKC A;  1NRL A;  2E2R A;  2Q60 A;  2YLP A;  5DXB A;  3DZY A;  2FVJ A;  2ABI A;  2QA8 A;  2ZVT A;  2ZMJ A;  4MG9 A;  4OH5 A;  3AN4 A;  1NQ0 A;  1SQN A;  2NPA A;  3VT9 A;  2H79 A;  2Q5G A;  3ET3 A;  2AO6 A;  1PK5 A;  3V49 A;  1KKQ A;  1ZUC A;  4ZNW A;  1NUO A;  5GIC A;  4ZNV A;  5DWJ A;  1NDE A;  3PO9 A;  3CWD A;  2FAI A;  4OFU A;  3IXP A;  5DK9 A;  4ZJR A;  1Y9R A;  3OMQ A;  5DZH A;  4FHH A;  3VTD A;  1ZEO A;  1R20 A;  4LTW A;  3HOD A;  5KRO A;  1A52 A;  5KRA A;  5HYR A;  3L3Z A;  4UDC A;  3UP3 A;  5KCD A;  5EIT A;  5ETH A;  3DCU A;  3DZU D;  2QZO B;  4PP6 A;  2YLY A;  4ZN9 A;  1XQ3 A;  4OZT U;  2QNV A;  3MNE A;  3UVV A;  3R8A A;  3OMK A;  4JYI A;  1X7R A;  3FC6 B;  2YFE A;  3HO0 A;  5DZ1 A;  1Z5X U;  1QKT A;  1X7B A;  3FAL A;  5K13 A;  3KWY A;  2AWH A;  1M7W A;  1PCG A;  4O8F A;  1GWR A;  3OMM A;  2XHS A;  1T63 A;  5DXM A;  4YNK A;  2B50 A;  3OOK A;  2YAT A;  4J5X A;  4TV1 B;  3HZF A;  2Q6S A;  3AZ2 A;  1DKF A;  1OVL B;  1YA3 A;  2PIP L;  3AX8 A;  2OAX A;  2P7G A;  1UOM A;  4FNE A;  2OUZ A;  3RY9 A;  3AZ3 A;  3FXV A;  1I7I A;  3W0G A;  1E3K A;  1ERE A;  2HFP A;  3GBK A;  2HAM A;  5AZT A;  4UDA A;  2B1Z A;  4OED A;  2ZK0 A;  1KNU A;  3NOA A;  1T76 A;  2PRG A;  4LNW A;  3A40 X;  4RE8 A;  5DV8 A;  3VRV A;  3X1I A;  3AN3 A;  1MV9 A;  3SP6 A;  1T7M A;  5DV6 A;  3LMP A;  1S0X A;  2BJ4 B;  1QKM A;  1S9Q A;  2QMV A;  4OAR A;  3CTB A;  2AMB A;  4OZT E;  1LBD A;  5H1E A;  3W0H A;  4DM6 A;  5KRH A;  1IE8 A;  2AMA A;  1X7E A;  3D90 A;  3G8O A;  2W8Y A;  1Z5X E;  3D5F A;  3UUA B;  2Q7J A;  4LBD A;  2F4B A;  4ITE A;  3WFG A;  2GP7 A;  4WHG A;  2Q5S A;  3FC6 A;  4DOR A;  2G0G A;  3HLV A;  5DXR A;  4DK7 A;  2ZL9 A;  1N83 A;  4OC7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...