5HYRA

Estrogen receptor alpha ligand binding domain y537s mutant in complex with stapled peptide src2-sp2 and estradiol
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
243
structure length
231
Chain Sequence
ALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLSDLLLEMLDAHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Gene regulation
molecule keywords Estrogen receptor
publication title Stapled Peptides with gamma-Methylated Hydrocarbon Chains for the Estrogen Receptor/Coactivator Interaction.
pubmed doi rcsb
source organism Homo sapiens
total genus 85
structure length 231
sequence length 243
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 5hyrA00
4OZRU 5GIDA 2VV4A 1XAPA 2Q5SA 5DZIA 4MGAB 3E00A 5HJSA 2Q60A 2AXAA 5DIGA 1XV9B 4PPPA 5E15A 5M96A 2AA5A 1K74D 1RDTD 2AWHA 5DKGA 2VSTA 4MG5A 4UDDA 4N1YA 4OKXA 1PRGA 1U3QA 2AYRA 3G9EA 3VHWA 3B0WA 2JJ3A 3W5QA 1Y0XX 2E2RA 2HCDA 1R20D 3L3XA 1ILHA 4OLMA 4PPSA 4PP6A 3FURA 4DM6A 5AAVA 5E7VA 3ZR7A 1QKTA 1X78A 3CS6A 3PEQA 3VSPA 3ERDA 4RMDA 4X1FA 1G5YA 2P15A 2QA6A 3KMGA 4LNXA 5FQPA 4NY9A 3DZYA 1M7WA 4J24A 5F9BA 5HYKA 3KPZA 2HASA 2R40D 3L3ZA 5DUHA 5KCEA 2P1UA 5FQVA 3VT7A 5E0XA 2VSRA 5ACCA 1KV6A 5C4OA 3F5CB 3X1HA 3R2AA 3KMRA 1QKNA 2YFEA 2ZLAA 1Y0SA 2PINA 4MG9B 5C4SA 4OIVA 3PLZA 1U3RA 4R06A 3AFRA 4RE8A 1PZLA 1XLSA 4N73A 3UU7B 4OEYA 1ZH7A 1M2ZA 1OSVA 4PVUA 5L7HA 2YLYA 1XQCA 1G2NA 1FCYA 3AZ2A 1IE8A 4PRGA 1R1KA 1T7TA 1NRLA 1A28A 3LBDA 3WT6A 2AX7A 4OFRA 4POJA 1GWRA 2XHSA 4FN9A 3WJ4A 2ZL9A 2QXMA 3GD2A 2QABA 3K6PA 4OEDA 2QZOA 1UOMA 2VV1B 3OS8C 4K6IA 1HJ1A 4Q50A 3V3QA 3W0HA 3G8IA 2YJAB 1NQ2A 2ZK1A 1S0XA 5HYRA 1I38A 5JY3A 2I0JA 4ZJWA 2P54A 2GL8A 3HODA 3D24A 5DKSA 3L0EA 4WPFA 5DU5A 4IA2A 3H52A 3E94A 1XV9A 1MV9A 3CS8A 5AVIA 2ZXZA 4TUZB 5DI7A 5DKEA 3HZFA 3R5MA 3O1DA 4Q0AC 4E2JA 2PIQA 5DWEA 1KNUA 4PLEA 5KCCA 5KYJA 2QPYA 1G1UA 3ADSA 5L7EA 3DZUA 2PJLA 4E4KA 4JL4A 2QTUA 1SJ0A 1YOWA 3R8DA 2P1TA 1T76A 4MDDA 1UPVA 2P7GA 2AA6A 2AO6A 3K22A 2ZXNA 3R8IA 3RVFA 1YUCA 3IPSA 2J14A 2XYJA 3ET0A 3R5NA 4RWVA 2PNUA 4KZMA 3VT4A 1X7JA 4S0TA 5DV6A 3S9SA 1X7BA 1L2IA 1NYXA 1NAVA 3CDPA 5DSHA 4NQAB 3VN2A 3VRWA 3ADUA 3KDUA 4OGHA 1UHLA 5EJVA 3VRUA 2HBHA 4MG9A 4QE6A 2GWXA 5C4TA 1SR7A 2YLPA 3A40X 4XAOA 5SYZA 4ZI1A 5KROA 1XNNA 3ET2A 2Q61A 5AVLA 3FC6B 3M7RA 1I37A 4QK4A 3VJIA 5GT4A 2AM9A 2PIXA 4FNEA 2OVHA 2HB7A 3FLIA 5EI1A 5APJA 3KMZA 4QJRA 1XJ7A 4R6SA 3W0GA 3JZBA 3K23A 4ZN7A 2B23A 1N4HA 5DZ3A 2Q5PA 3WFGA 2ZK4A 3AN3A 2HAMA 4IUIA 5DVSA 5G43A 2VV1A 2ZK6A 4IVWA 4DOSA 1P8DA 4DMAA 3V9TA 2QNVA 1OT7A 3FEJA 2OUZA 2XYWA 1RK3A 1GWQA 1DB1A 4OK1A 3IPUA 2ATHA 1XVPB 2IHQA 4NUFA 4PP3A 3TKMA 2AMAA 1KKQA 1FCXA 5DWLA 5HJPB 4QE8A 4OZTU 2A3IA 5E1CA 2QSEA 1T74A 5DXMA 3UP3A 5DX3B 3NOAA 4TUZA 3GYUA 3F7DA 4J5WA 1YP0A 5FQSA 4TV1B 1XDKB 4RZEA 2QA8A 1NHZA 3P0UA 4IS8A 4G1DA 1X76A 3ZQTA 1NQ0A 4G21A 1XP1A 4IU7A 4OZTE 3VT6A 5L11A 3QT0A 3VJTA 3D6DA 4JAZA 3H0AD 3OOFA 3FS1A 2AMBA 2O9IA 3CDSA 1YINA 3B65A 1FD0A 3OLSA 2F4BA 4M8EA 4ZJRA 1FBYA 4YNKA 4MGCA 4OZRE 5G3JA 5AWKA 3U9QA 3WMHA 2G0GA 3HC5A 4RUPA 5DVCA 4IA3A 3AUQA 3W0IA 2ZMIA 3R8AA 1S9PA 2FVJA 3A9EB 2J7YA 4A2JA 4ZNVA 2BJ4B 1NQ1A 2QE4A 3OLFA 4OIUA 5CJ6A 2Q7KA 5G45A 3ZRBA 1TFCA 5JJMB 3EYBA 2Q1HA 1T5ZA 4EMAA 5DIEA 2FAIA 2H77A 2ZNNA 4MG7B 1M13A 2Q3YA 4ITFA 2ZVTA 4OJBA 1EREA 3IXPA 4RAKA 3D5FA 2I4PA 4PXMA 1X7EA 5AZVA 1ILGA 2P1VA 3OSAA 1YOKA 3B67A 3UUDB 3VI8A 3W0JA 3DY6A 5APHA 4A4WA 2Z4JA 3RUTA 4ZN9A 3VHVA 5G42A 3IPQA 2XKWA 4JYHA 1ERRA 1Z95A 4L98A 1ZGYA 1EXXA 1Q4XA 1MZNA 4MGDA 3W5PA 5B41A 4REEA 4WHFA 1XVPA 2QMVA 2Q7JA 4FHHA 5DXPA 5C4UA 3V9YA 5HJPA 5APKA 3W0CA 3VJSA 1FM9A 5L7GA 1FCZA 3GN8A 3UVVB 2OZ7A 4ZO1B 5KCFA 3KFCA 1E3GA 5DXGA 1QKUA 1T7FA 2AX9A 3A3ZX 5DX3A 2AA2A 3VRTA 5DMFA 1XDKA 4E4QA 5JI0D 4MGAA 3E00D 3V3EA 4JYIA 2FSZA 2ZASA 3G0WA 1PDUA 4OJ4A 3W5TA 4YMQA 2B50A 1L2JA 1S0ZA 3B0QA 2PITA 1I7GA 1XOWA 4LBDA 5HCVA 4DK8A 2J4AA 4N5GA 5KR9A 5GICA 4IV2A 4OEZA 2ACLB 2NXXA 2QR9A 3AUNA 3P89A 1R6GA 4FGYA 1S9QA 2ZK2A 2Q59B 1T65A 4POHA 4KZJA 2ZMHA 3L1BA 1G50A 3OGTA 5DTVA 5DWGA 3OOKA 4ZO1X 1RKHA 3P88A 5DVVA 3VHUA 4ONIA 3A9EA 1HG4A 1PQCA 5KCDA 3CS4A 3GZ9A 2BJ4A 1YY4A 2P7ZA 5AZTA 3B3KA 5LWPA 5KCTA 1DKFB 5EGVA 4UDAA 5JJMA 2AA7A 3B66A 4K7AA 4X1GA 2V0VA 5DUGA 3Q95B 5G46A 3RY9A 2HWQA 2ABIA 2JFAB 1RKGA 1ZKYA 2PIRA 2REWA 2YLQA 5LGAA 5GIEA 1WM0X 3F5CA 5DXQA 2ZK3A 3OLLA 4LSJA 1S19A 3PRGA 1XP9A 5AWJA 3UUDA 3WJ5A 2YATA 3IA6A 4IWCA 4WLBA 1K74A 1RDTA 2ZBSA 1H9UA 4J5XA 4IWFA 4S15A 3TX7B 3UU7A 1ZEOA 2GP7A 4P6WA 3VRVA 4RMEA 4PLDA 3OSIA 4WVDA 3B68A 4OKWA 5EHJA 3VTBA 4RMCA 1R20A 1NUOA 4IQRA 5DZ1A 2NW4A 4OH6A 3V9VA 3VTCA 4XHDA 5AAVB 4MG6A 4IVYA 4IW8A 5FQRA 3CTBA 3UVVA 5KRAA 2OAXA 3GBKA 3OMMA 3DCUA 2POBA 5E19A 5DZHA 2Q7IA 3TKCA 2R40A 1N46A 3NSPA 5ICKA 3CJWA 4DQMA 2H79A 2YHDA 4R2UA 3AZ3A 2PIOA 2PKLA 3ILZA 3KDTA 2ZLCA 3B0TA 1E3KA 3HM1A 5DXBB 4ITEA 4LTWA 3AN4A 3HQ5A 5AAUA 4K4JA 2OM9A 5DY8A 2P4YA 2QXSA 3FEIA 4S14A 1ZAFA 2ACLA 4DORA 5DIDA 4HEEX 3P8XA 1T63A 2Q59A 5KRKA 4OEAA 3CLDA 3DZUD 3V4AA 3WTQA 5DMCA 3ZRAA 2PRGA 4IW6A 2R6WA 4RUJA 1T7RA 3OAPA 3ADXA 4J5WC 1PK5A 1DKFA 1PCGA 2QZOB 4RZGA 2JF9A 1SQNA 2POGA 1XNXA 3Q95A 2JFAA 4OJ9A 2PIPL 2QGTA 4G20A 4S0SA 4CI5A 1EXAA 3ET1A 5DWIA 1U9EA 4OKBA 3OKIA 2ZXMA 4HLWA 5DYBA 2PIWA 3MNOA 3SP9A 2P7AA 3BQDA 5DWJA 5DL4A 1NAXA 3V49A 1N83A 2Q6RA 3W0YA 1UPWA 2B1VA 4XUMA 3FC6A 4MG8B 2V7CA 3FALB 4APUA 3OS9A 4JYGA 4KZIA 5IZ0A 3WT7A 3DT3A 1GS4A 3AURA 3VTDA 3G8OA 4NIEA 2HC4A 4OFUA 1XIUA 4YT1A 1ZUCA 2Z4BA 5FQTA 4ZNUA 2AAXA 2QGWA 3VSOA 3RLLA 3ERTA 2ZKCA 3AX8A 2QH6A 5AK2A 3VT3A 2EWPA 4IA1A 3PO9A 2IOGA 3X1IA 1XP6A 3WFFA 5I4VA 3BC5A 2I4ZA 4OARA 1QKMA 1VJBA 4Q13A 4RZFA 1XLSE 2ZK5A 3SZ1A 4Y29A 4L96A 2W8YA 3BEJA 1XB7A 3OMOA 4OKTA 5DUEA 2Q8SA 4G1ZA 4EM9A 5E14A 2ZNOA 3MNPA 5A86A 5DXBA 1FM6D 2GPPA 5DXEA 4MGBB 1UHLB 3VT8A 3KBAA 2Q1VA 2Q7LA 2VV3A 4G2HA 5KRJA 2Q70A 5KYAA 2OVMA 2PIUA 1MVCA 3RLJA 4B7WA 4G1YA 3CQVA 3UUAB 4TV1A 5EC9A 3OS8A 3CWDA 2ZNQA 2GPUA 3GWXA 1YJEA 4REFA 4ZNTA 4DM8A 4YPQA 3OSWA 2XYXA 3ET3A 3JZCA 4F9MA 5KRIA 2R6YA 5DK9A 4OHAA 4QM0A 1U3SA 2GIUA 3UP0A 1PQ6A 5DV8A 2VV2A 1A52A 3N00A 3ADTA 4RFWA 3HVLA 5KRMA 4UDBA 3OZJA 4O8FA 3VT5A 2GTKA 4UDCA 5DXKA 3IMYA 1R5KA 3R29A 4WQPA 3TY0A 4LNWA 5DYDA 2NXXE 3MNEA 5DRMA 5B5BA 1ZDTA 3B5RA 4DK7A 3OKHA 1OVLB 3DZYD 3L0JA 4FHIA 4BCRA 1GWXA 5KRFA 4XT9A 3WGPA 3HLVA 4J26A 2Q6JA 3D90A 3O1EA 3PCUA 4MG8A 3FALA 2HWRA 4MG7A 5KD9A 3IXPD 2I4JA 1T7MA 2LBDA 1X7RA 4N8RA 4XLDA 3GYTA 4PF3A 2GPOA 4IA7A 3WWRA 1SKXA 