5HZCA

Crystal structure of the complex ppargamma/al26-29
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
268
structure length
251
Chain Sequence
ESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Peroxisome proliferator-activated receptor gamma
publication title Structural basis for PPAR partial or full activation revealed by a novel ligand binding mode.
pubmed doi rcsb
source organism Homo sapiens
total genus 95
structure length 251
sequence length 268
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 5hzcA00
1NHZA 3MNEA 5DVVA 1LBDA 3B65A 4PP6A 3VT8A 2QA8A 3CTBA 1MV9A 3P89A 2Q6JA 3KDTA 2PIXA 1G50A 1XDKA 1Y0SA 2O9IA 2YLOA 4TV1A 1U9EA 4PPSA 4PF3A 3SP6A 1XVPA 5KCDA 3TX7B 5EHJA 3OS8A 5DIGA 1T63A 4S0SA 1R20D 2GPUA 3FS1A 5DTVA 5DUGA 5KCCA 1U3QA 1R1KA 5DYBA 3R8IA 3VHUA 2J14A 4L98A 2OVHA 1YYEA 2Q6SA 4UDDA 4OH5A 1U3SA 2ZXZA 1FM9A 2IOKA 3CS4A 3FUGA 1T7TA 2XYXA 5KRAA 3RVFA 2GIUA 3RY9A 2AXAA 4Q0AC 3VT7A 4DORA 2AA6A 2B23A 1XV9A 2EWPA 2QGTA 2VV1A 3KPZA 3OGTA 2NXXE 4MG9B 2VV2A 3UU7B 3WGPA 4IQRA 2GPPA 5KRFA 3OMPA 1GS4A 2ZK4A 3ERDA 2XYWA 3R29A 3CWDA 3FLIA 4OIUA 4EMAA 1N46A 3W5TA 2Z4BA 5DZIA 1PK5A 2JJ3A 3B0WA 2OAXA 4QL8A 5DV6A 4PP5A 4JGVA 1XAPA 1RJKA 5DWJA 4PWLA 3W0IA 1OVLB 2NV7A 2Q60A 4DM6A 2H79A 5DK9A 5E19A 2JFAB 1R6GA 5DRMA 3ADVA 4J5XA 4OC7A 2GWXA 3G8OA 5HJPA 3A9EB 5DKGA 2PKLA 3MNPA 1I37A 3F7DA 5G43A 4J5XC 5GIEA 2R40D 2VV0A 3F5CB 1QKTA 3OSWA 5DIDA 3HQ5A 4LNXA 3KWYA 5DY8A 5AZTA 2PJLA 1YOKA 3VSOA 4ZNUA 3WFFA 4A4WA 3LBDA 4FHIA 5DIEA 3HZFA 1ILHA 1SKXA 1ZEOA 2AA2A 4OJ9A 5E15A 5DV3A 3KMZA 5GIDA 4WHFA 1FM6D 3VJHA 1X78A 3VTBA 5GICA 1FBYA 1XOWA 4IW8A 2YHDA 5DZ0A 4J26A 4OILA 2ZK0A 3FEJA 5FQPA 3VSPA 1S19A 3PLZA 2Q6RA 1Z5XE 1UHLA 5FQRA 2REWA 4OZTE 4WLBA 2QTUA 4ZJWA 2PRGA 3D6DA 4M8EA 3ET2A 3UUAA 2ACLB 5FQSA 1YY4A 3G8IA 3NSPA 3B5RA 3OOKA 3FALB 4E4QA 4EM9A 2HWRA 3E7CA 2P1UA 3W0AA 2AWHA 2ZVTA 4WPFA 2ZK3A 1SR7A 3GYUA 2QNVA 2PIWA 2QE4A 4NB6A 3UU7A 4POJA 2HB7A 4LBDA 4Q50A 4MG6A 4RMDA 1T7FA 2I0JA 3H52A 4N5GA 5L11A 5DXBB 2A3IA 3WWRA 2GTKA 5KRJA 5KCEA 4RZFA 3KDUA 4OKXA 2VSTA 3AZ3A 1OVLA 4JYIA 1WM0X 3PO9A 4IS8A 3TKMA 5DKSA 4DQMA 1U3RA 3DY6A 3HVLA 3CQVA 4MDDA 1XPCA 5DVCA 3FC6B 2ZK5A 3A9EA 2PIRA 1Z95A 5CJ6A 4S0TA 4OH6A 5KYAA 3F5CA 3U9QA 4Y29A 4OEYA 3VTDA 4YPQA 1ZKYA 5DI7A 5IZ0A 2ZKCA 3X36A 2YJAB 1T79A 5M96A 3B3KA 1PQ6A 2ZASA 1MZNA 3UUDB 5DZHA 5DYDA 5DVSA 5DXMA 5KRCA 1S0ZA 3VTCA 4WVDA 5DSHA 3W0CA 4N8RA 3ILZA 4RZEA 5LGAA 3OMQA 2AA7A 2P1TA 3ET1A 4OIVA 2I0GA 5LWPA 1P8DA 3V9VA 2HC4A 2Q8SA 1ILGA 3P88A 2Q3YA 4OFRA 3V3QA 2NW4A 2R6WA 3V9TA 2ACLA 3CLDA 2V7CA 3CJWA 2AB2A 4X1FA 3IPQA 3IXPA 2AX7A 3FALA 4OHAA 1GWQA 2QGWA 3D5FA 1G1UA 1T74A 2Q7JA 2ZK6A 5I4VA 3A3ZX 4OJBA 4ZNHA 2XHSA 3R2AA 1XP1A 4P6XA 4MGDB 4APUA 5IXKA 3VHVA 4MG8B 3WT6A 4ZN9A 3BEJA 4LTWA 3FEIA 1E3GA 4OEZA 5DXBA 1RKGA 1T65A 2QA6A 4N73A 4ZNTA 1M13A 5DV8A 2AX9A 2ZBSA 5HYRA 3HLVA 3JZCA 5KCFA 2HB8A 1M7WA 1N83A 1T5ZA 3OS9A 2IHQA 3OLFA 4UDCA 5E14A 4NQAB 3ZRAA 2QW4A 1R5KA 2ABIA 1PDUA 3FC6A 1XIUA 5AWJA 1ZAFA 1Z5XU 5E0XA 1GWXA 3GWXA 2I4PA 2AMBA 4ITEA 3WT7A 2QSEA 2ZFXA 1YINA 1FCXA 2QZOB 1FCYA 4RAKA 4QE6A 1S0XA 4JAZA 5DKBA 3UVVB 2V0VA 1YA3A 2ZXNA 2Q5PA 1YUCA 5DL4A 5K13A 5DUHA 4RFWA 3V49A 4R6SA 1XLSA 4G21A 3V4AA 3UUDA 2XYJA 5JJMB 1P93A 4REEA 4IWCA 2Q61A 1XNNA 2ZMJA 3ERTA 1ZGYA 3V3EA 3NSQA 3P8XA 1R20A 3B67A 3L3ZA 3ADTA 3B0QA 4PXMA 2Q5SA 3UUCA 3ZR7A 3L0LA 4R06A 1X76A 4JYGA 1XP9A 2YJDA 4XAOA 2QH6A 3OSAA 3IMYA 5L7HA 3X31A 1EXAA 2Q59B 4DM8A 4FN9A 4PLEA 1XQ3A 3AUNA 3VHWA 3BQDA 4YMQA 1VJBA 2ZL9A 2AM9A 4N1YA 1YMTA 5E0WA 1X7EA 4MGDA 4MGAB 3VRVA 5IAWA 5DXPA 4PLDA 1LV2A 2BJ4B 2Q1VA 2ZY0A 4IV4A 1G5YA 2BAWA 4KZIA 5E7VA 3HO0A 4KZMA 4LSJA 4WHGA 3W0JA 2P7GA 2QABA 3ADWA 5EI1A 2AMAA 5DZ1A 5DRJA 4CSJA 1RDTD 5HZCA 5KRIA 3CDSA 3S9SA 4XT9A 4OKTA 2G44A 4K4JA 5DXGA 4XLDA 3CS6A 5G42A 2ZLCA 2Z4JA 4IVWA 3E00D 3PCUA 4G1YA 2ZNPA 4PRGA 3SZ1A 4OEAA 5KCUA 3H0AD 4IA7A 5L7EA 4F9MA 3K6PA 2QZOA 2R40A 1HG4A 4B7WA 5JY3A 4PP3A 3KMRA 3UVVA 3OLLA 1K74D 3W0HA 1T73A 4FGYA 3TKCA 3CDPA 3FURA 5JJMA 1PRGA 3W5RA 1YP0A 3B1MA 1PQ9A 1FM6A 1S9QA 4MG9A 1RKHA 3K8SA 3GD2A 4ITFA 1HJ1A 4DMAA 2POBA 3OMKA 3QT0A 3AX8A 4E2JA 1NYXA 2HFPA 4BCRA 3ET0A 3GBKA 3H0AA 4RUJA 4ZNSA 3AZ1A 1G2NA 4M8HA 1ERRA 3A78A 2YLPA 5EITA 3DT3A 2XKWA 2HASA 2J7YA 5DWIA 2Q5GA 4ZI1A 1RK3A 1XB7A 1K7LA 2JFAA 4NY9A 3AN3A 3KMGA 3WT5A 3X1IA 3VT5A 2PIOA 4MGAA 3UP3A 5HJSA 2B1ZA 1L2IA 3D57A 5DXEA 3WJ4A 4RUOX 1QKNA 2BJ4A 3A2HA 4IU7A 2B50A 2P4YA 4POHA 4RMCA 5DMCA 5EJVA 1OSHA 5H1EA 5KCWA 2LBDA 1X7BA 2AA5A 3L0JA 5AK2A 3PEQA 4MG7B 5AAVB 5KD9A 1FD0A 1NAVA 5DXQA 1Y9RA 1QKMA 1KV6A 3BC5A 3ET3A 3OAPA 4OLMA 5AZVA 2NPAA 5JI0D 2ZXMA 4S15A 3AN4A 1I7GA 1YOWA 2OZ7A 1X7RA 1NUOA 2PITA 1XDKB 2HARA 3D24A 2PIQA 4DOSA 5AAUA 4QJRA 3VRWA 4IW6A 4OZRE 2QR9A 4XUHA 3W5PA 2OVMA 2Q7LA 2IOGA 1T7MA 3O1DA 3B0TA 4NUFA 4RMEA 4FNEA 2OUZA 5A86A 2AAXA 3ADSA 2HCDA 4XTAA 4G1ZA 1XQCA 2YATA 2GPOA 5GT4A 2GL8A 2Q1HA 3ADUA 2VV4B 5E1CA 1YIMA 5G45A 1E3KA 1XLSE 2FVJA 4UDBA 3R8AA 1UOMA 5DX3B 1X7JA 4R2UA 4XI3A 3GZ9A 2E2RA 3B0RA 5DZ3A 5G46A 1UPVA 4PPPA 3VJTA 1PQCA 4OKBA 4REFA 2P54A 3K23A 4Q13A 5SYZA 3W0YA 3JZBA 3N00A 3A40X 3KFCA 3L0EA 3VJIA 2J4AA 4MGBB 1MVCA 4IWFA 4OZTU 3GYTA 2P7AA 4RWVA 1DKFB 2GP7A 2W8YA 3RUUA 4CI4A 5C4OA 1S9PA 5EC9A 5AVIA 4A4VA 3OZ0A 4RZGA 3EYBA 1FM9D 4X1GA 3WTQA 5AAVA 3B68A 2YFEA 4MG7A 4IV2A 3OKIA 3FXVA 3O1EA 1TFCA 2HVCA 4O8FA 5KRHA 4YNKA 2ATHA 4UDAA 1M2ZA 4IA1A 2G0HA 5KRMA 2HAMA 4ONIA 1ZDTA 2P15A 2Q7IA 3G9EA 4OGHA 3R8DA 3RUTA 2PIPL 4JYHA 3IA6A 3VJSA 3VRUA 1SQNA 2QXSA 3DZUD 2O4RA 5B41A 1NRLA 1XNXA 2I4JA 2AYRA 3OS8C 5G5WA 5L7GA 3K22A 4G2HA 3OLSA 5DWLA 1UHLB 4L96A 4A2JA 3L03A 3UUAB 5HYKA 2O4JA 4G1DA 1OSVA 2VV4A 4MGCA 2AX8A 2OM9A 5KR9A 4OKWA 4IA2A 3HC5A 3RLLA 1XJ7A 3ZRBA 4TUZB 5APHA 2PIVA 4MG8A 5DX3A 4IVYA 3WJ5A 3AFRA 4IUIA 2VV3A 4QM0A 5AYGA 4DK8A 1OT7A 4ZNVA 3DZUA 2QMVA 4JL4A 5HCVA 1XZXX 2ZNNA 3D90A 4OFUA 1EREA 4DK7A 3IPUA 4ZNWA 4IA3A 1H9UA 4XUMA 3VT4A 3RLJA 1T76A 1QKUA 5KROA 3UP0A 4E4KA 3HC6A 1SJ0A 4HEEX 2P1VA 4OZRU 4MGBA 3VRTA 3DR1A 3ZQTA 1PCGA 1YJEA 3T03A 4LNWA 1DKFA 3HM1A 3AZ2A 2ZK2A 1A28A 1K4WA 1Y0XX 3DZYD 5KRLA 3WFGA 5DLRA 4ZJRA 1EXXA 3NOAA 5G44A 4RE8A 2JF9A 5DUEA 1ZH7A 1A52A 1RDTA 2AX6A 3Q95B 1GWRA 5DWGA 4NIEA 5APKA 3VI8A 4WQPA 4OK1A 2ZLAA 3CS8A 2NXXA 3AUQA 3M7RA 4ZN7A 5AVLA 3E00A 2VSRA 5F9BA 5C4SA 3GN8A 3VT6A 3P0UA 3DZYA 2Q59A 1I7IA 4ZOMA 1K74A 4P6WA 5DWEA 3MNOA 4KZJA 5FQTA 3VT3A 1KNUA 3HODA 4TUZA 5DKEA 1NQ1A 3G0WA 2F4BA 4HLWA 5APJA 3X1HA 1PZLA 3KBAA 2OCFA 4OARA 1NQ2A 3KYTA 3PRGA 5KYJA 4PVUA 2I4ZA 4FHHA 2B1VA 1I38A 1FCZA 2J7XA 5EGVA 4CI5A 2QA8B 3OMOA 2ZK1A 2ZMIA 2G5OA 4S14A 3VT9A 1BSXA 3V9YA 4TV1B 5DMFA 2G0GA 4XHDA 1XVPB 3OSIA 1DB1A 3OKHA 1Q4XA 5C4UA 5FQVA 5G3JA 4G20A 3WMHA 4YT1A 1IE9A 3ADXA 3R5MA 2GPVA 4QK4A 5DU5A 1ZDUA 1NQ0A 2ZNQA 3IXPD 3W5QA 2YLQA 4ZO1B 5DXRA 2FSZA 1XP6A 2HBHA 2Q70A 3A2JA 3Q95A 4MG5A 5DP0A 5AWKA 2HWQA 3R5NA 3E94A 3AURA 1ZUCA 3IPSA 1XV9B 2VV1B 1N4HA 3L3XA 4OJ4A 4J5WA 1KKQA 3GWSX 2QPYA 1UPWA 2H77A 3DCUA 3PBAA 1T7RA 4J24A 3L1BA 4J5WC 1IE8A 2AO6A 1TXIA 5C4TA 1NAXA 1L2JA 5KRKA 5KCTA 2QXMA 4ZO1X 2POGA 2R6YA 2YLYA 3OZJA 4G2IA 2P7ZA 4QE8A 5DXKA 3LMPA 2PINA 3B66A 5ACCA 2PIUA 4OEDA 2PNUA 3A2IA 1NDEA 4K7AA 2FAIA 3DCTA 5ICKA 1R1KD 2ZMHA 3TY0A 3OOFA 5HJPB 4K6IA 4RUPA 3OMMA 3SP9A 2Q7KA 3W0GA 2ZNOA 3VN2A 5B5BA 5ETHA 1NQ7A
chains in the Genus database with same CATH superfamily
1NHZA 3MNEA 5DVVA 1LBDA 3B65A 4PP6A 3VT8A 2QA8A 3CTBA 1MV9A 3P89A 2Q6JA 3KDTA 2PIXA 1G50A 1XDKA 1Y0SA 2O9IA 2YLOA 4TV1A 1U9EA 4PPSA 4PF3A 3SP6A 1XVPA 5KCDA 3TX7B 5EHJA 3OS8A 5DIGA 1T63A 4S0SA 1R20D 2GPUA 3FS1A 5DTVA 5DUGA 5KCCA 1U3QA 1R1KA 5DYBA 3R8IA 3VHUA 2J14A 4L98A 2OVHA 1YYEA 2Q6SA 4UDDA 4OH5A 1U3SA 2ZXZA 1FM9A 2IOKA 3CS4A 3FUGA 1T7TA 2XYXA 5KRAA 3RVFA 2GIUA 3RY9A 2AXAA 4Q0AC 3VT7A 4DORA 2AA6A 2B23A 1XV9A 2EWPA 2QGTA 2VV1A 3KPZA 3OGTA 2NXXE 4MG9B 2VV2A 3UU7B 3WGPA 4IQRA 2GPPA 5KRFA 3OMPA 1GS4A 2ZK4A 3ERDA 2XYWA 3R29A 3CWDA 3FLIA 4OIUA 4EMAA 1N46A 3W5TA 2Z4BA 5DZIA 1PK5A 2JJ3A 3B0WA 2OAXA 4QL8A 5DV6A 4PP5A 4JGVA 1XAPA 1RJKA 5DWJA 4PWLA 3W0IA 1OVLB 2NV7A 2Q60A 4DM6A 2H79A 5DK9A 5E19A 2JFAB 1R6GA 5DRMA 3ADVA 4J5XA 4OC7A 2GWXA 3G8OA 5HJPA 3A9EB 5DKGA 2PKLA 3MNPA 1I37A 3F7DA 5G43A 4J5XC 5GIEA 2R40D 2VV0A 3F5CB 1QKTA 3OSWA 5DIDA 3HQ5A 4LNXA 3KWYA 5DY8A 5AZTA 2PJLA 1YOKA 3VSOA 4ZNUA 3WFFA 4A4WA 3LBDA 4FHIA 5DIEA 3HZFA 1ILHA 1SKXA 1ZEOA 2AA2A 4OJ9A 5E15A 5DV3A 3KMZA 5GIDA 4WHFA 1FM6D 3VJHA 1X78A 3VTBA 5GICA 1FBYA 1XOWA 4IW8A 2YHDA 5DZ0A 4J26A 4OILA 2ZK0A 3FEJA 5FQPA 3VSPA 1S19A 3PLZA 2Q6RA 1Z5XE 1UHLA 5FQRA 2REWA 4OZTE 4WLBA 2QTUA 4ZJWA 2PRGA 3D6DA 4M8EA 3ET2A 3UUAA 2ACLB 5FQSA 1YY4A 3G8IA 3NSPA 3B5RA 3OOKA 3FALB 4E4QA 4EM9A 2HWRA 3E7CA 2P1UA 3W0AA 2AWHA 2ZVTA 4WPFA 2ZK3A 1SR7A 3GYUA 2QNVA 2PIWA 2QE4A 4NB6A 3UU7A 4POJA 2HB7A 4LBDA 4Q50A 4MG6A 4RMDA 1T7FA 2I0JA 3H52A 4N5GA 5L11A 5DXBB 2A3IA 3WWRA 2GTKA 5KRJA 5KCEA 4RZFA 3KDUA 4OKXA 2VSTA 3AZ3A 1OVLA 4JYIA 1WM0X 3PO9A 4IS8A 3TKMA 5DKSA 4DQMA 1U3RA 3DY6A 3HVLA 3CQVA 4MDDA 1XPCA 5DVCA 3FC6B 2ZK5A 3A9EA 2PIRA 1Z95A 5CJ6A 4S0TA 4OH6A 5KYAA 3F5CA 3U9QA 4Y29A 4OEYA 3VTDA 4YPQA 1ZKYA 5DI7A 5IZ0A 2ZKCA 3X36A 2YJAB 1T79A 5M96A 3B3KA 1PQ6A 2ZASA 1MZNA 3UUDB 5DZHA 5DYDA 5DVSA 5DXMA 5KRCA 1S0ZA 3VTCA 4WVDA 5DSHA 3W0CA 4N8RA 3ILZA 4RZEA 5LGAA 3OMQA 2AA7A 2P1TA 3ET1A 4OIVA 2I0GA 5LWPA 1P8DA 3V9VA 2HC4A 2Q8SA 1ILGA 3P88A 2Q3YA 4OFRA 3V3QA 2NW4A 2R6WA 3V9TA 2ACLA 3CLDA 2V7CA 3CJWA 2AB2A 4X1FA 3IPQA 3IXPA 2AX7A 3FALA 4OHAA 1GWQA 2QGWA 3D5FA 1G1UA 1T74A 2Q7JA 2ZK6A 5I4VA 3A3ZX 4OJBA 4ZNHA 2XHSA 3R2AA 1XP1A 4P6XA 4MGDB 4APUA 5IXKA 3VHVA 4MG8B 3WT6A 4ZN9A 3BEJA 4LTWA 3FEIA 1E3GA 4OEZA 5DXBA 1RKGA 1T65A 2QA6A 4N73A 4ZNTA 1M13A 5DV8A 2AX9A 2ZBSA 5HYRA 3HLVA 3JZCA 5KCFA 2HB8A 1M7WA 1N83A 1T5ZA 3OS9A 2IHQA 3OLFA 4UDCA 5E14A 4NQAB 3ZRAA 2QW4A 1R5KA 2ABIA 1PDUA 3FC6A 1XIUA 5AWJA 1ZAFA 1Z5XU 5E0XA 1GWXA 3GWXA 2I4PA 2AMBA 4ITEA 3WT7A 2QSEA 2ZFXA 1YINA 1FCXA 2QZOB 1FCYA 4RAKA 4QE6A 1S0XA 4JAZA 5DKBA 3UVVB 2V0VA 1YA3A 2ZXNA 2Q5PA 1YUCA 5DL4A 5K13A 5DUHA 4RFWA 3V49A 4R6SA 1XLSA 4G21A 3V4AA 3UUDA 2XYJA 5JJMB 1P93A 4REEA 4IWCA 2Q61A 1XNNA 2ZMJA 3ERTA 1ZGYA 3V3EA 3NSQA 3P8XA 1R20A 3B67A 3L3ZA 3ADTA 3B0QA 4PXMA 2Q5SA 3UUCA 3ZR7A 3L0LA 4R06A 1X76A 4JYGA 1XP9A 2YJDA 4XAOA 2QH6A 3OSAA 3IMYA 5L7HA 3X31A 1EXAA 2Q59B 4DM8A 4FN9A 4PLEA 1XQ3A 3AUNA 3VHWA 3BQDA 