2VV4B 5IAWA 2QA8B 2Q6SA 3A2JA 1LV2A 2GPVA 2HFPA 2ZK0A 2HARA 3K8SA 4OC7A 4JGVA 3H0AA 4OILA 3L0LA 1YA3A 2AX8A 3OMQA 1R1KD 5DKBA 5DV3A 2G0HA 2O4RA 3OZ0A 5ETHA 5KRCA 5KRLA 1ZDUA 2O4JA 5HZCA 3B0RA 5DRJA 3GWSX 1K4WA 1YYEA 3B1MA 4J5XC 1FM9D 2IOKA 3D57A 1XZXX 1PQ9A 3FXVA 3LMPA 4RUOX 3X31A 4XI3A 3KWYA 2YJDA 5KCUA 4G2IA 4MGBA 3HO0A 4ZNHA 2ZNPA 2BAWA 3HC6A 1XQ3A 3UUCA 3SP6A 4CSJA 2PIVA 2NV7A 3KYTA 4IV4A 4PP5A 4ZNSA 4A4VA 2J7XA 1YIMA 2NPAA 3UUAA 5KCWA 3RUUA 1YMTA 3NSQA 1RJKA 4ZNWA 4NB6A 5IXKA 3ADWA 4QL8A 5E0WA 3OMKA 5EITA 1LBDA 2I0GA 2ZFXA 2Q5GA 3A78A 4PWLA 4CI4A 1Z5XU 2HB8A 5DP0A 5KRHA 1BSXA 1P93A 3T03A 1T79A 5K13A 3VJHA 3E7CA 3W0AA 3PBAA 1TXIA 1I7IA 5DLRA 1NDEA 3ADVA 3DCTA 2HVCA 4OH5A 3OMPA 3FUGA 1OSHA 2OCFA 4MGDB 5G5WA 2G5OA 5DXRA 2YLOA 4M8HA 4P6XA 3AZ1A 1OVLA 1NQ7A 1Z5XE 2B1ZA 2AX6A 3X36A 5AYGA 2G44A 3A2IA 3WT5A 4XUHA 1FM6A 1K7LA 3DR1A 4WHGA 1T73A 1IE9A 2VV0A 3VT9A 2ZMJA 4XTAA 3A2HA 2QW4A 1XPCA 2ZY0A 3L03A 5G44A 1Y9RA 2AB2A 3W5RA 4ZOMA 5H1EA 5DZ0A
chains in the Genus database with same CATH superfamily
4OZRU 5GIDA 2VV4A 1XAPA 2Q5SA 5DZIA 4MGAB 3E00A 5HJSA 2Q60A 2AXAA 5DIGA 1XV9B 4PPPA 5E15A 5M96A 2AA5A 1K74D 1RDTD 2AWHA 5DKGA 2VSTA 4MG5A 4UDDA 4N1YA 4OKXA 1PRGA 1U3QA 2AYRA 3G9EA 3VHWA 3B0WA 2JJ3A 3W5QA 1Y0XX 2E2RA 2HCDA 1R20D 3L3XA 1ILHA 4OLMA 4PPSA 4PP6A 3FURA 4DM6A 5AAVA 5E7VA 3ZR7A 1QKTA 1X78A 3CS6A 3PEQA 3VSPA 3ERDA 4RMDA 4X1FA 1G5YA 2P15A 2QA6A 3KMGA 4LNXA 5FQPA 4NY9A 3DZYA 1M7WA 4J24A 5F9BA 5HYKA 3KPZA 2HASA 2R40D 3L3ZA 5DUHA 5KCEA 2P1UA 5FQVA 3VT7A 5E0XA 2VSRA 5ACCA 1KV6A 5C4OA 3F5CB 3X1HA 3R2AA 3KMRA 1QKNA 2YFEA 2ZLAA 1Y0SA 2PINA 4MG9B 5C4SA 4OIVA 3PLZA 1U3RA 4R06A 3AFRA 4RE8A 1PZLA 1XLSA 4N73A 3UU7B 4OEYA 1ZH7A 1M2ZA 1OSVA 4PVUA 5L7HA 2YLYA 1XQCA 1G2NA 1FCYA 3AZ2A 1IE8A 4PRGA 1R1KA 1T7TA 1NRLA 1A28A 3LBDA 3WT6A 2AX7A 4OFRA 4POJA 1GWRA 2XHSA 4FN9A 3WJ4A 2ZL9A 2QXMA 3GD2A 2QABA 3K6PA 4OEDA 2QZOA 1UOMA 2VV1B 3OS8C 4K6IA 1HJ1A 4Q50A 3V3QA 3W0HA 3G8IA 2YJAB 1NQ2A 2ZK1A 1S0XA 5HYRA 1I38A 5JY3A 2I0JA 4ZJWA 2P54A 2GL8A 3HODA 3D24A 5DKSA 3L0EA 4WPFA 5DU5A 4IA2A 3H52A 3E94A 1XV9A 1MV9A 3CS8A 5AVIA 2ZXZA 4TUZB 5DI7A 5DKEA 3HZFA 3R5MA 3O1DA 4Q0AC 4E2JA 2PIQA 5DWEA 1KNUA 4PLEA 5KCCA 5KYJA 2QPYA 1G1UA 3ADSA 5L7EA 3DZUA 2PJLA 4E4KA 4JL4A 2QTUA 1SJ0A 1YOWA 3R8DA 2P1TA 1T76A 4MDDA 1UPVA 2P7GA 2AA6A 2AO6A 3K22A 2ZXNA 3R8IA 3RVFA 1YUCA 3IPSA 2J14A 2XYJA 3ET0A 3R5NA 4RWVA 2PNUA 4KZMA 3VT4A 1X7JA 4S0TA 5DV6A 3S9SA 1X7BA 1L2IA 1NYXA 1NAVA 3CDPA 5DSHA 4NQAB 3VN2A 3VRWA 3ADUA 3KDUA 4OGHA 1UHLA 5EJVA 3VRUA 2HBHA 4MG9A 4QE6A 2GWXA 5C4TA 1SR7A 2YLPA 3A40X 4XAOA 5SYZA 4ZI1A 5KROA 1XNNA 3ET2A 2Q61A 5AVLA 3FC6B 3M7RA 1I37A 4QK4A 3VJIA 5GT4A 2AM9A 2PIXA 4FNEA 2OVHA 2HB7A 3FLIA 5EI1A 5APJA 3KMZA 4QJRA 1XJ7A 4R6SA 3W0GA 3JZBA 3K23A 4ZN7A 2B23A 1N4HA 5DZ3A 2Q5PA 3WFGA 2ZK4A 3AN3A 2HAMA 4IUIA 5DVSA 5G43A 2VV1A 2ZK6A 4IVWA 4DOSA 1P8DA 4DMAA 3V9TA 2QNVA 1OT7A 3FEJA 2OUZA 2XYWA 1RK3A 1GWQA 1DB1A 4OK1A 3IPUA 2ATHA 1XVPB 2IHQA 4NUFA 4PP3A 3TKMA 2AMAA 1KKQA 1FCXA 5DWLA 5HJPB 4QE8A 4OZTU 2A3IA 5E1CA 2QSEA 1T74A 5DXMA 3UP3A 5DX3B 3NOAA 4TUZA 3GYUA 3F7DA 4J5WA 1YP0A 5FQSA 4TV1B 1XDKB 4RZEA 2QA8A 1NHZA 3P0UA 4IS8A 4G1DA 1X76A 3ZQTA 1NQ0A 4G21A 1XP1A 4IU7A 4OZTE 3VT6A 5L11A 3QT0A 3VJTA 3D6DA 4JAZA 3H0AD 3OOFA 3FS1A 2AMBA 2O9IA 3CDSA 1YINA 3B65A 1FD0A 3OLSA 2F4BA 4M8EA 4ZJRA 1FBYA 4YNKA 4MGCA 4OZRE 5G3JA 5AWKA 3U9QA 3WMHA 2G0GA 3HC5A 4RUPA 5DVCA 4IA3A 3AUQA 3W0IA 2ZMIA 3R8AA 1S9PA 2FVJA 3A9EB 2J7YA 4A2JA 4ZNVA 2BJ4B 1NQ1A 2QE4A 3OLFA 4OIUA 5CJ6A 2Q7KA 5G45A 3ZRBA 1TFCA 5JJMB 3EYBA 2Q1HA 1T5ZA 4EMAA 5DIEA 2FAIA 2H77A 2ZNNA 4MG7B 1M13A 2Q3YA 4ITFA 2ZVTA 4OJBA 1EREA 3IXPA 4RAKA 3D5FA 2I4PA 4PXMA 1X7EA 5AZVA 1ILGA 2P1VA 3OSAA 1YOKA 3B67A 3UUDB 3VI8A 3W0JA 3DY6A 5APHA 4A4WA 2Z4JA 3RUTA 4ZN9A 3VHVA 5G42A 3IPQA 2XKWA 4JYHA 1ERRA 1Z95A 4L98A 1ZGYA 1EXXA 1Q4XA 1MZNA 4MGDA 3W5PA 5B41A 4REEA 4WHFA 1XVPA 2QMVA 2Q7JA 4FHHA 5DXPA 5C4UA 3V9YA 5HJPA 5APKA 3W0CA 3VJSA 1FM9A 5L7GA 1FCZA 3GN8A 3UVVB 2OZ7A 4ZO1B 5KCFA 3KFCA 1E3GA 5DXGA 1QKUA 1T7FA 2AX9A 3A3ZX 5DX3A 2AA2A 3VRTA 5DMFA 1XDKA 4E4QA 5JI0D 4MGAA 3E00D 3V3EA 4JYIA 2FSZA 2ZASA 3G0WA 1PDUA 4OJ4A 3W5TA 4YMQA 2B50A 1L2JA 1S0ZA 3B0QA 2PITA 1I7GA 1XOWA 4LBDA 5HCVA 4DK8A 2J4AA 4N5GA 5KR9A 5GICA 4IV2A 4OEZA 2ACLB 2NXXA 2QR9A 3AUNA 3P89A 1R6GA 4FGYA 1S9QA 2ZK2A 2Q59B 1T65A 4POHA 4KZJA 2ZMHA 3L1BA 1G50A 3OGTA 5DTVA 5DWGA 3OOKA 4ZO1X 1RKHA 3P88A 5DVVA 3VHUA 4ONIA 3A9EA 1HG4A 1PQCA 5KCDA 3CS4A 3GZ9A 2BJ4A 1YY4A 2P7ZA 5AZTA 3B3KA 5LWPA 5KCTA 1DKFB 5EGVA 4UDAA 5JJMA 2AA7A 3B66A 4K7AA 4X1GA 2V0VA 5DUGA 3Q95B 5G46A 3RY9A 2HWQA 2ABIA 2JFAB 1RKGA 1ZKYA 2PIRA 2REWA 2YLQA 5LGAA 5GIEA 1WM0X 3F5CA 5DXQA 2ZK3A 3OLLA 4LSJA 1S19A 3PRGA 1XP9A 5AWJA 3UUDA 3WJ5A 2YATA 3IA6A 4IWCA 4WLBA 1K74A 1RDTA 2ZBSA 1H9UA 4J5XA 4IWFA 4S15A 3TX7B 3UU7A 1ZEOA 2GP7A 4P6WA 3VRVA 4RMEA 4PLDA 3OSIA 4WVDA 3B68A 4OKWA 5EHJA 3VTBA 4RMCA 1R20A 1NUOA 4IQRA 5DZ1A 2NW4A 4OH6A 3V9VA 3VTCA 4XHDA 5AAVB 4MG6A 4IVYA 4IW8A 5FQRA 3CTBA 3UVVA 5KRAA 2OAXA 3GBKA 3OMMA 3DCUA 2POBA 5E19A 5DZHA 2Q7IA 3TKCA 2R40A 1N46A 3NSPA 5ICKA 3CJWA 4DQMA 2H79A 2YHDA 4R2UA 3AZ3A 2PIOA 2PKLA 3ILZA 3KDTA 2ZLCA 3B0TA 1E3KA 3HM1A 5DXBB 4ITEA 4LTWA 3AN4A 3HQ5A 5AAUA 4K4JA 2OM9A 5DY8A 2P4YA 2QXSA 3FEIA 4S14A 1ZAFA 2ACLA 4DORA 5DIDA 4HEEX 3P8XA 1T63A 2Q59A 5KRKA 4OEAA 3CLDA 3DZUD 3V4AA 3WTQA 5DMCA 3ZRAA 2PRGA 4IW6A 2R6WA 4RUJA 1T7RA 3OAPA 3ADXA 4J5WC 1PK5A 1DKFA 1PCGA 2QZOB 4RZGA 2JF9A 1SQNA 2POGA 1XNXA 3Q95A 2JFAA 4OJ9A 2PIPL 2QGTA 4G20A 4S0SA 4CI5A 1EXAA 3ET1A 5DWIA 1U9EA 4OKBA 3OKIA 2ZXMA 4HLWA 5DYBA 2PIWA 3MNOA 3SP9A 2P7AA 3BQDA 5DWJA 5DL4A 1NAXA 3V49A 1N83A 2Q6RA 3W0YA 1UPWA 2B1VA 4XUMA 3FC6A 4MG8B 2V7CA 3FALB 4APUA 3OS9A 4JYGA 4KZIA 5IZ0A 3WT7A 3DT3A 1GS4A 3AURA 3VTDA 3G8OA 4NIEA 2HC4A 4OFUA 1XIUA 4YT1A 1ZUCA 2Z4BA 5FQTA 4ZNUA 2AAXA 2QGWA 3VSOA 3RLLA 3ERTA 2ZKCA 3AX8A 2QH6A 5AK2A 3VT3A 2EWPA 4IA1A 3PO9A 2IOGA 3X1IA 1XP6A 3WFFA 5I4VA 3BC5A 2I4ZA 4OARA 1QKMA 1VJBA 4Q13A 4RZFA 1XLSE 2ZK5A 3SZ1A 4Y29A 4L96A 2W8YA 3BEJA 1XB7A 3OMOA 4OKTA 5DUEA 2Q8SA 4G1ZA 4EM9A 5E14A 2ZNOA 3MNPA 5A86A 5DXBA 1FM6D 2GPPA 5DXEA 4MGBB 1UHLB 3VT8A 3KBAA 2Q1VA 2Q7LA 2VV3A 4G2HA 5KRJA 2Q70A 5KYAA 2OVMA 2PIUA 1MVCA 3RLJA 4B7WA 4G1YA 3CQVA 3UUAB 4TV1A 5EC9A 3OS8A 3CWDA 2ZNQA 2GPUA 3GWXA 1YJEA 4REFA 4ZNTA 4DM8A 4YPQA 3OSWA 2XYXA 3ET3A 3JZCA 4F9MA 5KRIA 2R6YA 5DK9A 4OHAA 4QM0A 1U3SA 2GIUA 3UP0A 1PQ6A 5DV8A 2VV2A 1A52A 3N00A 3ADTA 4RFWA 3HVLA 5KRMA 