4YMQA 1VJBA 2ZL9A 2AM9A 4N1YA 1YMTA 5E0WA 1X7EA 4MGDA 4MGAB 3VRVA 5IAWA 5DXPA 4PLDA 1LV2A 2BJ4B 2Q1VA 2ZY0A 4IV4A 1G5YA 2BAWA 4KZIA 5E7VA 3HO0A 4KZMA 4LSJA 4WHGA 3W0JA 2P7GA 2QABA 3ADWA 5EI1A 2AMAA 5DZ1A 5DRJA 4CSJA 1RDTD 5HZCA 5KRIA 3CDSA 3S9SA 4XT9A 4OKTA 2G44A 4K4JA 5DXGA 4XLDA 3CS6A 5G42A 2ZLCA 2Z4JA 4IVWA 3E00D 3PCUA 4G1YA 2ZNPA 4PRGA 3SZ1A 4OEAA 5KCUA 3H0AD 4IA7A 5L7EA 4F9MA 3K6PA 2QZOA 2R40A 1HG4A 4B7WA 5JY3A 4PP3A 3KMRA 3UVVA 3OLLA 1K74D 3W0HA 1T73A 4FGYA 3TKCA 3CDPA 3FURA 5JJMA 1PRGA 3W5RA 1YP0A 3B1MA 1PQ9A 1FM6A 1S9QA 4MG9A 1RKHA 3K8SA 3GD2A 4ITFA 1HJ1A 4DMAA 2POBA 3OMKA 3QT0A 3AX8A 4E2JA 1NYXA 2HFPA 4BCRA 3ET0A 3GBKA 3H0AA 4RUJA 4ZNSA 3AZ1A 1G2NA 4M8HA 1ERRA 3A78A 2YLPA 5EITA 3DT3A 2XKWA 2HASA 2J7YA 5DWIA 2Q5GA 4ZI1A 1RK3A 1XB7A 1K7LA 2JFAA 4NY9A 3AN3A 3KMGA 3WT5A 3X1IA 3VT5A 2PIOA 4MGAA 3UP3A 5HJSA 2B1ZA 1L2IA 3D57A 5DXEA 3WJ4A 4RUOX 1QKNA 2BJ4A 3A2HA 4IU7A 2B50A 2P4YA 4POHA 4RMCA 5DMCA 5EJVA 1OSHA 5H1EA 5KCWA 2LBDA 1X7BA 2AA5A 3L0JA 5AK2A 3PEQA 4MG7B 5AAVB 5KD9A 1FD0A 1NAVA 5DXQA 1Y9RA 1QKMA 1KV6A 3BC5A 3ET3A 3OAPA 4OLMA 5AZVA 2NPAA 5JI0D 2ZXMA 4S15A 3AN4A 1I7GA 1YOWA 2OZ7A 1X7RA 1NUOA 2PITA 1XDKB 2HARA 3D24A 2PIQA 4DOSA 5AAUA 4QJRA 3VRWA 4IW6A 4OZRE 2QR9A 4XUHA 3W5PA 2OVMA 2Q7LA 2IOGA 1T7MA 3O1DA 3B0TA 4NUFA 4RMEA 4FNEA 2OUZA 5A86A 2AAXA 3ADSA 2HCDA 4XTAA 4G1ZA 1XQCA 2YATA 2GPOA 5GT4A 2GL8A 2Q1HA 3ADUA 2VV4B 5E1CA 1YIMA 5G45A 1E3KA 1XLSE 2FVJA 4UDBA 3R8AA 1UOMA 5DX3B 1X7JA 4R2UA 4XI3A 3GZ9A 2E2RA 3B0RA 5DZ3A 5G46A 1UPVA 4PPPA 3VJTA 1PQCA 4OKBA 4REFA 2P54A 3K23A 4Q13A 5SYZA 3W0YA 3JZBA 3N00A 3A40X 3KFCA 3L0EA 3VJIA 2J4AA 4MGBB 1MVCA 4IWFA 4OZTU 3GYTA 2P7AA 4RWVA 1DKFB 2GP7A 2W8YA 3RUUA 4CI4A 5C4OA 1S9PA 5EC9A 5AVIA 4A4VA 3OZ0A 4RZGA 3EYBA 1FM9D 4X1GA 3WTQA 5AAVA 3B68A 2YFEA 4MG7A 4IV2A 3OKIA 3FXVA 3O1EA 1TFCA 2HVCA 4O8FA 5KRHA 4YNKA 2ATHA 4UDAA 1M2ZA 4IA1A 2G0HA 5KRMA 2HAMA 4ONIA 1ZDTA 2P15A 2Q7IA 3G9EA 4OGHA 3R8DA 3RUTA 2PIPL 4JYHA 3IA6A 3VJSA 3VRUA 1SQNA 2QXSA 3DZUD 2O4RA 5B41A 1NRLA 1XNXA 2I4JA 2AYRA 3OS8C 5G5WA 5L7GA 3K22A 4G2HA 3OLSA 5DWLA 1UHLB 4L96A 4A2JA 3L03A 3UUAB 5HYKA 2O4JA 4G1DA 1OSVA 2VV4A 4MGCA 2AX8A 2OM9A 5KR9A 4OKWA 4IA2A 3HC5A 3RLLA 1XJ7A 3ZRBA 4TUZB 5APHA 2PIVA 4MG8A 5DX3A 4IVYA 3WJ5A 3AFRA 4IUIA 2VV3A 4QM0A 5AYGA 4DK8A 1OT7A 4ZNVA 3DZUA 2QMVA 4JL4A 5HCVA 1XZXX 2ZNNA 3D90A 4OFUA 1EREA 4DK7A 3IPUA 4ZNWA 4IA3A 1H9UA 4XUMA 3VT4A 3RLJA 1T76A 1QKUA 5KROA 3UP0A 4E4KA 3HC6A 1SJ0A 4HEEX 2P1VA 4OZRU 4MGBA 3VRTA 3DR1A 3ZQTA 1PCGA 1YJEA 3T03A 4LNWA 1DKFA 3HM1A 3AZ2A 2ZK2A 1A28A 1K4WA 1Y0XX 3DZYD 5KRLA 3WFGA 5DLRA 4ZJRA 1EXXA 3NOAA 5G44A 4RE8A 2JF9A 5DUEA 1ZH7A 1A52A 1RDTA 2AX6A 3Q95B 1GWRA 5DWGA 4NIEA 5APKA 3VI8A 4WQPA 4OK1A 2ZLAA 3CS8A 2NXXA 3AUQA 3M7RA 4ZN7A 5AVLA 3E00A 2VSRA 5F9BA 5C4SA 3GN8A 3VT6A 3P0UA 3DZYA 2Q59A 1I7IA 4ZOMA 1K74A 4P6WA 5DWEA 3MNOA 4KZJA 5FQTA 3VT3A 1KNUA 3HODA 4TUZA 5DKEA 1NQ1A 3G0WA 2F4BA 4HLWA 5APJA 3X1HA 1PZLA 3KBAA 2OCFA 4OARA 1NQ2A 3KYTA 3PRGA 5KYJA 4PVUA 2I4ZA 4FHHA 2B1VA 1I38A 1FCZA 2J7XA 5EGVA 4CI5A 2QA8B 3OMOA 2ZK1A 2ZMIA 2G5OA 4S14A 3VT9A 1BSXA 3V9YA 4TV1B 5DMFA 2G0GA 4XHDA 1XVPB 3OSIA 1DB1A 3OKHA 1Q4XA 5C4UA 5FQVA 5G3JA 4G20A 3WMHA 4YT1A 1IE9A 3ADXA 3R5MA 2GPVA 4QK4A 5DU5A 1ZDUA 1NQ0A 2ZNQA 3IXPD 3W5QA 2YLQA 4ZO1B 5DXRA 2FSZA 1XP6A 2HBHA 2Q70A 3A2JA 3Q95A 4MG5A 5DP0A 5AWKA 2HWQA 3R5NA 3E94A 3AURA 1ZUCA 3IPSA 1XV9B 2VV1B 1N4HA 3L3XA 4OJ4A 4J5WA 1KKQA 3GWSX 2QPYA 1UPWA 2H77A 3DCUA 3PBAA 1T7RA 4J24A 3L1BA 4J5WC 1IE8A 2AO6A 1TXIA 5C4TA 1NAXA 1L2JA 5KRKA 5KCTA 2QXMA 4ZO1X 2POGA 2R6YA 2YLYA 3OZJA 4G2IA 2P7ZA 4QE8A 5DXKA 3LMPA 2PINA 3B66A 5ACCA 2PIUA 4OEDA 2PNUA 3A2IA 1NDEA 4K7AA 2FAIA 3DCTA 5ICKA 1R1KD 2ZMHA 3TY0A 3OOFA 5HJPB 4K6IA 4RUPA 3OMMA 3SP9A 2Q7KA 3W0GA 2ZNOA 3VN2A 5B5BA 5ETHA 1NQ7A
chains in the Genus database with same CATH topology
1NHZA 3MNEA 5DVVA 1LBDA 3B65A 4PP6A 3VT8A 2QA8A 3CTBA 1MV9A 3P89A 2Q6JA 3KDTA 2PIXA 1G50A 1XDKA 1Y0SA 2O9IA 2YLOA 4TV1A 1U9EA 4PPSA 4PF3A 3SP6A 1XVPA 5KCDA 3TX7B 5EHJA 3OS8A 5DIGA 1T63A 4S0SA 1R20D 2GPUA 3FS1A 5DTVA 5DUGA 5KCCA 1U3QA 1R1KA 5DYBA 3R8IA 3VHUA 2J14A 4L98A 2OVHA 1YYEA 2Q6SA 4UDDA 4OH5A 1U3SA 2ZXZA 1FM9A 2IOKA 3CS4A 3FUGA 1T7TA 2XYXA 5KRAA 3RVFA 2GIUA 3RY9A 2AXAA 4Q0AC 3VT7A 4DORA 2AA6A 2B23A 1XV9A 2EWPA 2QGTA 2VV1A 3KPZA 3OGTA 2NXXE 4MG9B 2VV2A 3UU7B 3WGPA 4IQRA 2GPPA 5KRFA 3OMPA 1GS4A 2ZK4A 3ERDA 2XYWA 3R29A 3CWDA 3FLIA 4OIUA 4EMAA 1N46A 3W5TA 2Z4BA 5DZIA 1PK5A 2JJ3A 3B0WA 2OAXA 4QL8A 5DV6A 4PP5A 4JGVA 1XAPA 1RJKA 5DWJA 4PWLA 3W0IA 1OVLB 2NV7A 2Q60A 4DM6A 2H79A 5DK9A 5E19A 2JFAB 1R6GA 5DRMA 3ADVA 4J5XA 4OC7A 2GWXA 3G8OA 5HJPA 3A9EB 5DKGA 2PKLA 3MNPA 1I37A 3F7DA 5G43A 4J5XC 5GIEA 2R40D 2VV0A 3F5CB 1QKTA 3OSWA 5DIDA 3HQ5A 4LNXA 3KWYA 5DY8A 5AZTA 2PJLA 1YOKA 3VSOA 4ZNUA 3WFFA 4A4WA 3LBDA 4FHIA 5DIEA 3HZFA 1ILHA 1SKXA 1ZEOA 2AA2A 4OJ9A 5E15A 5DV3A 3KMZA 5GIDA 4WHFA 1FM6D 3VJHA 1X78A 3VTBA 5GICA 1FBYA 1XOWA 4IW8A 2YHDA 5DZ0A 4J26A 4OILA 2ZK0A 3FEJA 5FQPA 3VSPA 1S19A 3PLZA 2Q6RA 1Z5XE 1UHLA 5FQRA 2REWA 4OZTE 4WLBA 2QTUA 4ZJWA 2PRGA 3D6DA 4M8EA 3ET2A 3UUAA 2ACLB 5FQSA 1YY4A 3G8IA 3NSPA 3B5RA 3OOKA 3FALB 4E4QA 4EM9A 2HWRA 3E7CA 