4UDBA 3OZJA 4O8FA 3VT5A 2GTKA 4UDCA 5DXKA 3IMYA 1R5KA 3R29A 4WQPA 3TY0A 4LNWA 5DYDA 2NXXE 3MNEA 5DRMA 5B5BA 1ZDTA 3B5RA 4DK7A 3OKHA 1OVLB 3DZYD 3L0JA 4FHIA 4BCRA 1GWXA 5KRFA 4XT9A 3WGPA 3HLVA 4J26A 2Q6JA 3D90A 3O1EA 3PCUA 4MG8A 3FALA 2HWRA 4MG7A 5KD9A 3IXPD 2I4JA 1T7MA 2LBDA 1X7RA 4N8RA 4XLDA 3GYTA 4PF3A 2GPOA 4IA7A 3WWRA 1SKXA 2VV4B 5IAWA 2QA8B 2Q6SA 3A2JA 1LV2A 2GPVA 2HFPA 2ZK0A 2HARA 3K8SA 4OC7A 4JGVA 3H0AA 4OILA 3L0LA 1YA3A 2AX8A 3OMQA 1R1KD 5DKBA 5DV3A 2G0HA 2O4RA 3OZ0A 5ETHA 5KRCA 5KRLA 1ZDUA 2O4JA 5HZCA 3B0RA 5DRJA 3GWSX 1K4WA 1YYEA 3B1MA 4J5XC 1FM9D 2IOKA 3D57A 1XZXX 1PQ9A 3FXVA 3LMPA 4RUOX 3X31A 4XI3A 3KWYA 2YJDA 5KCUA 4G2IA 4MGBA 3HO0A 4ZNHA 2ZNPA 2BAWA 3HC6A 1XQ3A 3UUCA 3SP6A 4CSJA 2PIVA 2NV7A 3KYTA 4IV4A 4PP5A 4ZNSA 4A4VA 2J7XA 1YIMA 2NPAA 3UUAA 5KCWA 3RUUA 1YMTA 3NSQA 1RJKA 4ZNWA 4NB6A 5IXKA 3ADWA 4QL8A 5E0WA 3OMKA 5EITA 1LBDA 2I0GA 2ZFXA 2Q5GA 3A78A 4PWLA 4CI4A 1Z5XU 2HB8A 5DP0A 5KRHA 1BSXA 1P93A 3T03A 1T79A 5K13A 3VJHA 3E7CA 3W0AA 3PBAA 1TXIA 1I7IA 5DLRA 1NDEA 3ADVA 3DCTA 2HVCA 4OH5A 3OMPA 3FUGA 1OSHA 2OCFA 4MGDB 5G5WA 2G5OA 5DXRA 2YLOA 4M8HA 4P6XA 3AZ1A 1OVLA 1NQ7A 1Z5XE 2B1ZA 2AX6A 3X36A 5AYGA 2G44A 3A2IA 3WT5A 4XUHA 1FM6A 1K7LA 3DR1A 4WHGA 1T73A 1IE9A 2VV0A 3VT9A 2ZMJA 4XTAA 3A2HA 2QW4A 1XPCA 2ZY0A 3L03A 5G44A 1Y9RA 2AB2A 3W5RA 4ZOMA 5H1EA 5DZ0A
chains in the Genus database with same CATH topology
4OZRU 5GIDA 2VV4A 1XAPA 2Q5SA 5DZIA 4MGAB 3E00A 5HJSA 2Q60A 2AXAA 5DIGA 1XV9B 4PPPA 5E15A 5M96A 2AA5A 1K74D 1RDTD 2AWHA 5DKGA 2VSTA 4MG5A 4UDDA 4N1YA 4OKXA 1PRGA 1U3QA 2AYRA 3G9EA 3VHWA 3B0WA 2JJ3A 3W5QA 1Y0XX 2E2RA 2HCDA 1R20D 3L3XA 1ILHA 4OLMA 4PPSA 4PP6A 3FURA 4DM6A 5AAVA 5E7VA 3ZR7A 1QKTA 1X78A 3CS6A 3PEQA 3VSPA 3ERDA 4RMDA 4X1FA 1G5YA 2P15A 2QA6A 3KMGA 4LNXA 5FQPA 4NY9A 3DZYA 1M7WA 4J24A 5F9BA 5HYKA 3KPZA 2HASA 2R40D 3L3ZA 5DUHA 5KCEA 2P1UA 5FQVA 3VT7A 5E0XA 2VSRA 5ACCA 1KV6A 5C4OA 3F5CB 3X1HA 3R2AA 3KMRA 1QKNA 2YFEA 2ZLAA 1Y0SA 2PINA 4MG9B 5C4SA 4OIVA 3PLZA 1U3RA 4R06A 3AFRA 4RE8A 1PZLA 1XLSA 4N73A 3UU7B 4OEYA 1ZH7A 1M2ZA 1OSVA 4PVUA 5L7HA 2YLYA 1XQCA 1G2NA 1FCYA 3AZ2A 1IE8A 4PRGA 1R1KA 1T7TA 1NRLA 1A28A 3LBDA 3WT6A 2AX7A 4OFRA 4POJA 1GWRA 2XHSA 4FN9A 3WJ4A 2ZL9A 2QXMA 3GD2A 2QABA 3K6PA 4OEDA 2QZOA 1UOMA 2VV1B 3OS8C 4K6IA 1HJ1A 4Q50A 3V3QA 3W0HA 3G8IA 2YJAB 1NQ2A 2ZK1A 1S0XA 5HYRA 1I38A 5JY3A 2I0JA 4ZJWA 2P54A 2GL8A 3HODA 3D24A 5DKSA 3L0EA 4WPFA 5DU5A 4IA2A 3H52A 3E94A 1XV9A 1MV9A 3CS8A 5AVIA 2ZXZA 4TUZB 5DI7A 5DKEA 3HZFA 3R5MA 3O1DA 4Q0AC 4E2JA 2PIQA 5DWEA 1KNUA 4PLEA 5KCCA 5KYJA 2QPYA 1G1UA 3ADSA 5L7EA 3DZUA 2PJLA 4E4KA 4JL4A 2QTUA 1SJ0A 1YOWA 3R8DA 2P1TA 1T76A 4MDDA 1UPVA 2P7GA 2AA6A 2AO6A 3K22A 2ZXNA 3R8IA 3RVFA 1YUCA 3IPSA 2J14A 2XYJA 3ET0A 3R5NA 4RWVA 2PNUA 4KZMA 3VT4A 1X7JA 4S0TA 5DV6A 3S9SA 1X7BA 1L2IA 1NYXA 1NAVA 3CDPA 5DSHA 4NQAB 3VN2A 3VRWA 3ADUA 3KDUA 4OGHA 1UHLA 5EJVA 3VRUA 2HBHA 4MG9A 4QE6A 2GWXA 5C4TA 1SR7A 2YLPA 3A40X 4XAOA 5SYZA 4ZI1A 5KROA 1XNNA 3ET2A 2Q61A 5AVLA 3FC6B 3M7RA 1I37A 4QK4A 3VJIA 5GT4A 2AM9A 2PIXA 4FNEA 2OVHA 2HB7A 3FLIA 5EI1A 5APJA 3KMZA 4QJRA 1XJ7A 4R6SA 3W0GA 3JZBA 3K23A 4ZN7A 2B23A 1N4HA 5DZ3A 2Q5PA 3WFGA 2ZK4A 3AN3A 2HAMA 4IUIA 5DVSA 5G43A 2VV1A 2ZK6A 4IVWA 4DOSA 1P8DA 4DMAA 3V9TA 2QNVA 1OT7A 3FEJA 2OUZA 2XYWA 1RK3A 1GWQA 1DB1A 4OK1A 3IPUA 2ATHA 1XVPB 2IHQA 4NUFA 4PP3A 3TKMA 2AMAA 1KKQA 1FCXA 5DWLA 5HJPB 4QE8A 4OZTU 2A3IA 5E1CA 2QSEA 1T74A 5DXMA 3UP3A 5DX3B 3NOAA 4TUZA 3GYUA 3F7DA 4J5WA 1YP0A 5FQSA 4TV1B 1XDKB 4RZEA 2QA8A 1NHZA 3P0UA 4IS8A 4G1DA 1X76A 3ZQTA 1NQ0A 4G21A 1XP1A 4IU7A 4OZTE 3VT6A 5L11A 3QT0A 3VJTA 3D6DA 4JAZA 3H0AD 3OOFA 3FS1A 2AMBA 2O9IA 3CDSA 1YINA 3B65A 1FD0A 3OLSA 2F4BA 4M8EA 4ZJRA 1FBYA 4YNKA 4MGCA 4OZRE 5G3JA 5AWKA 3U9QA 3WMHA 2G0GA 3HC5A 4RUPA 5DVCA 4IA3A 3AUQA 3W0IA 2ZMIA 3R8AA 1S9PA 2FVJA 3A9EB 2J7YA 4A2JA 4ZNVA 2BJ4B 1NQ1A 2QE4A 3OLFA 4OIUA 5CJ6A 2Q7KA 5G45A 3ZRBA 1TFCA 5JJMB 3EYBA 2Q1HA 1T5ZA 4EMAA 5DIEA 2FAIA 2H77A 2ZNNA 4MG7B 1M13A 2Q3YA 4ITFA 2ZVTA 4OJBA 1EREA 3IXPA 4RAKA 3D5FA 2I4PA 4PXMA 1X7EA 5AZVA 1ILGA 2P1VA 3OSAA 1YOKA 3B67A 3UUDB 3VI8A 3W0JA 3DY6A 5APHA 4A4WA 2Z4JA 3RUTA 4ZN9A 3VHVA 5G42A 3IPQA 2XKWA 4JYHA 1ERRA 1Z95A 4L98A 1ZGYA 1EXXA 1Q4XA 1MZNA 4MGDA 3W5PA 5B41A 4REEA 4WHFA 1XVPA 2QMVA 2Q7JA 4FHHA 5DXPA 5C4UA 3V9YA 5HJPA 5APKA 3W0CA 3VJSA 1FM9A 5L7GA 1FCZA 3GN8A 3UVVB 2OZ7A 4ZO1B 5KCFA 3KFCA 1E3GA 5DXGA 1QKUA 1T7FA 2AX9A 3A3ZX 5DX3A 2AA2A 3VRTA 5DMFA 1XDKA 4E4QA 5JI0D 4MGAA 3E00D 3V3EA 4JYIA 2FSZA 2ZASA 3G0WA 1PDUA 4OJ4A 3W5TA 4YMQA 2B50A 1L2JA 1S0ZA 3B0QA 2PITA 1I7GA 1XOWA 4LBDA 5HCVA 4DK8A 2J4AA 4N5GA 5KR9A 5GICA 4IV2A 4OEZA 2ACLB 2NXXA 2QR9A 3AUNA 3P89A 1R6GA 4FGYA 1S9QA 2ZK2A 2Q59B 1T65A 4POHA 4KZJA 2ZMHA 3L1BA 1G50A 3OGTA 5DTVA 5DWGA 3OOKA 4ZO1X 1RKHA 3P88A 5DVVA 3VHUA 4ONIA 3A9EA 1HG4A 1PQCA 5KCDA 3CS4A 3GZ9A 2BJ4A 1YY4A 2P7ZA 5AZTA 3B3KA 5LWPA 5KCTA 1DKFB 5EGVA 4UDAA 5JJMA 2AA7A 3B66A 4K7AA 4X1GA 2V0VA 5DUGA 3Q95B 5G46A 3RY9A 2HWQA 2ABIA 2JFAB 1RKGA 1ZKYA 2PIRA 2REWA 2YLQA 5LGAA 5GIEA 1WM0X 3F5CA 5DXQA 2ZK3A 3OLLA 4LSJA 1S19A 3PRGA 1XP9A 5AWJA 3UUDA 3WJ5A 2YATA 3IA6A 4IWCA 4WLBA 1K74A 1RDTA 2ZBSA 1H9UA 4J5XA 4IWFA 4S15A 3TX7B 3UU7A 1ZEOA 2GP7A 4P6WA 3VRVA 4RMEA 4PLDA 3OSIA 4WVDA 3B68A 4OKWA 5EHJA 3VTBA 4RMCA 1R20A 1NUOA 4IQRA 5DZ1A 2NW4A 4OH6A 3V9VA 3VTCA 4XHDA 5AAVB 4MG6A 4IVYA 4IW8A 5FQRA 3CTBA 3UVVA 5KRAA 2OAXA 3GBKA 3OMMA 3DCUA 2POBA 5E19A 5DZHA 2Q7IA 3TKCA 2R40A 1N46A 3NSPA 5ICKA 3CJWA 4DQMA 2H79A 2YHDA 4R2UA 3AZ3A 2PIOA 2PKLA 3ILZA 3KDTA 2ZLCA 3B0TA 1E3KA 3HM1A 5DXBB 4ITEA 4LTWA 3AN4A 3HQ5A 5AAUA 4K4JA 2OM9A 5DY8A 2P4YA 2QXSA 3FEIA 4S14A 1ZAFA 2ACLA 4DORA 5DIDA 4HEEX 3P8XA 1T63A 2Q59A 5KRKA 4OEAA 3CLDA 3DZUD 3V4AA 3WTQA 5DMCA 3ZRAA 2PRGA 4IW6A 2R6WA 4RUJA 1T7RA 3OAPA 3ADXA 4J5WC 1PK5A 1DKFA 1PCGA 2QZOB 4RZGA 2JF9A 1SQNA 2POGA 1XNXA 3Q95A 2JFAA 4OJ9A 2PIPL 2QGTA 4G20A 4S0SA 4CI5A 1EXAA 3ET1A 5DWIA 1U9EA 4OKBA 3OKIA 2ZXMA 4HLWA 5DYBA 2PIWA 3MNOA 3SP9A 2P7AA 3BQDA 5DWJA 5DL4A 1NAXA 3V49A 1N83A 2Q6RA 3W0YA 1UPWA 2B1VA 4XUMA 3FC6A 4MG8B 2V7CA 3FALB 4APUA 3OS9A 4JYGA 4KZIA 5IZ0A 3WT7A 3DT3A 1GS4A 3AURA 3VTDA 3G8OA 4NIEA 2HC4A 4OFUA 1XIUA 4YT1A 1ZUCA 2Z4BA 5FQTA 4ZNUA 2AAXA 2QGWA 3VSOA 3RLLA 3ERTA 2ZKCA 3AX8A 2QH6A 5AK2A 3VT3A 2EWPA 4IA1A 3PO9A 2IOGA 3X1IA 1XP6A 3WFFA 5I4VA 3BC5A 2I4ZA 4OARA 1QKMA 1VJBA 4Q13A 4RZFA 1XLSE 2ZK5A 3SZ1A 4Y29A 4L96A 2W8YA 3BEJA 1XB7A 3OMOA 4OKTA 5DUEA 2Q8SA 4G1ZA 4EM9A 5E14A 2ZNOA 3MNPA 5A86A 5DXBA 1FM6D 2GPPA 5DXEA 4MGBB 1UHLB 3VT8A 3KBAA 2Q1VA 2Q7LA 2VV3A 4G2HA 5KRJA 2Q70A 5KYAA 2OVMA 2PIUA 1MVCA 3RLJA 4B7WA 4G1YA 3CQVA 3UUAB 4TV1A 5EC9A 3OS8A 3CWDA 2ZNQA 2GPUA 3GWXA 1YJEA 4REFA 4ZNTA 4DM8A 4YPQA 3OSWA 2XYXA 3ET3A 3JZCA 4F9MA 5KRIA 2R6YA 5DK9A 4OHAA 4QM0A 1U3SA 2GIUA 3UP0A 1PQ6A 5DV8A 2VV2A 1A52A 3N00A 3ADTA 4RFWA 3HVLA 5KRMA 4UDBA 3OZJA 4O8FA 3VT5A 2GTKA 4UDCA 5DXKA 3IMYA 1R5KA 3R29A 4WQPA 3TY0A 4LNWA 5DYDA 2NXXE 3MNEA 5DRMA 5B5BA 1ZDTA 3B5RA 4DK7A 3OKHA 1OVLB 3DZYD 3L0JA 4FHIA 4BCRA 1GWXA 5KRFA 4XT9A 3WGPA 3HLVA 4J26A 2Q6JA 3D90A 3O1EA 3PCUA 4MG8A 3FALA 2HWRA 4MG7A 5KD9A 3IXPD 2I4JA 1T7MA 2LBDA 1X7RA 4N8RA 4XLDA 3GYTA 4PF3A 2GPOA 4IA7A 3WWRA 1SKXA 2VV4B 5IAWA 2QA8B 2Q6SA 3A2JA 1LV2A 2GPVA 2HFPA 2ZK0A 2HARA 3K8SA 4OC7A 4JGVA 3H0AA 4OILA 3L0LA 1YA3A 2AX8A 3OMQA 1R1KD 5DKBA 5DV3A 2G0HA 2O4RA 3OZ0A 5ETHA 5KRCA 5KRLA 1ZDUA 2O4JA 5HZCA 3B0RA 5DRJA 3GWSX 1K4WA 1YYEA 3B1MA 4J5XC 1FM9D 2IOKA 3D57A 1XZXX 1PQ9A 3FXVA 3LMPA 4RUOX 3X31A 4XI3A 3KWYA 2YJDA 5KCUA 4G2IA 4MGBA 3HO0A 4ZNHA 2ZNPA 2BAWA 3HC6A 1XQ3A 3UUCA 3SP6A 4CSJA 2PIVA 2NV7A 3KYTA 4IV4A 4PP5A 4ZNSA 4A4VA 2J7XA 1YIMA 2NPAA 3UUAA 5KCWA 3RUUA 1YMTA 3NSQA 1RJKA 4ZNWA 4NB6A 5IXKA 3ADWA 4QL8A 5E0WA 3OMKA 5EITA 1LBDA 2I0GA 2ZFXA 2Q5GA 3A78A 4PWLA 4CI4A 1Z5XU 2HB8A 5DP0A 5KRHA 1BSXA 1P93A 3T03A 1T79A 5K13A 3VJHA 3E7CA 3W0AA 3PBAA 1TXIA 1I7IA 5DLRA 1NDEA 3ADVA 3DCTA 2HVCA 4OH5A 3OMPA 3FUGA 1OSHA 2OCFA 4MGDB 5G5WA 2G5OA 5DXRA 2YLOA 4M8HA 4P6XA 3AZ1A 1OVLA 1NQ7A 1Z5XE 2B1ZA 2AX6A 3X36A 5AYGA 2G44A 3A2IA 3WT5A 4XUHA 1FM6A 1K7LA 3DR1A 4WHGA 1T73A 1IE9A 2VV0A 3VT9A 2ZMJA 4XTAA 3A2HA 2QW4A 1XPCA 2ZY0A 3L03A 5G44A 1Y9RA 2AB2A 3W5RA 4ZOMA 5H1EA 5DZ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OZR U;  5GID A;  2VV4 A;  1XAP A;  2Q5S A;  5DZI A;  4MGA B;  3E00 A;  5HJS A;  2Q60 A;  2AXA A;  5DIG A;  1XV9 B;  4PPP A;  5E15 A;  5M96 A;  2AA5 A;  1K74 D;  1RDT D;  2AWH A;  5DKG A;  2VST A;  4MG5 A;  4UDD A;  4N1Y A;  4OKX A;  1PRG A;  1U3Q A;  2AYR A;  3G9E A;  3VHW A;  3B0W A;  2JJ3 A;  3W5Q A;  1Y0X X;  2E2R A;  2HCD A;  1R20 D;  3L3X A;  1ILH A;  4OLM A;  4PPS A;  4PP6 A;  3FUR A;  4DM6 A;  5AAV A;  5E7V A;  3ZR7 A;  1QKT A;  1X78 A;  3CS6 A;  3PEQ A;  3VSP A;  3ERD A;  4RMD A;  4X1F A;  1G5Y A;  2P15 A;  2QA6 A;  3KMG A;  4LNX A;  5FQP A;  4NY9 A;  3DZY A;  1M7W A;  4J24 A;  5F9B A;  5HYK A;  3KPZ A;  2HAS A;  2R40 D;  3L3Z A;  5DUH A;  5KCE A;  2P1U A;  5FQV A;  3VT7 A;  5E0X A;  2VSR A;  5ACC A;  1KV6 A;  5C4O A;  3F5C B;  3X1H A;  3R2A A;  3KMR A;  1QKN A;  2YFE A;  2ZLA A;  1Y0S A;  2PIN A;  4MG9 B;  5C4S A;  4OIV A;  3PLZ A;  1U3R A;  4R06 A;  3AFR A;  4RE8 A;  1PZL A;  1XLS A;  4N73 A;  3UU7 B;  4OEY A;  1ZH7 A;  1M2Z A;  1OSV A;  4PVU A;  5L7H A;  2YLY A;  1XQC A;  1G2N A;  1FCY A;  3AZ2 A;  1IE8 A;  4PRG A;  1R1K A;  1T7T A;  1NRL A;  1A28 A;  3LBD A;  3WT6 A;  2AX7 A;  4OFR A;  4POJ A;  1GWR A;  2XHS A;  4FN9 A;  3WJ4 A;  2ZL9 A;  2QXM A;  3GD2 A;  2QAB A;  3K6P A;  4OED A;  2QZO A;  1UOM A;  2VV1 B;  3OS8 C;  4K6I A;  1HJ1 A;  4Q50 A;  3V3Q A;  3W0H A;  3G8I A;  2YJA B;  1NQ2 A;  2ZK1 A;  1S0X A;  5HYR A;  1I38 A;  5JY3 A;  2I0J A;  4ZJW A;  2P54 A;  2GL8 A;  3HOD A;  3D24 A;  5DKS A;  3L0E A;  4WPF A;  5DU5 A;  4IA2 A;  3H52 A;  3E94 A;  1XV9 A;  1MV9 A;  3CS8 A;  5AVI A;  2ZXZ A;  4TUZ B;  5DI7 A;  5DKE A;  3HZF A;  3R5M A;  3O1D A;  4Q0A C;  4E2J A;  2PIQ A;  5DWE A;  1KNU A;  4PLE A;  5KCC A;  5KYJ A;  2QPY A;  1G1U A;  3ADS A;  5L7E A;  3DZU A;  2PJL A;  4E4K A;  4JL4 A;  2QTU A;  1SJ0 A;  1YOW A;  3R8D A;  2P1T A;  1T76 A;  4MDD A;  1UPV A;  2P7G A;  2AA6 A;  2AO6 A;  3K22 A;  2ZXN A;  3R8I A;  3RVF A;  1YUC A;  3IPS A;  2J14 A;  2XYJ A;  3ET0 A;  3R5N A;  4RWV A;  2PNU A;  4KZM A;  3VT4 A;  1X7J A;  4S0T A;  5DV6 A;  3S9S A;  1X7B A;  1L2I A;  1NYX A;  1NAV A;  3CDP A;  5DSH A;  4NQA B;  3VN2 A;  3VRW A;  3ADU A;  3KDU A;  4OGH A;  1UHL A;  5EJV A;  3VRU A;  2HBH A;  4MG9 A;  4QE6 A;  2GWX A;  5C4T A;  1SR7 A;  2YLP A;  3A40 X;  4XAO A;  5SYZ A;  4ZI1 A;  5KRO A;  1XNN A;  3ET2 A;  2Q61 A;  5AVL A;  3FC6 B;  3M7R A;  1I37 A;  4QK4 A;  3VJI A;  5GT4 A;  2AM9 A;  2PIX A;  4FNE A;  2OVH A;  2HB7 A;  3FLI A;  5EI1 A;  5APJ A;  3KMZ A;  4QJR A;  1XJ7 A;  4R6S A;  3W0G A;  3JZB A;  3K23 A;  4ZN7 A;  2B23 A;  1N4H A;  5DZ3 A;  2Q5P A;  3WFG A;  2ZK4 A;  3AN3 A;  2HAM A;  4IUI A;  5DVS A;  5G43 A;  2VV1 A;  2ZK6 A;  4IVW A;  4DOS A;  1P8D A;  4DMA A;  3V9T A;  2QNV A;  1OT7 A;  3FEJ A;  2OUZ A;  2XYW A;  1RK3 A;  1GWQ A;  1DB1 A;  4OK1 A;  3IPU A;  2ATH A;  1XVP B;  2IHQ A;  4NUF A;  4PP3 A;  3TKM A;  2AMA A;  1KKQ A;  1FCX A;  5DWL A;  5HJP B;  4QE8 A;  4OZT U;  2A3I A;  5E1C A;  2QSE A;  1T74 A;  5DXM A;  3UP3 A;  5DX3 B;  3NOA A;  4TUZ A;  3GYU A;  3F7D A;  4J5W A;  1YP0 A;  5FQS A;  4TV1 B;  1XDK B;  4RZE A;  2QA8 A;  1NHZ A;  3P0U A;  4IS8 A;  4G1D A;  1X76 A;  3ZQT A;  1NQ0 A;  4G21 A;  1XP1 A;  4IU7 A;  4OZT E;  3VT6 A;  5L11 A;  3QT0 A;  3VJT A;  3D6D A;  4JAZ A;  3H0A D;  3OOF A;  3FS1 A;  2AMB A;  2O9I A;  3CDS A;  1YIN A;  3B65 A;  1FD0 A;  3OLS A;  2F4B A;  4M8E A;  4ZJR A;  1FBY A;  4YNK A;  4MGC A;  4OZR E;  5G3J A;  5AWK A;  3U9Q A;  3WMH A;  2G0G A;  3HC5 A;  4RUP A;  5DVC A;  4IA3 A;  3AUQ A;  3W0I A;  2ZMI A;  3R8A A;  1S9P A;  2FVJ A;  3A9E B;  2J7Y A;  4A2J A;  4ZNV A;  2BJ4 B;  1NQ1 A;  2QE4 A;  3OLF A;  4OIU A;  5CJ6 A;  2Q7K A;  5G45 A;  3ZRB A;  1TFC A;  5JJM B;  3EYB A;  2Q1H A;  1T5Z A;  4EMA A;  5DIE A;  2FAI A;  2H77 A;  2ZNN A;  4MG7 B;  1M13 A;  2Q3Y A;  4ITF A;  2ZVT A;  4OJB A;  1ERE A;  3IXP A;  4RAK A;  3D5F A;  2I4P A;  4PXM A;  1X7E A;  5AZV A;  1ILG A;  2P1V A;  3OSA A;  1YOK A;  3B67 A;  3UUD B;  3VI8 A;  3W0J A;  3DY6 A;  5APH A;  4A4W A;  2Z4J A;  3RUT A;  4ZN9 A;  3VHV A;  5G42 A;  3IPQ A;  2XKW A;  4JYH A;  1ERR A;  1Z95 A;  4L98 A;  1ZGY A;  1EXX A;  1Q4X A;  1MZN A;  4MGD A;  3W5P A;  5B41 A;  4REE A;  4WHF A;  1XVP A;  2QMV A;  2Q7J A;  4FHH A;  5DXP A;  5C4U A;  3V9Y A;  5HJP A;  5APK A;  3W0C A;  3VJS A;  1FM9 A;  5L7G A;  1FCZ A;  3GN8 A;  3UVV B;  2OZ7 A;  4ZO1 B;  5KCF A;  3KFC A;  1E3G A;  5DXG A;  1QKU A;  1T7F A;  2AX9 A;  3A3Z X;  5DX3 A;  2AA2 A;  3VRT A;  5DMF A;  1XDK A;  4E4Q A;  5JI0 D;  4MGA A;  3E00 D;  3V3E A;  4JYI A;  2FSZ A;  2ZAS A;  3G0W A;  1PDU A;  4OJ4 A;  3W5T A;  4YMQ A;  2B50 A;  1L2J A;  1S0Z A;  3B0Q