2P1UA 3W0AA 2AWHA 2ZVTA 4WPFA 2ZK3A 1SR7A 3GYUA 2QNVA 2PIWA 2QE4A 4NB6A 3UU7A 4POJA 2HB7A 4LBDA 4Q50A 4MG6A 4RMDA 1T7FA 2I0JA 3H52A 4N5GA 5L11A 5DXBB 2A3IA 3WWRA 2GTKA 5KRJA 5KCEA 4RZFA 3KDUA 4OKXA 2VSTA 3AZ3A 1OVLA 4JYIA 1WM0X 3PO9A 4IS8A 3TKMA 5DKSA 4DQMA 1U3RA 3DY6A 3HVLA 3CQVA 4MDDA 1XPCA 5DVCA 3FC6B 2ZK5A 3A9EA 2PIRA 1Z95A 5CJ6A 4S0TA 4OH6A 5KYAA 3F5CA 3U9QA 4Y29A 4OEYA 3VTDA 4YPQA 1ZKYA 5DI7A 5IZ0A 2ZKCA 3X36A 2YJAB 1T79A 5M96A 3B3KA 1PQ6A 2ZASA 1MZNA 3UUDB 5DZHA 5DYDA 5DVSA 5DXMA 5KRCA 1S0ZA 3VTCA 4WVDA 5DSHA 3W0CA 4N8RA 3ILZA 4RZEA 5LGAA 3OMQA 2AA7A 2P1TA 3ET1A 4OIVA 2I0GA 5LWPA 1P8DA 3V9VA 2HC4A 2Q8SA 1ILGA 3P88A 2Q3YA 4OFRA 3V3QA 2NW4A 2R6WA 3V9TA 2ACLA 3CLDA 2V7CA 3CJWA 2AB2A 4X1FA 3IPQA 3IXPA 2AX7A 3FALA 4OHAA 1GWQA 2QGWA 3D5FA 1G1UA 1T74A 2Q7JA 2ZK6A 5I4VA 3A3ZX 4OJBA 4ZNHA 2XHSA 3R2AA 1XP1A 4P6XA 4MGDB 4APUA 5IXKA 3VHVA 4MG8B 3WT6A 4ZN9A 3BEJA 4LTWA 3FEIA 1E3GA 4OEZA 5DXBA 1RKGA 1T65A 2QA6A 4N73A 4ZNTA 1M13A 5DV8A 2AX9A 2ZBSA 5HYRA 3HLVA 3JZCA 5KCFA 2HB8A 1M7WA 1N83A 1T5ZA 3OS9A 2IHQA 3OLFA 4UDCA 5E14A 4NQAB 3ZRAA 2QW4A 1R5KA 2ABIA 1PDUA 3FC6A 1XIUA 5AWJA 1ZAFA 1Z5XU 5E0XA 1GWXA 3GWXA 2I4PA 2AMBA 4ITEA 3WT7A 2QSEA 2ZFXA 1YINA 1FCXA 2QZOB 1FCYA 4RAKA 4QE6A 1S0XA 4JAZA 5DKBA 3UVVB 2V0VA 1YA3A 2ZXNA 2Q5PA 1YUCA 5DL4A 5K13A 5DUHA 4RFWA 3V49A 4R6SA 1XLSA 4G21A 3V4AA 3UUDA 2XYJA 5JJMB 1P93A 4REEA 4IWCA 2Q61A 1XNNA 2ZMJA 3ERTA 1ZGYA 3V3EA 3NSQA 3P8XA 1R20A 3B67A 3L3ZA 3ADTA 3B0QA 4PXMA 2Q5SA 3UUCA 3ZR7A 3L0LA 4R06A 1X76A 4JYGA 1XP9A 2YJDA 4XAOA 2QH6A 3OSAA 3IMYA 5L7HA 3X31A 1EXAA 2Q59B 4DM8A 4FN9A 4PLEA 1XQ3A 3AUNA 3VHWA 3BQDA 4YMQA 1VJBA 2ZL9A 2AM9A 4N1YA 1YMTA 5E0WA 1X7EA 4MGDA 4MGAB 3VRVA 5IAWA 5DXPA 4PLDA 1LV2A 2BJ4B 2Q1VA 2ZY0A 4IV4A 1G5YA 2BAWA 4KZIA 5E7VA 3HO0A 4KZMA 4LSJA 4WHGA 3W0JA 2P7GA 2QABA 3ADWA 5EI1A 2AMAA 5DZ1A 5DRJA 4CSJA 1RDTD 5HZCA 5KRIA 3CDSA 3S9SA 4XT9A 4OKTA 2G44A 4K4JA 5DXGA 4XLDA 3CS6A 5G42A 2ZLCA 2Z4JA 4IVWA 3E00D 3PCUA 4G1YA 2ZNPA 4PRGA 3SZ1A 4OEAA 5KCUA 3H0AD 4IA7A 5L7EA 4F9MA 3K6PA 2QZOA 2R40A 1HG4A 4B7WA 5JY3A 4PP3A 3KMRA 3UVVA 3OLLA 1K74D 3W0HA 1T73A 4FGYA 3TKCA 3CDPA 3FURA 5JJMA 1PRGA 3W5RA 1YP0A 3B1MA 1PQ9A 1FM6A 1S9QA 4MG9A 1RKHA 3K8SA 3GD2A 4ITFA 1HJ1A 4DMAA 2POBA 3OMKA 3QT0A 3AX8A 4E2JA 1NYXA 2HFPA 4BCRA 3ET0A 3GBKA 3H0AA 4RUJA 4ZNSA 3AZ1A 1G2NA 4M8HA 1ERRA 3A78A 2YLPA 5EITA 3DT3A 2XKWA 2HASA 2J7YA 5DWIA 2Q5GA 4ZI1A 1RK3A 1XB7A 1K7LA 2JFAA 4NY9A 3AN3A 3KMGA 3WT5A 3X1IA 3VT5A 2PIOA 4MGAA 3UP3A 5HJSA 2B1ZA 1L2IA 3D57A 5DXEA 3WJ4A 4RUOX 1QKNA 2BJ4A 3A2HA 4IU7A 2B50A 2P4YA 4POHA 4RMCA 5DMCA 5EJVA 1OSHA 5H1EA 5KCWA 2LBDA 1X7BA 2AA5A 3L0JA 5AK2A 3PEQA 4MG7B 5AAVB 5KD9A 1FD0A 1NAVA 5DXQA 1Y9RA 1QKMA 1KV6A 3BC5A 3ET3A 3OAPA 4OLMA 5AZVA 2NPAA 5JI0D 2ZXMA 4S15A 3AN4A 1I7GA 1YOWA 2OZ7A 1X7RA 1NUOA 2PITA 1XDKB 2HARA 3D24A 2PIQA 4DOSA 5AAUA 4QJRA 3VRWA 4IW6A 4OZRE 2QR9A 4XUHA 3W5PA 2OVMA 2Q7LA 2IOGA 1T7MA 3O1DA 3B0TA 4NUFA 4RMEA 4FNEA 2OUZA 5A86A 2AAXA 3ADSA 2HCDA 4XTAA 4G1ZA 1XQCA 2YATA 2GPOA 5GT4A 2GL8A 2Q1HA 3ADUA 2VV4B 5E1CA 1YIMA 5G45A 1E3KA 1XLSE 2FVJA 4UDBA 3R8AA 1UOMA 5DX3B 1X7JA 4R2UA 4XI3A 3GZ9A 2E2RA 3B0RA 5DZ3A 5G46A 1UPVA 4PPPA 3VJTA 1PQCA 4OKBA 4REFA 2P54A 3K23A 4Q13A 5SYZA 3W0YA 3JZBA 3N00A 3A40X 3KFCA 3L0EA 3VJIA 2J4AA 4MGBB 1MVCA 4IWFA 4OZTU 3GYTA 2P7AA 4RWVA 1DKFB 2GP7A 2W8YA 3RUUA 4CI4A 5C4OA 1S9PA 5EC9A 5AVIA 4A4VA 3OZ0A 4RZGA 3EYBA 1FM9D 4X1GA 3WTQA 5AAVA 3B68A 2YFEA 4MG7A 4IV2A 3OKIA 3FXVA 3O1EA 1TFCA 2HVCA 4O8FA 5KRHA 4YNKA 2ATHA 4UDAA 1M2ZA 4IA1A 2G0HA 5KRMA 2HAMA 4ONIA 1ZDTA 2P15A 2Q7IA 3G9EA 4OGHA 3R8DA 3RUTA 2PIPL 4JYHA 3IA6A 3VJSA 3VRUA 1SQNA 2QXSA 3DZUD 2O4RA 5B41A 1NRLA 1XNXA 2I4JA 2AYRA 3OS8C 5G5WA 5L7GA 3K22A 4G2HA 3OLSA 5DWLA 1UHLB 4L96A 4A2JA 3L03A 3UUAB 5HYKA 2O4JA 4G1DA 1OSVA 2VV4A 4MGCA 2AX8A 2OM9A 5KR9A 4OKWA 4IA2A 3HC5A 3RLLA 1XJ7A 3ZRBA 4TUZB 5APHA 2PIVA 4MG8A 5DX3A 4IVYA 3WJ5A 3AFRA 4IUIA 2VV3A 4QM0A 5AYGA 4DK8A 1OT7A 4ZNVA 3DZUA 2QMVA 4JL4A 5HCVA 1XZXX 2ZNNA 3D90A 4OFUA 1EREA 4DK7A 3IPUA 4ZNWA 4IA3A 1H9UA 4XUMA 3VT4A 3RLJA 1T76A 1QKUA 5KROA 3UP0A 4E4KA 3HC6A 1SJ0A 4HEEX 2P1VA 4OZRU 4MGBA 3VRTA 3DR1A 3ZQTA 1PCGA 1YJEA 3T03A 4LNWA 1DKFA 3HM1A 3AZ2A 2ZK2A 1A28A 1K4WA 1Y0XX 3DZYD 5KRLA 3WFGA 5DLRA 4ZJRA 1EXXA 3NOAA 5G44A 4RE8A 2JF9A 5DUEA 1ZH7A 1A52A 1RDTA 2AX6A 3Q95B 1GWRA 5DWGA 4NIEA 5APKA 3VI8A 4WQPA 4OK1A 2ZLAA 3CS8A 2NXXA 3AUQA 3M7RA 4ZN7A 5AVLA 3E00A 2VSRA 5F9BA 5C4SA 3GN8A 3VT6A 3P0UA 3DZYA 2Q59A 1I7IA 4ZOMA 1K74A 4P6WA 5DWEA 3MNOA 4KZJA 5FQTA 3VT3A 1KNUA 3HODA 4TUZA 5DKEA 1NQ1A 3G0WA 2F4BA 4HLWA 5APJA 3X1HA 1PZLA 3KBAA 2OCFA 4OARA 1NQ2A 3KYTA 3PRGA 5KYJA 4PVUA 2I4ZA 4FHHA 2B1VA 1I38A 1FCZA 2J7XA 5EGVA 4CI5A 2QA8B 3OMOA 2ZK1A 2ZMIA 2G5OA 4S14A 3VT9A 1BSXA 3V9YA 4TV1B 5DMFA 2G0GA 4XHDA 1XVPB 3OSIA 1DB1A 3OKHA 1Q4XA 5C4UA 5FQVA 5G3JA 4G20A 3WMHA 4YT1A 1IE9A 3ADXA 3R5MA 2GPVA 4QK4A 5DU5A 1ZDUA 1NQ0A 2ZNQA 3IXPD 3W5QA 2YLQA 4ZO1B 5DXRA 2FSZA 1XP6A 2HBHA 2Q70A 3A2JA 3Q95A 4MG5A 5DP0A 5AWKA 2HWQA 3R5NA 3E94A 3AURA 1ZUCA 3IPSA 1XV9B 2VV1B 1N4HA 3L3XA 4OJ4A 4J5WA 1KKQA 3GWSX 2QPYA 1UPWA 2H77A 3DCUA 3PBAA 1T7RA 4J24A 3L1BA 4J5WC 1IE8A 2AO6A 1TXIA 5C4TA 1NAXA 