A;  2PIT A;  1I7G A;  1XOW A;  4LBD A;  5HCV A;  4DK8 A;  2J4A A;  4N5G A;  5KR9 A;  5GIC A;  4IV2 A;  4OEZ A;  2ACL B;  2NXX A;  2QR9 A;  3AUN A;  3P89 A;  1R6G A;  4FGY A;  1S9Q A;  2ZK2 A;  2Q59 B;  1T65 A;  4POH A;  4KZJ A;  2ZMH A;  3L1B A;  1G50 A;  3OGT A;  5DTV A;  5DWG A;  3OOK A;  4ZO1 X;  1RKH A;  3P88 A;  5DVV A;  3VHU A;  4ONI A;  3A9E A;  1HG4 A;  1PQC A;  5KCD A;  3CS4 A;  3GZ9 A;  2BJ4 A;  1YY4 A;  2P7Z A;  5AZT A;  3B3K A;  5LWP A;  5KCT A;  1DKF B;  5EGV A;  4UDA A;  5JJM A;  2AA7 A;  3B66 A;  4K7A A;  4X1G A;  2V0V A;  5DUG A;  3Q95 B;  5G46 A;  3RY9 A;  2HWQ A;  2ABI A;  2JFA B;  1RKG A;  1ZKY A;  2PIR A;  2REW A;  2YLQ A;  5LGA A;  5GIE A;  1WM0 X;  3F5C A;  5DXQ A;  2ZK3 A;  3OLL A;  4LSJ A;  1S19 A;  3PRG A;  1XP9 A;  5AWJ A;  3UUD A;  3WJ5 A;  2YAT A;  3IA6 A;  4IWC A;  4WLB A;  1K74 A;  1RDT A;  2ZBS A;  1H9U A;  4J5X A;  4IWF A;  4S15 A;  3TX7 B;  3UU7 A;  1ZEO A;  2GP7 A;  4P6W A;  3VRV A;  4RME A;  4PLD A;  3OSI A;  4WVD A;  3B68 A;  4OKW A;  5EHJ A;  3VTB A;  4RMC A;  1R20 A;  1NUO A;  4IQR A;  5DZ1 A;  2NW4 A;  4OH6 A;  3V9V A;  3VTC A;  4XHD A;  5AAV B;  4MG6 A;  4IVY A;  4IW8 A;  5FQR A;  3CTB A;  3UVV A;  5KRA A;  2OAX A;  3GBK A;  3OMM A;  3DCU A;  2POB A;  5E19 A;  5DZH A;  2Q7I A;  3TKC A;  2R40 A;  1N46 A;  3NSP A;  5ICK A;  3CJW A;  4DQM A;  2H79 A;  2YHD A;  4R2U A;  3AZ3 A;  2PIO A;  2PKL A;  3ILZ A;  3KDT A;  2ZLC A;  3B0T A;  1E3K A;  3HM1 A;  5DXB B;  4ITE A;  4LTW A;  3AN4 A;  3HQ5 A;  5AAU A;  4K4J A;  2OM9 A;  5DY8 A;  2P4Y A;  2QXS A;  3FEI A;  4S14 A;  1ZAF A;  2ACL A;  4DOR A;  5DID A;  4HEE X;  3P8X A;  1T63 A;  2Q59 A;  5KRK A;  4OEA A;  3CLD A;  3DZU D;  3V4A A;  3WTQ A;  5DMC A;  3ZRA A;  2PRG A;  4IW6 A;  2R6W A;  4RUJ A;  1T7R A;  3OAP A;  3ADX A;  4J5W C;  1PK5 A;  1DKF A;  1PCG A;  2QZO B;  4RZG A;  2JF9 A;  1SQN A;  2POG A;  1XNX A;  3Q95 A;  2JFA A;  4OJ9 A;  2PIP L;  2QGT A;  4G20 A;  4S0S A;  4CI5 A;  1EXA A;  3ET1 A;  5DWI A;  1U9E A;  4OKB A;  3OKI A;  2ZXM A;  4HLW A;  5DYB A;  2PIW A;  3MNO A;  3SP9 A;  2P7A A;  3BQD A;  5DWJ A;  5DL4 A;  1NAX A;  3V49 A;  1N83 A;  2Q6R A;  3W0Y A;  1UPW A;  2B1V A;  4XUM A;  3FC6 A;  4MG8 B;  2V7C A;  3FAL B;  4APU A;  3OS9 A;  4JYG A;  4KZI A;  5IZ0 A;  3WT7 A;  3DT3 A;  1GS4 A;  3AUR A;  3VTD A;  3G8O A;  4NIE A;  2HC4 A;  4OFU A;  1XIU A;  4YT1 A;  1ZUC A;  2Z4B A;  5FQT A;  4ZNU A;  2AAX A;  2QGW A;  3VSO A;  3RLL A;  3ERT A;  2ZKC A;  3AX8 A;  2QH6 A;  5AK2 A;  3VT3 A;  2EWP A;  4IA1 A;  3PO9 A;  2IOG A;  3X1I A;  1XP6 A;  3WFF A;  5I4V A;  3BC5 A;  2I4Z A;  4OAR A;  1QKM A;  1VJB A;  4Q13 A;  4RZF A;  1XLS E;  2ZK5 A;  3SZ1 A;  4Y29 A;  4L96 A;  2W8Y A;  3BEJ A;  1XB7 A;  3OMO A;  4OKT A;  5DUE A;  2Q8S A;  4G1Z A;  4EM9 A;  5E14 A;  2ZNO A;  3MNP A;  5A86 A;  5DXB A;  1FM6 D;  2GPP A;  5DXE A;  4MGB B;  1UHL B;  3VT8 A;  3KBA A;  2Q1V A;  2Q7L A;  2VV3 A;  4G2H A;  5KRJ A;  2Q70 A;  5KYA A;  2OVM A;  2PIU A;  1MVC A;  3RLJ A;  4B7W A;  4G1Y A;  3CQV A;  3UUA B;  4TV1 A;  5EC9 A;  3OS8 A;  3CWD A;  2ZNQ A;  2GPU A;  3GWX A;  1YJE A;  4REF A;  4ZNT A;  4DM8 A;  4YPQ A;  3OSW A;  2XYX A;  3ET3 A;  3JZC A;  4F9M A;  5KRI A;  2R6Y A;  5DK9 A;  4OHA A;  4QM0 A;  1U3S A;  2GIU A;  3UP0 A;  1PQ6 A;  5DV8 A;  2VV2 A;  1A52 A;  3N00 A;  3ADT A;  4RFW A;  3HVL A;  5KRM A;  4UDB A;  3OZJ A;  4O8F A;  3VT5 A;  2GTK A;  4UDC A;  5DXK A;  3IMY A;  1R5K A;  3R29 A;  4WQP A;  3TY0 A;  4LNW A;  5DYD A;  2NXX E;  3MNE A;  5DRM A;  5B5B A;  1ZDT A;  3B5R A;  4DK7 A;  3OKH A;  1OVL B;  3DZY D;  3L0J A;  4FHI A;  4BCR A;  1GWX A;  5KRF A;  4XT9 A;  3WGP A;  3HLV A;  4J26 A;  2Q6J A;  3D90 A;  3O1E A;  3PCU A;  4MG8 A;  3FAL A;  2HWR A;  4MG7 A;  5KD9 A;  3IXP D;  2I4J A;  1T7M A;  2LBD A;  1X7R A;  4N8R A;  4XLD A;  3GYT A;  4PF3 A;  2GPO A;  4IA7 A;  3WWR A;  1SKX A;  2VV4 B;  5IAW A;  2QA8 B;  2Q6S A;  3A2J A;  1LV2 A;  2GPV A;  2HFP A;  2ZK0 A;  2HAR A;  3K8S A;  4OC7 A;  4JGV A;  3H0A A;  4OIL A;  3L0L A;  1YA3 A;  2AX8 A;  3OMQ A;  1R1K D;  5DKB A;  5DV3 A;  2G0H A;  2O4R A;  3OZ0 A;  5ETH A;  5KRC A;  5KRL A;  1ZDU A;  2O4J A;  5HZC A;  3B0R A;  5DRJ A;  3GWS X;  1K4W A;  1YYE A;  3B1M A;  4J5X C;  1FM9 D;  2IOK A;  3D57 A;  1XZX X;  1PQ9 A;  3FXV A;  3LMP A;  4RUO X;  3X31 A;  4XI3 A;  3KWY A;  2YJD A;  5KCU A;  4G2I A;  4MGB A;  3HO0 A;  4ZNH A;  2ZNP A;  2BAW A;  3HC6 A;  1XQ3 A;  3UUC A;  3SP6 A;  4CSJ A;  2PIV A;  2NV7 A;  3KYT A;  4IV4 A;  4PP5 A;  4ZNS A;  4A4V A;  2J7X A;  1YIM A;  2NPA A;  3UUA A;  5KCW A;  3RUU A;  1YMT A;  3NSQ A;  1RJK A;  4ZNW A;  4NB6 A;  5IXK A;  3ADW A;  4QL8 A;  5E0W A;  3OMK A;  5EIT A;  1LBD A;  2I0G A;  2ZFX A;  2Q5G A;  3A78 A;  4PWL A;  4CI4 A;  1Z5X U;  2HB8 A;  5DP0 A;  5KRH A;  1BSX A;  1P93 A;  3T03 A;  1T79 A;  5K13 A;  3VJH A;  3E7C A;  3W0A A;  3PBA A;  1TXI A;  1I7I A;  5DLR A;  1NDE A;  3ADV A;  3DCT A;  2HVC A;  4OH5 A;  3OMP A;  3FUG A;  1OSH A;  2OCF A;  4MGD B;  5G5W A;  2G5O A;  5DXR A;  2YLO A;  4M8H A;  4P6X A;  3AZ1 A;  1OVL A;  1NQ7 A;  1Z5X E;  2B1Z A;  2AX6 A;  3X36 A;  5AYG A;  2G44 A;  3A2I A;  3WT5 A;  4XUH A;  1FM6 A;  1K7L A;  3DR1 A;  4WHG A;  1T73 A;  1IE9 A;  2VV0 A;  3VT9 A;  2ZMJ A;  4XTA A;  3A2H A;  2QW4 A;  1XPC A;  2ZY0 A;  3L03 A;  5G44 A;  1Y9R A;  2AB2 A;  3W5R A;  4ZOM A;  5H1E A;  5DZ0 A; 
#chains in the Genus database with same CATH topology
 4OZR U;  5GID A;  2VV4 A;  1XAP A;  2Q5S A;  5DZI A;  4MGA B;  3E00 A;  5HJS A;  2Q60 A;  2AXA A;  5DIG A;  1XV9 B;  4PPP A;  5E15 A;  5M96 A;  2AA5 A;  1K74 D;  1RDT D;  2AWH A;  5DKG A;  2VST A;  4MG5 A;  4UDD A;  4N1Y A;  4OKX A;  1PRG A;  1U3Q A;  2AYR A;  3G9E A;  3VHW A;  3B0W A;  2JJ3 A;  3W5Q A;  1Y0X X;  2E2R A;  2HCD A;  1R20 D;  3L3X A;  1ILH A;  4OLM A;  4PPS A;  4PP6 A;  3FUR A;  4DM6 A;  5AAV A;  5E7V A;  3ZR7 A;  1QKT A;  1X78 A;  3CS6 A;  3PEQ A;  3VSP A;  3ERD A;  4RMD A;  4X1F A;  1G5Y A;  2P15 A;  2QA6 A;  3KMG A;  4LNX A;  5FQP A;  4NY9 A;  3DZY A;  1M7W A;  4J24 A;  5F9B A;  5HYK A;  3KPZ A;  2HAS A;  2R40 D;  3L3Z A;  5DUH A;  5KCE A;  2P1U A;  5FQV A;  3VT7 A;  5E0X A;  2VSR A;  5ACC A;  1KV6 A;  5C4O A;  3F5C B;  3X1H A;  3R2A A;  3KMR A;  1QKN A;  2YFE A;  2ZLA A;  1Y0S A;  2PIN A;  4MG9 B;  5C4S A;  4OIV A;  3PLZ A;  1U3R A;  4R06 A;  3AFR A;  4RE8 A;  1PZL A;  1XLS A;  4N73 A;  3UU7 B;  4OEY A;  1ZH7 A;  1M2Z A;  1OSV A;  4PVU A;  5L7H A;  2YLY A;  1XQC A;  1G2N A;  1FCY A;  3AZ2 A;  1IE8 A;  4PRG A;  1R1K A;  1T7T A;  1NRL A;  1A28 A;  3LBD A;  3WT6 A;  2AX7 A;  4OFR A;  4POJ A;  1GWR A;  2XHS A;  4FN9 A;  3WJ4 A;  2ZL9 A;  2QXM A;  3GD2 A;  2QAB A;  3K6P A;  4OED A;  2QZO A;  1UOM A;  2VV1 B;  3OS8 C;  4K6I A;  1HJ1 A;  4Q50 A;  3V3Q A;  3W0H A;  3G8I A;  2YJA B;  1NQ2 A;  2ZK1 A;  1S0X A;  5HYR A;  1I38 A;  5JY3 A;  2I0J A;  4ZJW A;  2P54 A;  2GL8 A;  3HOD A;  3D24 A;  5DKS A;  3L0E A;  4WPF A;  5DU5 A;  4IA2 A;  3H52 A;  3E94 A;  1XV9 A;  1MV9 A;  3CS8 A;  5AVI A;  2ZXZ A;  4TUZ B;  5DI7 A;  5DKE A;  3HZF A;  3R5M A;  3O1D A;  4Q0A C;  4E2J A;  2PIQ A;  5DWE A;  1KNU A;  4PLE A;  5KCC A;  5KYJ A;  2QPY A;  1G1U A;  3ADS A;  5L7E A;  3DZU A;  2PJL A;  4E4K A;  4JL4 A;  2QTU A;  1SJ0 A;  1YOW A;  3R8D A;  2P1T A;  1T76 A;  4MDD A;  1UPV A;  2P7G A;  2AA6 A;  2AO6 A;  3K22 A;  2ZXN A;  3R8I A;  3RVF A;  1YUC A;  3IPS A;  2J14 A;  2XYJ A;  3ET0 A;  3R5N A;  4RWV A;  2PNU A;  4KZM A;  3VT4 A;  1X7J A;  4S0T A;  5DV6 A;  3S9S A;  1X7B A;  1L2I A;  1NYX A;  1NAV A;  3CDP A;  5DSH A;  4NQA B;  3VN2 A;  3VRW A;  3ADU A;  3KDU A;  4OGH A;  1UHL A;  5EJV A;  3VRU A;  2HBH A;  4MG9 A;  4QE6 A;  2GWX A;  5C4T A;  1SR7 A;  2YLP A;  3A40 X;  4XAO A;  5SYZ A;  4ZI1 A;  5KRO A;  1XNN A;  3ET2 A;  2Q61 A;  5AVL A;  3FC6 B;  3M7R A;  1I37 A;  4QK4 A;  3VJI A;  5GT4 A;  2AM9 A;  2PIX A;  4FNE A;  2OVH A;  2HB7 A;  3FLI A;  5EI1 A;  5APJ A;  3KMZ A;  4QJR A;  1XJ7 A;  4R6S A;  3W0G A;  3JZB A;  3K23 A;  4ZN7 A;  2B23 A;  1N4H A;  5DZ3 A;  2Q5P A;  3WFG A;  2ZK4 A;  3AN3 A;  2HAM A;  4IUI A;  5DVS A;  5G43 A;  2VV1 A;  2ZK6 A;  4IVW A;  4DOS A;  1P8D A;  4DMA A;  3V9T A;  2QNV A;  1OT7 A;  3FEJ A;  2OUZ A;  2XYW A;  1RK3 A;  1GWQ A;  1DB1 A;  4OK1 A;  3IPU A;  2ATH A;  1XVP B;  2IHQ A;  4NUF A;  4PP3 A;  3TKM A;  2AMA A;  1KKQ A;  1FCX A;  5DWL A;  5HJP B;  4QE8 A;  4OZT U;  2A3I A;  5E1C A;  2QSE A;  1T74 A;  5DXM A;  3UP3 A;  5DX3 B;  3NOA A;  4TUZ A;  3GYU A;  3F7D A;  4J5W A;  1YP0 A;  5FQS A;  4TV1 B;  1XDK B;  4RZE A;  2QA8 A;  1NHZ A;  3P0U A;  4IS8 A;  4G1D A;  1X76 A;  3ZQT A;  1NQ0 A;  4G21 A;  1XP1 A;  4IU7 A;  4OZT E;  3VT6 A;  5L11 A;  3QT0 A;  3VJT A;  3D6D A;  4JAZ A;  3H0A D;  3OOF A;  3FS1 A;  2AMB A;  2O9I A;  3CDS A;  1YIN A;  3B65 A;  1FD0 A;  3OLS A;  2F4B A;  4M8E A;  4ZJR A;  1FBY A;  4YNK A;  4MGC A;  4OZR E;  5G3J A;  5AWK A;  3U9Q A;  3WMH A;  2G0G A;  3HC5 A;  4RUP A;  5DVC A;  4IA3 A;  3AUQ A;  3W0I A;  2ZMI A;  3R8A A;  1S9P A;  2FVJ A;  3A9E B;  2J7Y A;  4A2J A;  4ZNV A;  2BJ4 B;  1NQ1 A;  2QE4 A;  3OLF A;  4OIU A;  5CJ6 A;  2Q7K A;  5G45 A;  3ZRB A;  1TFC A;  5JJM B;  3EYB A;  2Q1H A;  1T5Z A;  4EMA A;  5DIE A;  2FAI A;  2H77 A;  2ZNN A;  4MG7 B;  1M13 A;  2Q3Y A;  4ITF A;  2ZVT A;  4OJB A;  1ERE A;  3IXP A;  4RAK A;  3D5F A;  2I4P A;  4PXM A;  1X7E A;  5AZV A;  1ILG A;  2P1V A;  3OSA A;  1YOK A;  3B67 A;  3UUD B;  3VI8 A;  3W0J A;  3DY6 A;  5APH A;  4A4W A;  2Z4J A;  3RUT A;  4ZN9 A;  3VHV A;  5G42 A;  3IPQ A;  2XKW A;  4JYH A;  1ERR A;  1Z95 A;  4L98 A;  1ZGY A;  1EXX A;  1Q4X A;  1MZN A;  4MGD A;  3W5P A;  5B41 A;  4REE A;  4WHF A;  1XVP A;  2QMV A;  2Q7J A;  4FHH A;  5DXP A;  5C4U A;  3V9Y A;  5HJP A;  5APK A;  3W0C A;  3VJS A;  1FM9 A;  5L7G A;  1FCZ A;  3GN8 A;  3UVV B;  2OZ7 A;  4ZO1 B;  5KCF A;  3KFC A;  1E3G A;  5DXG A;  1QKU A;  1T7F A;  2AX9 A;  3A3Z X;  5DX3 A;  2AA2 A;  3VRT A;  5DMF A;  1XDK A;  4E4Q A;  5JI0 D;  4MGA A;  3E00 D;  3V3E A;  4JYI A;  2FSZ A;  2ZAS A;  3G0W A;  1PDU A;  4OJ4 A;  3W5T A;  4YMQ A;  2B50 A;  1L2J A;  1S0Z A;  3B0Q A;  2PIT A;  1I7G A;  1XOW A;  4LBD A;  5HCV A;  4DK8 A;  2J4A A;  4N5G A;  5KR9 A;  5GIC A;  4IV2 A;  4OEZ A;  2ACL B;  2NXX A;  2QR9 A;  3AUN A;  3P89 A;  1R6G A;  4FGY A;  1S9Q A;  2ZK2 A;  2Q59 B;  1T65 A;  4POH A;  4KZJ A;  2ZMH A;  3L1B A;  1G50 A;  3OGT A;  5DTV A;  5DWG A;  3OOK A;  4ZO1 X;  1RKH A;  3P88 A;  5DVV A;  3VHU A;  4ONI A;  3A9E A;  1HG4 A;  1PQC A;  5KCD A;  3CS4 A;  3GZ9 A;  2BJ4 A;  1YY4 A;  2P7Z A;  5AZT A;  3B3K A;  5LWP A;  5KCT A;  1DKF B;  5EGV A;  4UDA A;  5JJM A;  2AA7 A;  3B66 A;  4K7A A;  4X1G A;  2V0V A;  5DUG A;  3Q95 B;  5G46 A;  3RY9 A;  2HWQ A;  2ABI A;  2JFA B;  1RKG A;  1ZKY A;  2PIR A;  2REW A;  2YLQ A;  5LGA A;  5GIE A;  1WM0 X;  3F5C A;  5DXQ A;  2ZK3 A;  3OLL A;  4LSJ A;  1S19 A;  3PRG A;  1XP9 A;  5AWJ A;  3UUD A;  3WJ5 A;  2YAT A;  3IA6 A;  4IWC A;  4WLB A;  1K74 A;  1RDT A;  2ZBS A;  1H9U A;  4J5X A;  4IWF A;  4S15 A;  3TX7 B;  3UU7 A;  1ZEO A;  2GP7 A;  4P6W A;  3VRV A;  4RME A;  4PLD A;  3OSI A;  4WVD A;  3B68 A;  4OKW A;  5EHJ A;  3VTB A;  4RMC A;  1R20 A;  1NUO A;  4IQR A;  5DZ1 A;  2NW4 A;  4OH6 A;  3V9V A;  3VTC A;  4XHD A;  5AAV B;  4MG6 A;  4IVY A;  4IW8 A;  5FQR A;  3CTB A;  3UVV A;  5KRA A;  2OAX A;  3GBK A;  3OMM A;  3DCU A;  2POB A;  5E19 A;  5DZH A;  2Q7I A;  3TKC A;  2R40 A;  1N46 A;  3NSP A;  5ICK A;  3CJW A;  4DQM A;  2H79 A;  2YHD A;  4R2U A;  3AZ3 A;  2PIO A;  2PKL A;  3ILZ A;  3KDT A;  2ZLC A;  3B0T A;  1E3K A;  3HM1 A;  5DXB B;  4ITE A;  4LTW A;  3AN4 A;  3HQ5 A;  5AAU A;  4K4J A;  2OM9 A;  5DY8 A;  2P4Y A;  2QXS A;  3FEI A;  4S14 A;  1ZAF A;  2ACL A;  4DOR A;  5DID A;  4HEE X;  3P8X A;  1T63 A;  2Q59 A;  5KRK A;  4OEA A;  3CLD A;  3DZU D;  3V4A A;  3WTQ A;  5DMC A;  3ZRA A;  2PRG A;  4IW6 A;  2R6W A;  4RUJ A;  1T7R A;  3OAP A;  3ADX A;  4J5W C;  1PK5 A;  1DKF A;  1PCG A;  2QZO B;  4RZG A;  2JF9 A;  1SQN A;  2POG A;  1XNX A;  3Q95 A;  2JFA A;  4OJ9 A;  2PIP L;  2QGT A;  4G20 A;  4S0S A;  4CI5 A;  1EXA A;  3ET1 A;  5DWI A;  1U9E A;  4OKB A;  3OKI A;  2ZXM A;  4HLW A;  5DYB A;  2PIW A;  3MNO A;  3SP9 A;  2P7A A;  3BQD A;  5DWJ A;  5DL4 A;  1NAX A;  3V49 A;  1N83 A;  2Q6R A;  3W0Y A;  1UPW A;  2B1V A;  4XUM A;  3FC6 A;  4MG8 B;  2V7C A;  3FAL B;  4APU A;  3OS9 A;  4JYG A;  4KZI A;  5IZ0 A;  3WT7 A;  3DT3 A;  1GS4 A;  3AUR A;  3VTD A;  3G8O A;  4NIE A;  2HC4 A;  4OFU A;  1XIU A;  4YT1 A;  1ZUC A;  2Z4B A;  5FQT A;  4ZNU A;  2AAX A;  2QGW A;  3VSO A;  3RLL A;  3ERT A;  2ZKC A;  3AX8 A;  2QH6 A;  5AK2 A;  3VT3 A;  2EWP A;  4IA1 A;  3PO9 A;  2IOG A;  3X1I A;  1XP6 A;  3WFF A;  5I4V A;  3BC5 A;  2I4Z A;  4OAR A;  1QKM A;  1VJB A;  4Q13 A;  4RZF A;  1XLS E;  2ZK5 A;  3SZ1 A;  4Y29 A;  4L96 A;  2W8Y