1L2JA 5KRKA 5KCTA 2QXMA 4ZO1X 2POGA 2R6YA 2YLYA 3OZJA 4G2IA 2P7ZA 4QE8A 5DXKA 3LMPA 2PINA 3B66A 5ACCA 2PIUA 4OEDA 2PNUA 3A2IA 1NDEA 4K7AA 2FAIA 3DCTA 5ICKA 1R1KD 2ZMHA 3TY0A 3OOFA 5HJPB 4K6IA 4RUPA 3OMMA 3SP9A 2Q7KA 3W0GA 2ZNOA 3VN2A 5B5BA 5ETHA 1NQ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NHZ A;  3MNE A;  5DVV A;  1LBD A;  3B65 A;  4PP6 A;  3VT8 A;  2QA8 A;  3CTB A;  1MV9 A;  3P89 A;  2Q6J A;  3KDT A;  2PIX A;  1G50 A;  1XDK A;  1Y0S A;  2O9I A;  2YLO A;  4TV1 A;  1U9E A;  4PPS A;  4PF3 A;  3SP6 A;  1XVP A;  5KCD A;  3TX7 B;  5EHJ A;  3OS8 A;  5DIG A;  1T63 A;  4S0S A;  1R20 D;  2GPU A;  3FS1 A;  5DTV A;  5DUG A;  5KCC A;  1U3Q A;  1R1K A;  5DYB A;  3R8I A;  3VHU A;  2J14 A;  4L98 A;  2OVH A;  1YYE A;  2Q6S A;  4UDD A;  4OH5 A;  1U3S A;  2ZXZ A;  1FM9 A;  2IOK A;  3CS4 A;  3FUG A;  1T7T A;  2XYX A;  5KRA A;  3RVF A;  2GIU A;  3RY9 A;  2AXA A;  4Q0A C;  3VT7 A;  4DOR A;  2AA6 A;  2B23 A;  1XV9 A;  2EWP A;  2QGT A;  2VV1 A;  3KPZ A;  3OGT A;  2NXX E;  4MG9 B;  2VV2 A;  3UU7 B;  3WGP A;  4IQR A;  2GPP A;  5KRF A;  3OMP A;  1GS4 A;  2ZK4 A;  3ERD A;  2XYW A;  3R29 A;  3CWD A;  3FLI A;  4OIU A;  4EMA A;  1N46 A;  3W5T A;  2Z4B A;  5DZI A;  1PK5 A;  2JJ3 A;  3B0W A;  2OAX A;  4QL8 A;  5DV6 A;  4PP5 A;  4JGV A;  1XAP A;  1RJK A;  5DWJ A;  4PWL A;  3W0I A;  1OVL B;  2NV7 A;  2Q60 A;  4DM6 A;  2H79 A;  5DK9 A;  5E19 A;  2JFA B;  1R6G A;  5DRM A;  3ADV A;  4J5X A;  4OC7 A;  2GWX A;  3G8O A;  5HJP A;  3A9E B;  5DKG A;  2PKL A;  3MNP A;  1I37 A;  3F7D A;  5G43 A;  4J5X C;  5GIE A;  2R40 D;  2VV0 A;  3F5C B;  1QKT A;  3OSW A;  5DID A;  3HQ5 A;  4LNX A;  3KWY A;  5DY8 A;  5AZT A;  2PJL A;  1YOK A;  3VSO A;  4ZNU A;  3WFF A;  4A4W A;  3LBD A;  4FHI A;  5DIE A;  3HZF A;  1ILH A;  1SKX A;  1ZEO A;  2AA2 A;  4OJ9 A;  5E15 A;  5DV3 A;  3KMZ A;  5GID A;  4WHF A;  1FM6 D;  3VJH A;  1X78 A;  3VTB A;  5GIC A;  1FBY A;  1XOW A;  4IW8 A;  2YHD A;  5DZ0 A;  4J26 A;  4OIL A;  2ZK0 A;  3FEJ A;  5FQP A;  3VSP A;  1S19 A;  3PLZ A;  2Q6R A;  1Z5X E;  1UHL A;  5FQR A;  2REW A;  4OZT E;  4WLB A;  2QTU A;  4ZJW A;  2PRG A;  3D6D A;  4M8E A;  3ET2 A;  3UUA A;  2ACL B;  5FQS A;  1YY4 A;  3G8I A;  3NSP A;  3B5R A;  3OOK A;  3FAL B;  4E4Q A;  4EM9 A;  2HWR A;  3E7C A;  2P1U A;  3W0A A;  2AWH A;  2ZVT A;  4WPF A;  2ZK3 A;  1SR7 A;  3GYU A;  2QNV A;  2PIW A;  2QE4 A;  4NB6 A;  3UU7 A;  4POJ A;  2HB7 A;  4LBD A;  4Q50 A;  4MG6 A;  4RMD A;  1T7F A;  2I0J A;  3H52 A;  4N5G A;  5L11 A;  5DXB B;  2A3I A;  3WWR A;  2GTK A;  5KRJ A;  5KCE A;  4RZF A;  3KDU A;  4OKX A;  2VST A;  3AZ3 A;  1OVL A;  4JYI A;  1WM0 X;  3PO9 A;  4IS8 A;  3TKM A;  5DKS A;  4DQM A;  1U3R A;  3DY6 A;  3HVL A;  3CQV A;  4MDD A;  1XPC A;  5DVC A;  3FC6 B;  2ZK5 A;  3A9E A;  2PIR A;  1Z95 A;  5CJ6 A;  4S0T A;  4OH6 A;  5KYA A;  3F5C A;  3U9Q A;  4Y29 A;  4OEY A;  3VTD A;  4YPQ A;  1ZKY A;  5DI7 A;  5IZ0 A;  2ZKC A;  3X36 A;  2YJA B;  1T79 A;  5M96 A;  3B3K A;  1PQ6 A;  2ZAS A;  1MZN A;  3UUD B;  5DZH A;  5DYD A;  5DVS A;  5DXM A;  5KRC A;  1S0Z A;  3VTC A;  4WVD A;  5DSH A;  3W0C A;  4N8R A;  3ILZ A;  4RZE A;  5LGA A;  3OMQ A;  2AA7 A;  2P1T A;  3ET1 A;  4OIV A;  2I0G A;  5LWP A;  1P8D A;  3V9V A;  2HC4 A;  2Q8S A;  1ILG A;  3P88 A;  2Q3Y A;  4OFR A;  3V3Q A;  2NW4 A;  2R6W A;  3V9T A;  2ACL A;  3CLD A;  2V7C A;  3CJW A;  2AB2 A;  4X1F A;  3IPQ A;  3IXP A;  2AX7 A;  3FAL A;  4OHA A;  1GWQ A;  2QGW A;  3D5F A;  1G1U A;  1T74 A;  2Q7J A;  2ZK6 A;  5I4V A;  3A3Z X;  4OJB A;  4ZNH A;  2XHS A;  3R2A A;  1XP1 A;  4P6X A;  4MGD B;  4APU A;  5IXK A;  3VHV A;  4MG8 B;  3WT6 A;  4ZN9 A;  3BEJ A;  4LTW A;  3FEI A;  1E3G A;  4OEZ A;  5DXB A;  1RKG A;  1T65 A;  2QA6 A;  4N73 A;  4ZNT A;  1M13 A;  5DV8 A;  2AX9 A;  2ZBS A;  5HYR A;  3HLV A;  3JZC A;  5KCF A;  2HB8 A;  1M7W A;  1N83 A;  1T5Z A;  3OS9 A;  2IHQ A;  3OLF A;  4UDC A;  5E14 A;  4NQA B;  3ZRA A;  2QW4 A;  1R5K A;  2ABI A;  1PDU A;  3FC6 A;  1XIU A;  5AWJ A;  1ZAF A;  1Z5X U;  5E0X A;  1GWX A;  3GWX A;  2I4P A;  2AMB A;  4ITE A;  3WT7 A;  2QSE A;  2ZFX A;  1YIN A;  1FCX A;  2QZO B;  1FCY A;  4RAK A;  4QE6 A;  1S0X A;  4JAZ A;  5DKB A;  3UVV B;  2V0V A;  1YA3 A;  2ZXN A;  2Q5P A;  1YUC A;  5DL4 A;  5K13 A;  5DUH A;  4RFW A;  3V49 A;  4R6S A;  1XLS A;  4G21 A;  3V4A A;  3UUD A;  2XYJ A;  5JJM B;  1P93 A;  4REE A;  4IWC A;  2Q61 A;  1XNN A;  2ZMJ A;  3ERT A;  1ZGY A;  3V3E A;  3NSQ A;  3P8X A;  1R20 A;  3B67 A;  3L3Z A;  3ADT A;  3B0Q A;  4PXM A;  2Q5S A;  3UUC A;  3ZR7 A;  3L0L A;  4R06 A;  1X76 A;  4JYG A;  1XP9 A;  2YJD A;  4XAO A;  2QH6 A;  3OSA A;  3IMY A;  5L7H A;  3X31 A;  1EXA A;  2Q59 B;  4DM8 A;  4FN9 A;  4PLE A;  1XQ3 A;  3AUN A;  3VHW A;  3BQD A;  4YMQ A;  1VJB A;  2ZL9 A;  2AM9 A;  4N1Y A;  1YMT A;  5E0W A;  1X7E A;  4MGD A;  4MGA B;  3VRV A;  5IAW A;  5DXP A;  4PLD A;  1LV2 A;  2BJ4 B;  2Q1V A;  2ZY0 A;  4IV4 A;  1G5Y A;  2BAW A;  4KZI A;  5E7V A;  3HO0 A;  4KZM A;  4LSJ A;  4WHG A;  3W0J A;  2P7G A;  2QAB A;  3ADW A;  5EI1 A;  2AMA A;  5DZ1 A;  5DRJ A;  4CSJ A;  1RDT D;  5HZC A;  5KRI A;  3CDS A;  3S9S A;  4XT9 A;  4OKT A;  