A;  3BEJ A;  1XB7 A;  3OMO A;  4OKT A;  5DUE A;  2Q8S A;  4G1Z A;  4EM9 A;  5E14 A;  2ZNO A;  3MNP A;  5A86 A;  5DXB A;  1FM6 D;  2GPP A;  5DXE A;  4MGB B;  1UHL B;  3VT8 A;  3KBA A;  2Q1V A;  2Q7L A;  2VV3 A;  4G2H A;  5KRJ A;  2Q70 A;  5KYA A;  2OVM A;  2PIU A;  1MVC A;  3RLJ A;  4B7W A;  4G1Y A;  3CQV A;  3UUA B;  4TV1 A;  5EC9 A;  3OS8 A;  3CWD A;  2ZNQ A;  2GPU A;  3GWX A;  1YJE A;  4REF A;  4ZNT A;  4DM8 A;  4YPQ A;  3OSW A;  2XYX A;  3ET3 A;  3JZC A;  4F9M A;  5KRI A;  2R6Y A;  5DK9 A;  4OHA A;  4QM0 A;  1U3S A;  2GIU A;  3UP0 A;  1PQ6 A;  5DV8 A;  2VV2 A;  1A52 A;  3N00 A;  3ADT A;  4RFW A;  3HVL A;  5KRM A;  4UDB A;  3OZJ A;  4O8F A;  3VT5 A;  2GTK A;  4UDC A;  5DXK A;  3IMY A;  1R5K A;  3R29 A;  4WQP A;  3TY0 A;  4LNW A;  5DYD A;  2NXX E;  3MNE A;  5DRM A;  5B5B A;  1ZDT A;  3B5R A;  4DK7 A;  3OKH A;  1OVL B;  3DZY D;  3L0J A;  4FHI A;  4BCR A;  1GWX A;  5KRF A;  4XT9 A;  3WGP A;  3HLV A;  4J26 A;  2Q6J A;  3D90 A;  3O1E A;  3PCU A;  4MG8 A;  3FAL A;  2HWR A;  4MG7 A;  5KD9 A;  3IXP D;  2I4J A;  1T7M A;  2LBD A;  1X7R A;  4N8R A;  4XLD A;  3GYT A;  4PF3 A;  2GPO A;  4IA7 A;  3WWR A;  1SKX A;  2VV4 B;  5IAW A;  2QA8 B;  2Q6S A;  3A2J A;  1LV2 A;  2GPV A;  2HFP A;  2ZK0 A;  2HAR A;  3K8S A;  4OC7 A;  4JGV A;  3H0A A;  4OIL A;  3L0L A;  1YA3 A;  2AX8 A;  3OMQ A;  1R1K D;  5DKB A;  5DV3 A;  2G0H A;  2O4R A;  3OZ0 A;  5ETH A;  5KRC A;  5KRL A;  1ZDU A;  2O4J A;  5HZC A;  3B0R A;  5DRJ A;  3GWS X;  1K4W A;  1YYE A;  3B1M A;  4J5X C;  1FM9 D;  2IOK A;  3D57 A;  1XZX X;  1PQ9 A;  3FXV A;  3LMP A;  4RUO X;  3X31 A;  4XI3 A;  3KWY A;  2YJD A;  5KCU A;  4G2I A;  4MGB A;  3HO0 A;  4ZNH A;  2ZNP A;  2BAW A;  3HC6 A;  1XQ3 A;  3UUC A;  3SP6 A;  4CSJ A;  2PIV A;  2NV7 A;  3KYT A;  4IV4 A;  4PP5 A;  4ZNS A;  4A4V A;  2J7X A;  1YIM A;  2NPA A;  3UUA A;  5KCW A;  3RUU A;  1YMT A;  3NSQ A;  1RJK A;  4ZNW A;  4NB6 A;  5IXK A;  3ADW A;  4QL8 A;  5E0W A;  3OMK A;  5EIT A;  1LBD A;  2I0G A;  2ZFX A;  2Q5G A;  3A78 A;  4PWL A;  4CI4 A;  1Z5X U;  2HB8 A;  5DP0 A;  5KRH A;  1BSX A;  1P93 A;  3T03 A;  1T79 A;  5K13 A;  3VJH A;  3E7C A;  3W0A A;  3PBA A;  1TXI A;  1I7I A;  5DLR A;  1NDE A;  3ADV A;  3DCT A;  2HVC A;  4OH5 A;  3OMP A;  3FUG A;  1OSH A;  2OCF A;  4MGD B;  5G5W A;  2G5O A;  5DXR A;  2YLO A;  4M8H A;  4P6X A;  3AZ1 A;  1OVL A;  1NQ7 A;  1Z5X E;  2B1Z A;  2AX6 A;  3X36 A;  5AYG A;  2G44 A;  3A2I A;  3WT5 A;  4XUH A;  1FM6 A;  1K7L A;  3DR1 A;  4WHG A;  1T73 A;  1IE9 A;  2VV0 A;  3VT9 A;  2ZMJ A;  4XTA A;  3A2H A;  2QW4 A;  1XPC A;  2ZY0 A;  3L03 A;  5G44 A;  1Y9R A;  2AB2 A;  3W5R A;  4ZOM A;  5H1E A;  5DZ0 A; 
#chains in the Genus database with same CATH homology
 4OZR U;  5GID A;  2VV4 A;  1XAP A;  2Q5S A;  5DZI A;  4MGA B;  3E00 A;  5HJS A;  2Q60 A;  2AXA A;  5DIG A;  1XV9 B;  4PPP A;  5E15 A;  5M96 A;  2AA5 A;  1K74 D;  1RDT D;  2AWH A;  5DKG A;  2VST A;  4MG5 A;  4UDD A;  4N1Y A;  4OKX A;  1PRG A;  1U3Q A;  2AYR A;  3G9E A;  3VHW A;  3B0W A;  2JJ3 A;  3W5Q A;  1Y0X X;  2E2R A;  2HCD A;  1R20 D;  3L3X A;  1ILH A;  4OLM A;  4PPS A;  4PP6 A;  3FUR A;  4DM6 A;  5AAV A;  5E7V A;  3ZR7 A;  1QKT A;  1X78 A;  3CS6 A;  3PEQ A;  3VSP A;  3ERD A;  4RMD A;  4X1F A;  1G5Y A;  2P15 A;  2QA6 A;  3KMG A;  4LNX A;  5FQP A;  4NY9 A;  3DZY A;  1M7W A;  4J24 A;  5F9B A;  5HYK A;  3KPZ A;  2HAS A;  2R40 D;  3L3Z A;  5DUH A;  5KCE A;  2P1U A;  5FQV A;  3VT7 A;  5E0X A;  2VSR A;  5ACC A;  1KV6 A;  5C4O A;  3F5C B;  3X1H A;  3R2A A;  3KMR A;  1QKN A;  2YFE A;  2ZLA A;  1Y0S A;  2PIN A;  4MG9 B;  5C4S A;  4OIV A;  3PLZ A;  1U3R A;  4R06 A;  3AFR A;  4RE8 A;  1PZL A;  1XLS A;  4N73 A;  3UU7 B;  4OEY A;  1ZH7 A;  1M2Z A;  1OSV A;  4PVU A;  5L7H A;  2YLY A;  1XQC A;  1G2N A;  1FCY A;  3AZ2 A;  1IE8 A;  4PRG A;  1R1K A;  1T7T A;  1NRL A;  1A28 A;  3LBD A;  3WT6 A;  2AX7 A;  4OFR A;  4POJ A;  1GWR A;  2XHS A;  4FN9 A;  3WJ4 A;  2ZL9 A;  2QXM A;  3GD2 A;  2QAB A;  3K6P A;  4OED A;  2QZO A;  1UOM A;  2VV1 B;  3OS8 C;  4K6I A;  1HJ1 A;  4Q50 A;  3V3Q A;  3W0H A;  3G8I A;  2YJA B;  1NQ2 A;  2ZK1 A;  1S0X A;  5HYR A;  1I38 A;  5JY3 A;  2I0J A;  4ZJW A;  2P54 A;  2GL8 A;  3HOD A;  3D24 A;  5DKS A;  3L0E A;  4WPF A;  5DU5 A;  4IA2 A;  3H52 A;  3E94 A;  1XV9 A;  1MV9 A;  3CS8 A;  5AVI A;  2ZXZ A;  4TUZ B;  5DI7 A;  5DKE A;  3HZF A;  3R5M A;  3O1D A;  4Q0A C;  4E2J A;  2PIQ A;  5DWE A;  1KNU A;  4PLE A;  5KCC A;  5KYJ A;  2QPY A;  1G1U A;  3ADS A;  5L7E A;  3DZU A;  2PJL A;  4E4K A;  4JL4 A;  2QTU A;  1SJ0 A;  1YOW A;  3R8D A;  2P1T A;  1T76 A;  4MDD A;  1UPV A;  2P7G A;  2AA6 A;  2AO6 A;  3K22 A;  2ZXN A;  3R8I A;  3RVF A;  1YUC A;  3IPS A;  2J14 A;  2XYJ A;  3ET0 A;  3R5N A;  4RWV A;  2PNU A;  4KZM A;  3VT4 A;  1X7J A;  4S0T A;  5DV6 A;  3S9S A;  1X7B A;  1L2I A;  1NYX A;  1NAV A;  3CDP A;  5DSH A;  4NQA B;  3VN2 A;  3VRW A;  3ADU A;  3KDU A;  4OGH A;  1UHL A;  5EJV A;  3VRU A;  2HBH A;  4MG9 A;  4QE6 A;  2GWX A;  5C4T A;  1SR7 A;  2YLP A;  3A40 X;  4XAO A;  5SYZ A;  4ZI1 A;  5KRO A;  1XNN A;  3ET2 A;  2Q61 A;  5AVL A;  3FC6 B;  3M7R A;  1I37 A;  4QK4 A;  3VJI A;  5GT4 A;  2AM9 A;  2PIX A;  4FNE A;  2OVH A;  2HB7 A;  3FLI A;  5EI1 A;  5APJ A;  3KMZ A;  4QJR A;  1XJ7 A;  4R6S A;  3W0G A;  3JZB A;  3K23 A;  4ZN7 A;  2B23 A;  1N4H A;  5DZ3 A;  2Q5P A;  3WFG A;  2ZK4 A;  3AN3 A;  2HAM A;  4IUI A;  5DVS A;  5G43 A;  2VV1 A;  2ZK6 A;  4IVW A;  4DOS A;  1P8D A;  4DMA A;  3V9T A;  2QNV A;  1OT7 A;  3FEJ A;  2OUZ A;  2XYW A;  1RK3 A;  1GWQ A;  1DB1 A;  4OK1 A;  3IPU A;  2ATH A;  1XVP B;  2IHQ A;  4NUF A;  4PP3 A;  3TKM A;  2AMA A;  1KKQ A;  1FCX A;  5DWL A;  5HJP B;  4QE8 A;  4OZT U;  2A3I A;  5E1C A;  2QSE A;  1T74 A;  5DXM A;  3UP3 A;  5DX3 B;  3NOA A;  4TUZ A;  3GYU A;  3F7D A;  4J5W A;  1YP0 A;  5FQS A;  4TV1 B;  1XDK B;  4RZE A;  2QA8 A;  1NHZ A;  3P0U A;  4IS8 A;  4G1D A;  1X76 A;  3ZQT A;  1NQ0 A;  4G21 A;  1XP1 A;  4IU7 A;  4OZT E;  3VT6 A;  5L11 A;  3QT0 A;  3VJT A;  3D6D A;  4JAZ A;  3H0A D;  3OOF A;  3FS1 A;  2AMB A;  2O9I A;  3CDS A;  1YIN A;  3B65 A;  1FD0 A;  3OLS A;  2F4B A;  4M8E A;  4ZJR A;  1FBY A;  4YNK A;  4MGC A;  4OZR E;  5G3J A;  5AWK A;  3U9Q A;  3WMH A;  2G0G A;  3HC5 A;  4RUP A;  5DVC A;  4IA3 A;  3AUQ A;  3W0I A;  2ZMI A;  3R8A A;  1S9P A;  2FVJ A;  3A9E B;  2J7Y A;  4A2J A;  4ZNV A;  2BJ4 B;  1NQ1 A;  2QE4 A;  3OLF A;  4OIU A;  5CJ6 A;  2Q7K A;  5G45 A;  3ZRB A;  1TFC A;  5JJM B;  3EYB A;  2Q1H A;  1T5Z A;  4EMA A;  5DIE A;  2FAI A;  2H77 A;  2ZNN A;  4MG7 B;  1M13 A;  2Q3Y A;  4ITF A;  2ZVT A;  4OJB A;  1ERE A;  3IXP A;  4RAK A;  3D5F A;  2I4P A;  4PXM A;  1X7E A;  5AZV A;  1ILG A;  2P1V A;  3OSA A;  1YOK A;  3B67 A;  3UUD B;  3VI8 A;  3W0J A;  3DY6 A;  5APH A;  4A4W A;  2Z4J A;  3RUT A;  4ZN9 A;  3VHV A;  5G42 A;  3IPQ A;  2XKW A;  4JYH A;  1ERR A;  1Z95 A;  4L98 A;  1ZGY A;  1EXX A;  1Q4X A;  1MZN A;  4MGD A;  3W5P A;  5B41 A;  4REE A;  4WHF A;  1XVP A;  2QMV A;  2Q7J A;  4FHH A;  5DXP A;  5C4U A;  3V9Y A;  5HJP A;  5APK A;  3W0C A;  3VJS A;  1FM9 A;  5L7G A;  1FCZ A;  3GN8 A;  3UVV B;  2OZ7 A;  4ZO1 B;  5KCF A;  3KFC A;  1E3G A;  5DXG A;  1QKU A;  1T7F A;  2AX9 A;  3A3Z X;  5DX3 A;  2AA2 A;  3VRT A;  5DMF A;  1XDK A;  4E4Q A;  5JI0 D;  4MGA A;  3E00 D;  3V3E A;  4JYI A;  2FSZ A;  2ZAS A;  3G0W A;  1PDU A;  4OJ4 A;  3W5T A;  4YMQ A;  2B50 A;  1L2J A;  1S0Z A;  3B0Q A;  2PIT A;  1I7G A;  1XOW A;  4LBD A;  5HCV A;  4DK8 A;  2J4A A;  4N5G A;  5KR9 A;  5GIC A;  4IV2 A;  4OEZ A;  2ACL B;  2NXX A;  2QR9 A;  3AUN A;  3P89 A;  1R6G A;  4FGY A;  1S9Q A;  2ZK2 A;  2Q59 B;  1T65 A;  4POH A;  4KZJ A;  2ZMH A;  3L1B A;  1G50 A;  3OGT A;  5DTV A;  5DWG A;  3OOK A;  4ZO1 X;  1RKH A;  3P88 A;  5DVV A;  3VHU A;  4ONI A;  3A9E A;  1HG4 A;  1PQC A;  5KCD A;  3CS4 A;  3GZ9 A;  2BJ4 A;  1YY4 A;  2P7Z A;  5AZT A;  3B3K A;  5LWP A;  5KCT A;  1DKF B;  5EGV A;  4UDA A;  5JJM A;  2AA7 A;  3B66 A;  4K7A A;  4X1G A;  2V0V A;  5DUG A;  3Q95 B;  5G46 A;  3RY9 A;  2HWQ A;  2ABI A;  2JFA B;  1RKG A;  1ZKY A;  2PIR A;  2REW A;  2YLQ A;  5LGA A;  5GIE A;  1WM0 X;  3F5C A;  5DXQ A;  2ZK3 A;  3OLL A;  4LSJ A;  1S19 A;  3PRG A;  1XP9 A;  5AWJ A;  3UUD A;  3WJ5 A;  2YAT A;  3IA6 A;  4IWC A;  4WLB A;  1K74 A;  1RDT A;  2ZBS A;  1H9U A;  4J5X A;  4IWF A;  4S15 A;  3TX7 B;  3UU7 A;  1ZEO A;  2GP7 A;  4P6W A;  3VRV A;  4RME A;  4PLD A;  3OSI A;  4WVD A;  3B68 A;  4OKW A;  5EHJ A;  3VTB A;  4RMC A;  1R20 A;  1NUO A;  4IQR A;  5DZ1 A;  2NW4 A;  4OH6 A;  3V9V A;  3VTC A;  4XHD A;  5AAV B;  4MG6 A;  4IVY A;  4IW8 A;  5FQR A;  3CTB A;  3UVV A;  5KRA A;  2OAX A;  3GBK A;  3OMM A;  3DCU A;  2POB A;  5E19 A;  5DZH A;  2Q7I A;  3TKC A;  2R40 A;  1N46 A;  3NSP A;  5ICK A;  3CJW A;  4DQM A;  2H79 A;  2YHD A;  4R2U A;  3AZ3 A;  2PIO A;  2PKL A;  3ILZ A;  3KDT A;  2ZLC A;  3B0T A;  1E3K A;  3HM1 A;  5DXB B;  4ITE A;  4LTW A;  3AN4 A;  3HQ5 A;  5AAU A;  4K4J A;  2OM9 A;  5DY8 A;  2P4Y A;  2QXS A;  3FEI A;  4S14 A;  1ZAF A;  2ACL A;  4DOR A;  5DID A;  4HEE X;  3P8X A;  1T63 A;  2Q59 A;  5KRK A;  4OEA A;  3CLD A;  3DZU D;  3V4A A;  3WTQ A;  5DMC A;  3ZRA A;  2PRG A;  4IW6 A;  2R6W A;  4RUJ A;  1T7R A;  3OAP A;  3ADX A;  4J5W C;  1PK5 A;  1DKF A;  1PCG A;  2QZO B;  4RZG A;  2JF9 A;  1SQN A;  2POG A;  1XNX A;  3Q95 A;  2JFA A;  4OJ9 A;  2PIP L;  2QGT A;  4G20 A;  4S0S A;  4CI5 A;  1EXA A;  3ET1 A;  5DWI A;  1U9E A;  4OKB A;  3OKI A;  2ZXM A;  4HLW A;  5DYB A;  2PIW A;  3MNO A;  3SP9 A;  2P7A A;  3BQD A;  5DWJ A;  5DL4 A;  1NAX A;  3V49 A;  1N83 A;  2Q6R A;  3W0Y A;  1UPW A;  2B1V A;  4XUM A;  3FC6 A;  4MG8 B;  2V7C A;  3FAL B;  4APU A;  3OS9 A;  4JYG A;  4KZI A;  5IZ0 A;  3WT7 A;  3DT3 A;  1GS4 A;  3AUR A;  3VTD A;  3G8O A;  4NIE A;  2HC4 A;  4OFU A;  1XIU A;  4YT1 A;  1ZUC A;  2Z4B A;  5FQT A;  4ZNU A;  2AAX A;  2QGW A;  3VSO A;  3RLL A;  3ERT A;  2ZKC A;  3AX8 A;  2QH6 A;  5AK2 A;  3VT3 A;  2EWP A;  4IA1 A;  3PO9 A;  2IOG A;  3X1I A;  1XP6 A;  3WFF A;  5I4V A;  3BC5 A;  2I4Z A;  4OAR A;  1QKM A;  1VJB A;  4Q13 A;  4RZF A;  1XLS E;  2ZK5 A;  3SZ1 A;  4Y29 A;  4L96 A;  2W8Y A;  3BEJ A;  1XB7 A;  3OMO A;  4OKT A;  5DUE A;  2Q8S A;  4G1Z A;  4EM9 A;  5E14 A;  2ZNO A;  3MNP A;  5A86 A;  5DXB A;  1FM6 D;  2GPP A;  5DXE A;  4MGB B;  1UHL B;  3VT8 A;  3KBA A;  2Q1V A;  2Q7L A;  2VV3 A;  4G2H A;  5KRJ A;  2Q70 A;  5KYA A;  2OVM A;  2PIU A;  1MVC A;  3RLJ A;  4B7W A;  4G1Y A;  3CQV A;  3UUA B;  4TV1 A;  5EC9 A;  3OS8 A;  3CWD A;  2ZNQ A;  2GPU A;  3GWX A;  1YJE A;  4REF A;  4ZNT A;  4DM8 A;  4YPQ A;  3OSW A;  2XYX A;  3ET3 A;  3JZC A;  4F9M A;  5KRI A;  2R6Y A;  5DK9 A;  4OHA A;  4QM0 A;  1U3S A;  2GIU A;  3UP0 A;  1PQ6 A;  5DV8 A;  2VV2 A;  1A52 A;  3N00 A;  3ADT A;  4RFW A;  3HVL A;  5KRM A;  4UDB A;  3OZJ A;  4O8F A;  3VT5 A;  2GTK A;  4UDC A;  5DXK A;  3IMY A;  1R5K A;  3R29 A;  4WQP A;  3TY0 A;  4LNW A;  5DYD A;  2NXX E;  3MNE A;  5DRM A;  5B5B A;  1ZDT A;  3B5R A;  4DK7 A;  3OKH A;  1OVL B;  3DZY D;  3L0J A;  4FHI A;  4BCR A;  1GWX A;  5KRF A;  4XT9 A;  3WGP A;  3HLV A;  4J26 A;  2Q6J A;  3D90 A;  3O1E A;  3PCU A;  4MG8 A;  3FAL A;  2HWR A;  4MG7 A;  5KD9 A;  3IXP D;  2I4J A;  1T7M A;  2LBD A;  1X7R A;  4N8R A;  4XLD A;  3GYT A;  4PF3 A;  2GPO A;  4IA7 A;  3WWR A;  1SKX A;  2VV4 B;  5IAW A;  2QA8 B;  2Q6S A;  3A2J A;  1LV2 A;  2GPV A;  2HFP A;  2ZK0 A;  2HAR A;  3K8S A;  4OC7 A;  4JGV A;  3H0A A;  4OIL A;  3L0L A;  1YA3 A;  2AX8 A;  3OMQ A;  1R1K D;  5DKB A;  5DV3 A;  2G0H A;  2O4R A;  3OZ0 A;  5ETH A;  5KRC A;  5KRL A;  1ZDU A;  2O4J A;  5HZC A;  3B0R A;  5DRJ A;  3GWS X;  1K4W A;  1YYE A;  3B1M A;  4J5X C;  1FM9 D;  2IOK A;  3D57 A;  1XZX X;  1PQ9 A;  3FXV A;  3LMP A;  4RUO X;  3X31 A;  4XI3 A;  3KWY A;  2YJD A;  5KCU A;  4G2I A;  4MGB A;  3HO0 A;  4ZNH A;  2ZNP A;  2BAW A;  3HC6 A;  1XQ3 A;  3UUC A;  3SP6 A;  4CSJ A;  2PIV A;  2NV7 A;  3KYT A;  4IV4 A;  4PP5 A;  4ZNS A;  4A4V A;  2J7X A;  1YIM A;  2NPA A;  3UUA A;  5KCW A;  3RUU A;  1YMT A;  3NSQ A;  1RJK A;  4ZNW A;  4NB6 A;  5IXK A;  3ADW A;  4QL8 A;  5E0W A;  3OMK A;  5EIT A;  1LBD A;  2I0G A;  2ZFX A;  2Q5G A;  3A78 A;  4PWL A;  4CI4 A;  1Z5X U;  2HB8 A;  5DP0 A;  5KRH A;  1BSX A;  1P93 A;  3T03 A;  1T79 A;  5K13 A;  3VJH A;  3E7C A;  3W0A A;  3PBA A;  1TXI A;  1I7I A;  5DLR A;  1NDE A;  3ADV A;  3DCT A;  2HVC A;  4OH5 A;  3OMP A;  3FUG A;  1OSH A;  2OCF A;  4MGD B;  5G5W A;  2G5O A;  5DXR A;  2YLO A;  4M8H A;  4P6X A;  3AZ1 A;  1OVL A;  1NQ7 A;  1Z5X E;  2B1Z A;  2AX6 A;  3X36 A;  5AYG A;  2G44 A;  3A2I A;  3WT5 A;  4XUH A;  1FM6 A;  1K7L A;  3DR1 A;  4WHG A;  1T73 A;  1IE9 A;  2VV0 A;  3VT9 A;  2ZMJ A;  4XTA A;  3A2H A;  2QW4 A;  1XPC A;  2ZY0 A;  3L03 A;  5G44 A;  1Y9R A;  2AB2 A;  3W5R A;  4ZOM A;  5H1E A;  5DZ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...