2G44 A;  4K4J A;  5DXG A;  4XLD A;  3CS6 A;  5G42 A;  2ZLC A;  2Z4J A;  4IVW A;  3E00 D;  3PCU A;  4G1Y A;  2ZNP A;  4PRG A;  3SZ1 A;  4OEA A;  5KCU A;  3H0A D;  4IA7 A;  5L7E A;  4F9M A;  3K6P A;  2QZO A;  2R40 A;  1HG4 A;  4B7W A;  5JY3 A;  4PP3 A;  3KMR A;  3UVV A;  3OLL A;  1K74 D;  3W0H A;  1T73 A;  4FGY A;  3TKC A;  3CDP A;  3FUR A;  5JJM A;  1PRG A;  3W5R A;  1YP0 A;  3B1M A;  1PQ9 A;  1FM6 A;  1S9Q A;  4MG9 A;  1RKH A;  3K8S A;  3GD2 A;  4ITF A;  1HJ1 A;  4DMA A;  2POB A;  3OMK A;  3QT0 A;  3AX8 A;  4E2J A;  1NYX A;  2HFP A;  4BCR A;  3ET0 A;  3GBK A;  3H0A A;  4RUJ A;  4ZNS A;  3AZ1 A;  1G2N A;  4M8H A;  1ERR A;  3A78 A;  2YLP A;  5EIT A;  3DT3 A;  2XKW A;  2HAS A;  2J7Y A;  5DWI A;  2Q5G A;  4ZI1 A;  1RK3 A;  1XB7 A;  1K7L A;  2JFA A;  4NY9 A;  3AN3 A;  3KMG A;  3WT5 A;  3X1I A;  3VT5 A;  2PIO A;  4MGA A;  3UP3 A;  5HJS A;  2B1Z A;  1L2I A;  3D57 A;  5DXE A;  3WJ4 A;  4RUO X;  1QKN A;  2BJ4 A;  3A2H A;  4IU7 A;  2B50 A;  2P4Y A;  4POH A;  4RMC A;  5DMC A;  5EJV A;  1OSH A;  5H1E A;  5KCW A;  2LBD A;  1X7B A;  2AA5 A;  3L0J A;  5AK2 A;  3PEQ A;  4MG7 B;  5AAV B;  5KD9 A;  1FD0 A;  1NAV A;  5DXQ A;  1Y9R A;  1QKM A;  1KV6 A;  3BC5 A;  3ET3 A;  3OAP A;  4OLM A;  5AZV A;  2NPA A;  5JI0 D;  2ZXM A;  4S15 A;  3AN4 A;  1I7G A;  1YOW A;  2OZ7 A;  1X7R A;  1NUO A;  2PIT A;  1XDK B;  2HAR A;  3D24 A;  2PIQ A;  4DOS A;  5AAU A;  4QJR A;  3VRW A;  4IW6 A;  4OZR E;  2QR9 A;  4XUH A;  3W5P A;  2OVM A;  2Q7L A;  2IOG A;  1T7M A;  3O1D A;  3B0T A;  4NUF A;  4RME A;  4FNE A;  2OUZ A;  5A86 A;  2AAX A;  3ADS A;  2HCD A;  4XTA A;  4G1Z A;  1XQC A;  2YAT A;  2GPO A;  5GT4 A;  2GL8 A;  2Q1H A;  3ADU A;  2VV4 B;  5E1C A;  1YIM A;  5G45 A;  1E3K A;  1XLS E;  2FVJ A;  4UDB A;  3R8A A;  1UOM A;  5DX3 B;  1X7J A;  4R2U A;  4XI3 A;  3GZ9 A;  2E2R A;  3B0R A;  5DZ3 A;  5G46 A;  1UPV A;  4PPP A;  3VJT A;  1PQC A;  4OKB A;  4REF A;  2P54 A;  3K23 A;  4Q13 A;  5SYZ A;  3W0Y A;  3JZB A;  3N00 A;  3A40 X;  3KFC A;  3L0E A;  3VJI A;  2J4A A;  4MGB B;  1MVC A;  4IWF A;  4OZT U;  3GYT A;  2P7A A;  4RWV A;  1DKF B;  2GP7 A;  2W8Y A;  3RUU A;  4CI4 A;  5C4O A;  1S9P A;  5EC9 A;  5AVI A;  4A4V A;  3OZ0 A;  4RZG A;  3EYB A;  1FM9 D;  4X1G A;  3WTQ A;  5AAV A;  3B68 A;  2YFE A;  4MG7 A;  4IV2 A;  3OKI A;  3FXV A;  3O1E A;  1TFC A;  2HVC A;  4O8F A;  5KRH A;  4YNK A;  2ATH A;  4UDA A;  1M2Z A;  4IA1 A;  2G0H A;  5KRM A;  2HAM A;  4ONI A;  1ZDT A;  2P15 A;  2Q7I A;  3G9E A;  4OGH A;  3R8D A;  3RUT A;  2PIP L;  4JYH A;  3IA6 A;  3VJS A;  3VRU A;  1SQN A;  2QXS A;  3DZU D;  2O4R A;  5B41 A;  1NRL A;  1XNX A;  2I4J A;  2AYR A;  3OS8 C;  5G5W A;  5L7G A;  3K22 A;  4G2H A;  3OLS A;  5DWL A;  1UHL B;  4L96 A;  4A2J A;  3L03 A;  3UUA B;  5HYK A;  2O4J A;  4G1D A;  1OSV A;  2VV4 A;  4MGC A;  2AX8 A;  2OM9 A;  5KR9 A;  4OKW A;  4IA2 A;  3HC5 A;  3RLL A;  1XJ7 A;  3ZRB A;  4TUZ B;  5APH A;  2PIV A;  4MG8 A;  5DX3 A;  4IVY A;  3WJ5 A;  3AFR A;  4IUI A;  2VV3 A;  4QM0 A;  5AYG A;  4DK8 A;  1OT7 A;  4ZNV A;  3DZU A;  2QMV A;  4JL4 A;  5HCV A;  1XZX X;  2ZNN A;  3D90 A;  4OFU A;  1ERE A;  4DK7 A;  3IPU A;  4ZNW A;  4IA3 A;  1H9U A;  4XUM A;  3VT4 A;  3RLJ A;  1T76 A;  1QKU A;  5KRO A;  3UP0 A;  4E4K A;  3HC6 A;  1SJ0 A;  4HEE X;  2P1V A;  4OZR U;  4MGB A;  3VRT A;  3DR1 A;  3ZQT A;  1PCG A;  1YJE A;  3T03 A;  4LNW A;  1DKF A;  3HM1 A;  3AZ2 A;  2ZK2 A;  1A28 A;  1K4W A;  1Y0X X;  3DZY D;  5KRL A;  3WFG A;  5DLR A;  4ZJR A;  1EXX A;  3NOA A;  5G44 A;  4RE8 A;  2JF9 A;  5DUE A;  1ZH7 A;  1A52 A;  1RDT A;  2AX6 A;  3Q95 B;  1GWR A;  5DWG A;  4NIE A;  5APK A;  3VI8 A;  4WQP A;  4OK1 A;  2ZLA A;  3CS8 A;  2NXX A;  3AUQ A;  3M7R A;  4ZN7 A;  5AVL A;  3E00 A;  2VSR A;  5F9B A;  5C4S A;  3GN8 A;  3VT6 A;  3P0U A;  3DZY A;  2Q59 A;  1I7I A;  4ZOM A;  1K74 A;  4P6W A;  5DWE A;  3MNO A;  4KZJ A;  5FQT A;  3VT3 A;  1KNU A;  3HOD A;  4TUZ A;  5DKE A;  1NQ1 A;  3G0W A;  2F4B A;  4HLW A;  5APJ A;  3X1H A;  1PZL A;  3KBA A;  2OCF A;  4OAR A;  1NQ2 A;  3KYT A;  3PRG A;  5KYJ A;  4PVU A;  2I4Z A;  4FHH A;  2B1V A;  1I38 A;  1FCZ A;  2J7X A;  5EGV A;  4CI5 A;  2QA8 B;  3OMO A;  2ZK1 A;  2ZMI A;  2G5O A;  4S14 A;  3VT9 A;  1BSX A;  3V9Y A;  4TV1 B;  5DMF A;  2G0G A;  4XHD A;  1XVP B;  3OSI A;  1DB1 A;  3OKH A;  1Q4X A;  5C4U A;  5FQV A;  5G3J A;  4G20 A;  3WMH A;  4YT1 A;  1IE9 A;  3ADX A;  3R5M A;  2GPV A;  4QK4 A;  5DU5 A;  1ZDU A;  1NQ0 A;  2ZNQ A;  3IXP D;  3W5Q A;  2YLQ A;  4ZO1 B;  5DXR A;  2FSZ A;  1XP6 A;  2HBH A;  2Q70 A;  3A2J A;  3Q95 A;  4MG5 A;  5DP0 A;  5AWK A;  2HWQ A;  3R5N A;  3E94 A;  3AUR A;  1ZUC A;  3IPS A;  1XV9 B;  2VV1 B;  1N4H A;  3L3X A;  4OJ4 A;  4J5W A;  1KKQ A;  3GWS X;  2QPY A;  1UPW A;  2H77 A;  3DCU A;  3PBA A;  1T7R A;  4J24 A;  3L1B A;  4J5W C;  1IE8 A;  2AO6 A;  1TXI A;  5C4T A;  1NAX A;  1L2J A;  5KRK A;  5KCT A;  2QXM A;  4ZO1 X;  2POG A;  2R6Y A;  2YLY A;  3OZJ A;  4G2I A;  2P7Z A;  4QE8 A;  5DXK A;  3LMP A;  2PIN A;  3B66 A;  5ACC A;  2PIU A;  4OED A;  2PNU A;  3A2I A;  1NDE A;  4K7A A;  2FAI A;  3DCT A;  5ICK A;  1R1K D;  2ZMH A;  3TY0 A;  3OOF A;  5HJP B;  4K6I A;  4RUP A;  3OMM A;  3SP9 A;  2Q7K A;  3W0G A;  2ZNO A;  3VN2 A;  5B5B A;  5ETH A;  1NQ7 A; 
#chains in the Genus database with same CATH topology
 1NHZ A;  3MNE A;  5DVV A;  1LBD A;  3B65 A;  4PP6 A;  3VT8 A;  2QA8 A;  3CTB A;  1MV9 A;  3P89 A;  2Q6J A;  3KDT A;  2PIX A;  1G50 A;  1XDK A;  1Y0S A;  2O9I A;  2YLO A;  4TV1 A;  1U9E A;  4PPS A;  4PF3 A;  3SP6 A;  1XVP A;  5KCD A;  3TX7 B;  5EHJ A;  3OS8 A;  5DIG A;  1T63 A;  4S0S A;  1R20 D;  2GPU A;  3FS1 A;  5DTV A;  5DUG A;  5KCC A;  1U3Q A;  1R1K A;  5DYB A;  3R8I A;  3VHU A;  2J14 A;  4L98 A;  2OVH A;  1YYE A;  2Q6S A;  4UDD A;  4OH5 A;  1U3S A;  2ZXZ A;  1FM9 A;  2IOK A;  3CS4 A;  3FUG A;  1T7T A;  2XYX A;  5KRA A;  3RVF A;  2GIU A;  3RY9 A;  2AXA A;  4Q0A C;  3VT7 A;  4DOR A;  2AA6 A;  2B23 A;  1XV9 A;  2EWP A;  2QGT A;  2VV1 A;  3KPZ A;  3OGT A;  2NXX E;  4MG9 B;  2VV2 A;  3UU7 B;  3WGP A;  4IQR A;  2GPP A;  5KRF A;  3OMP A;  1GS4 A;  2ZK4 A;  3ERD A;  2XYW A;  3R29 A;  3CWD A;  3FLI A;  4OIU A;  4EMA A;  1N46 A;  3W5T A;  2Z4B A;  5DZI A;  1PK5 A;  2JJ3 A;  3B0W A;  2OAX A;  4QL8 A;  5DV6 A;  4PP5 A;  4JGV A;  1XAP A;  1RJK A;  5DWJ A;  4PWL A;  3W0I A;  1OVL B;  2NV7 A;  2Q60 A;  4DM6 A;  2H79 A;  5DK9 A;  5E19 A;  2JFA B;  1R6G A;  5DRM A;  3ADV A;  4J5X A;  4OC7 A;  2GWX A;  3G8O A;  5HJP A;  3A9E B;  5DKG A;  2PKL A;  3MNP A;  1I37 A;  3F7D A;  5G43 A;  4J5X C;  5GIE A;  2R40 D;  2VV0 A;  3F5C B;  1QKT A;  3OSW A;  5DID A;  3HQ5 A;  4LNX A;  3KWY A;  5DY8 A;  5AZT A;  2PJL A;  1YOK A;  3VSO A;  4ZNU A;  3WFF A;  4A4W A;  3LBD A;  4FHI A;  5DIE A;  3HZF A;  1ILH A;  1SKX A;  1ZEO A;  2AA2 A;  4OJ9 A;  5E15 A;  5DV3 A;  3KMZ A;  5GID A;  4WHF A;  1FM6 D;  3VJH A;  1X78 A;  3VTB A;  5GIC A;  1FBY A;  1XOW A;  4IW8 A;  2YHD A;  5DZ0 A;  4J26 A;  4OIL A;  2ZK0 A;  3FEJ A;  5FQP A;  3VSP A;  1S19 A;  3PLZ A;  2Q6R A;  1Z5X E;  1UHL A;  5FQR A;  2REW A;  4OZT E;  4WLB A;  2QTU A;  4ZJW A;  2PRG A;  3D6D A;  4M8E A;  3ET2 A;  3UUA A;  2ACL B;  5FQS A;  1YY4 A;  3G8I A;  3NSP A;  3B5R A;  3OOK A;  3FAL B;  4E4Q A;  4EM9 A;  2HWR A;  3E7C A;  2P1U A;  3W0A A;  2AWH A;  2ZVT A;  4WPF A;  2ZK3 A;  1SR7 A;  3GYU A;  2QNV A;  2PIW A;  2QE4 A;  4NB6 A;  3UU7 A;  4POJ A;  2HB7 A;  4LBD A;  4Q50 A;  4MG6 A;  4RMD A;  1T7F A;  2I0J A;  3H52 A;  4N5G A;  5L11 A;  5DXB B;  2A3I A;  3WWR A;  2GTK A;  5KRJ A;  5KCE A;  4RZF A;  3KDU A;  4OKX A;  2VST A;  3AZ3 A;  1OVL A;  4JYI A;  1WM0 X;  3PO9 A;  4IS8 A;  3TKM A;  5DKS A;  4DQM A;  1U3R A;  3DY6 A;  3HVL A;  3CQV A;  4MDD A;  1XPC A;  5DVC A;  3FC6 B;  2ZK5 A;  3A9E A;  2PIR A;  1Z95 A;  5CJ6 A;  4S0T A;  4OH6 A;  5KYA A;  3F5C A;  3U9Q A;  4Y29 A;  4OEY A;  3VTD A;  4YPQ A;  1ZKY A;  5DI7 A;  5IZ0 A;  2ZKC A;  3X36 A;  2YJA B;  1T79 A;  5M96 A;  3B3K A;  1PQ6 A;  2ZAS A;  1MZN A;  3UUD B;  5DZH A;  5DYD A;  5DVS A;  5DXM A;  5KRC A;  1S0Z A;  3VTC A;  4WVD A;  5DSH A;  3W0C A;  4N8R A;  3ILZ A;  4RZE A;  5LGA A;  3OMQ A;  2AA7 A;  2P1T A;  3ET1 A;  4OIV A;  2I0G A;  5LWP A;  1P8D A;  3V9V A;  2HC4 A;  2Q8S A;  1ILG A;  3P88 A;  2Q3Y A;  4OFR A;  3V3Q A;  2NW4 A;  2R6W A;  3V9T A;  2ACL A;  3CLD A;  2V7C A;  3CJW A;  2AB2 A;  4X1F A;  3IPQ A;  3IXP A;  2AX7 A;  3FAL A;  4OHA A;  1GWQ A;  2QGW A;  3D5F A;  1G1U A;  1T74 A;  2Q7J A;  2ZK6 A;  5I4V A;  3A3Z X;  4OJB A;  4ZNH A;  2XHS A;  3R2A A;  1XP1 A;  4P6X A;  4MGD B;  4APU A;  5IXK A;  3VHV A;  4MG8 B;  3WT6 A;  4ZN9 A;  3BEJ A;  4LTW A;  3FEI A;  1E3G A;  4OEZ A;  5DXB A;  1RKG A;  1T65 A;  2QA6 A;  4N73 A;  4ZNT A;  1M13 A;  5DV8 A;  2AX9 A;  2ZBS A;  5HYR A;  3HLV A;  3JZC A;  5KCF A;  2HB8 A;  1M7W A;  1N83 A;  1T5Z A;  3OS9 A;  2IHQ A;  3OLF A;  4UDC A;  5E14 A;  4NQA B;  3ZRA A;  2QW4 A;  1R5K A;  2ABI A;  1PDU A;  3FC6 A;  1XIU A;  5AWJ A;  1ZAF A;  1Z5X U;  5E0X A;  1GWX A;  3GWX A;  2I4P A;  2AMB A;  4ITE A;  3WT7 A;  2QSE A;  2ZFX A;  1YIN A;  1FCX A;  2QZO B;  1FCY A;  4RAK A;  4QE6 A;  1S0X A;  4JAZ A;  5DKB A;  3UVV B;  2V0V A;  1YA3 A;  2ZXN A;  2Q5P A;  1YUC A;  5DL4 A;  5K13 A;  5DUH A;  4RFW A;  3V49 A;  4R6S A;  1XLS A;  4G21 A;  3V4A A;  3UUD A;  2XYJ A;  5JJM B;  1P93 A;  4REE A;  4IWC A;  2Q61 A;  1XNN A;  2ZMJ A;  3ERT A;  1ZGY A;  3V3E A;  3NSQ A;  3P8X A;  1R20 A;  3B67 A;  3L3Z A;  3ADT A;  3B0Q A;  4PXM A;  2Q5S A;  3UUC A;  3ZR7 A;  3L0L A;  4R06 A;  1X76 A;  4JYG A;  1XP9 A;  2YJD A;  4XAO A;  2QH6 A;  3OSA A;  3IMY A;  5L7H A;  3X31 A;  1EXA A;  2Q59 B;  4DM8 A;  4FN9 A;  4PLE A;  1XQ3 A;  3AUN A;  3VHW A;  3BQD A;  4YMQ A;  1VJB A;  2ZL9 A;  2AM9 A;  4N1Y A;  1YMT A;  5E0W A;  1X7E A;  4MGD A;  4MGA B;  3VRV A;  5IAW A;  5DXP A;  4PLD A;  1LV2 A;  2BJ4 B;  2Q1V A;  2ZY0 A;  4IV4 A;  1G5Y A;  2BAW A;  4KZI A;  5E7V A;  3HO0 A;  4KZM A;  4LSJ A;  4WHG A;  3W0J A;  2P7G A;  2QAB A;  3ADW A;  5EI1 A;  2AMA A;  5DZ1 A;  5DRJ A;  4CSJ A;  1RDT D;  5HZC A;  5KRI A;  3CDS A;  3S9S A;  4XT9 A;  4OKT A;  2G44 A;  4K4J A;  5DXG A;  4XLD A;  3CS6 A;  5G42 A;  2ZLC A;  2Z4J A;  4IVW A;  3E00 D;  3PCU A;  4G1Y A;  2ZNP A;  4PRG A;  3SZ1 A;  4OEA A;  5KCU A;  3H0A D;  4IA7 A;  5L7E A;  4F9M A;  3K6P A;  2QZO A;  2R40 A;  1HG4 A;  4B7W A;  5JY3 A;  4PP3 A;  3KMR A;  3UVV A;  3OLL A;  1K74 D;  3W0H A;  1T73 A;  4FGY A;  3TKC A;  3CDP A;  3FUR A;  5JJM A;  1PRG A;  3W5R A;  1YP0 A;  3B1M A;  1PQ9 A;  1FM6 A;  1S9Q A;  4MG9 A;  1RKH A;  3K8S A;  3GD2 A;  4ITF A;  1HJ1 A;  4DMA A;  2POB A;  3OMK A;  3QT0 A;  3AX8 A;  4E2J A;  1NYX A;  2HFP A;  4BCR A;  3ET0 A;  3GBK A;  3H0A A;  4RUJ A;  4ZNS A;  3AZ1 A;  1G2N A;  4M8H A;  1ERR A;  3A78 A;  2YLP A;  5EIT A;  3DT3 A;  2XKW A;  2HAS A;  2J7Y A;  5DWI A;  2Q5G A;  4ZI1 A;  1RK3 A;  1XB7 A;  1K7L A;  2JFA A;  4NY9 A;  3AN3 A;  3KMG A;  3WT5 A;  3X1I A;  3VT5 A;  2PIO A;  4MGA A;  3UP3 A;  5HJS A;  2B1Z A;  1L2I A;  3D57 A;  5DXE A;  3WJ4 A;  4RUO X;  1QKN A;  2BJ4 A;  3A2H A;  4IU7 A;  2B50 A;  2P4Y A;  4POH A;  4RMC A;  5DMC A;  5EJV A;  1OSH A;  5H1E A;  5KCW A;  2LBD A;  1X7B A;  2AA5 A;  3L0J A;  5AK2 A;  3PEQ A;  4MG7 B;  5AAV B;  5KD9 A;  1FD0 A;  1NAV A;  5DXQ A;  1Y9R A;  1QKM A;  1KV6 A;  3BC5 A;  3ET3 A;  3OAP A;  4OLM A;  5AZV A;  2NPA A;  5JI0 D;  2ZXM A;  4S15 A;  3AN4 A;  1I7G A;  1YOW A;  2OZ7 A;  1X7R A;  1NUO A;  2PIT A;  1XDK B;  2HAR A;  3D24 A;  2PIQ A;  4DOS A;  5AAU A;  4QJR A;  3VRW A;  4IW6 A;  4OZR E;  2QR9 A;  4XUH A;  3W5P A;  2OVM A;  2Q7L A;  2IOG A;  1T7M A;  3O1D A;  3B0T A;  4NUF A;  4RME A;  4FNE A;  2OUZ A;  5A86 A;  2AAX A;  3ADS A;  2HCD A;  4XTA A;  4G1Z A;  1XQC A;  2YAT A;  2GPO A;  5GT4 A;  2GL8 A;  2Q1H A;  3ADU A;  2VV4 B;  5E1C A;  1YIM A;  5G45 A;  1E3K A;  1XLS E;  2FVJ A;  4UDB A;  3R8A A;  1UOM A;  5DX3 B;  1X7J A;  4R2U A;  4XI3 A;  3GZ9 A;  2E2R A;  3B0R A;  5DZ3 A;  5G46 A;  1UPV A;  4PPP A;  3VJT A;  1PQC A;  4OKB A;  4REF A;  2P54 A;  3K23 A;  4Q13 A;  5SYZ A;  3W0Y A;  3JZB A;  3N00 A;  3A40 X;  3KFC A;  3L0E A;  3VJI A;  2J4A A;  4MGB B;  1MVC A;  4IWF A;  4OZT U;  3GYT A;  2P7A A;  4RWV A;  1DKF B;  2GP7 A;  2W8Y A;  3RUU A;  4CI4 A;  5C4O A;  1S9P A;  5EC9 A;  5AVI A;  4A4V A;  3OZ0 A;  4RZG A;  3EYB A;  1FM9 D;  4X1G A;  3WTQ A;  5AAV A;  3B68 A;  2YFE A;  4MG7 A;  4IV2 A;  3OKI A;  3FXV A;  3O1E A;  1TFC A;  2HVC A;  4O8F A;  5KRH A;  4YNK A;  2ATH A;  4UDA A;  1M2Z A;  4IA1 A;  2G0H A;  5KRM A;  2HAM A;  4ONI A;  1ZDT A;  2P15 A;  2Q7I A;  3G9E A;  4OGH A;  3R8D A;  3RUT A;  2PIP L;  4JYH A;  3IA6 A;  3VJS A;  3VRU A;  1SQN A;  2QXS A;  3DZU D;  2O4R A;  5B41 A;  1NRL A;  1XNX A;  2I4J A;  2AYR A;  3OS8 C;  5G5W A;  5L7G A;  3K22 A;  4G2H A;  3OLS A;  5DWL A;  1UHL B;  4L96 A;  4A2J A;  3L03 A;  3UUA B;  5HYK A;  2O4J A;  4G1D A;  1OSV A;  2VV4 A;  4MGC A;  2AX8 A;  2OM9 A;  5KR9 A;  4OKW A;  4IA2 A;  3HC5 A;  3RLL A;  1XJ7 A;  3ZRB A;  4TUZ B;  5APH A;  2PIV A;  4MG8 A;  5DX3 A;  4IVY A;  3WJ5 A;  3AFR A;  4IUI A;  2VV3 A;  4QM0 A;  5AYG A;  4DK8 A;  1OT7 A;  4ZNV A;  3DZU A;  2QMV A;  4JL4 A;  5HCV A;  1XZX X;  2ZNN A;  3D90 A;  4OFU A;  1ERE A;  4DK7 A;  3IPU A;  4ZNW A;  4IA3 A;  1H9U A;  4XUM A;  3VT4 A;  3RLJ A;  1T76 A;  1QKU A;  5KRO A;  3UP0 A;  4E4K A;  3HC6 A;  1SJ0 A;  4HEE X;  2P1V A;  4OZR U;  4MGB A;  3VRT A;  3DR1 A;  3ZQT A;  1PCG A;  1YJE A;  3T03 A;  4LNW A;  1DKF A;  3HM1 A;  3AZ2 A;  2ZK2 A;  1A28 A;  1K4W A;  1Y0X X;  3DZY D;  5KRL A;  3WFG A;  5DLR A;  4ZJR A;  1EXX A;  3NOA A;  5G44 A;  4RE8 A;  2JF9 A;  5DUE A;  1ZH7 A;  1A52 A;  1RDT A;  2AX6 A;  3Q95 B;  1GWR A;  5DWG A;  4NIE A;  5APK A;  3VI8 A;  4WQP A;  4OK1 A;  2ZLA A;  3CS8 A;  2NXX A;  3AUQ A;  3M7R A;  4ZN7 A;  5AVL A;  3E00 A;  2VSR A;  5F9B A;  5C4S A;  3GN8 A;  3VT6 A;  3P0U A;  3DZY A;  2Q59 A;  1I7I A;  4ZOM A;  1K74 A;  4P6W A;  5DWE A;  3MNO A;  4KZJ A;  5FQT A;  3VT3 A;  1KNU A;  3HOD A;  4TUZ A;  5DKE A;  1NQ1 A;  3G0W A;  2F4B A;  4HLW A;  5APJ A;  3X1H A;  1PZL A;  3KBA A;  2OCF A;  4OAR A;  1NQ2 A;  3KYT A;  3PRG A;  5KYJ A;  4PVU A;  2I4Z A;  4FHH A;  2B1V A;  1I38 A;  1FCZ A;  2J7X A;  5EGV A;  4CI5 A;  2QA8 B;  3OMO A;  2ZK1 A;  2ZMI A;  2G5O A;  4S14 A;  3VT9 A;  1BSX A;  3V9Y A;  4TV1 B;  5DMF A;  2G0G A;  4XHD A;  1XVP B;  3OSI A;  1DB1 A;  3OKH A;  1Q4X A;  5C4U A;  5FQV A;  5G3J A;  4G20 A;  3WMH A;  4YT1 A;  1IE9 A;  3ADX A;  3R5M A;  2GPV A;  4QK4 A;  5DU5 A;  1ZDU A;  1NQ0 A;  2ZNQ A;  3IXP D;  3W5Q A;  2YLQ A;  4ZO1 B;  5DXR A;  2FSZ A;  1XP6 A;  2HBH A;  2Q70 A;  3A2J A;  3Q95 A;  4MG5 A;  5DP0 A;  5AWK A;  2HWQ A;  3R5N A;  3E94 A;  3AUR A;  1ZUC A;  3IPS A;  1XV9 B;  2VV1 B;  1N4H A;  3L3X A;  4OJ4 A;  4J5W A;  1KKQ A;  3GWS X;  2QPY A;  1UPW A;  2H77 A;  3DCU A;  3PBA A;  1T7R A;  4J24 A;  3L1B A;  4J5W C;  1IE8 A;  2AO6 A;  1TXI A;  5C4T A;  1NAX A;  1L2J A;  5KRK A;  5KCT A;  2QXM A;  4ZO1 X;  2POG A;  2R6Y A;  2YLY A;  3OZJ A;  4G2I A;  2P7Z A;  4QE8 A;  5DXK A;  3LMP A;  2PIN A;  3B66 A;  5ACC A;  2PIU A;  4OED A;  2PNU A;  3A2I A;  1NDE A;  4K7A A;  2FAI A;  3DCT A;  5ICK A;  1R1K D;  2ZMH A;  3TY0 A;  3OOF A;  5HJP B;  4K6I A;  4RUP A;  3OMM A;  3SP9 A;  2Q7K A;  3W0G A;  2ZNO A;  3VN2 A;  5B5B A;  5ETH A;  1NQ7 A; 
#chains in the Genus database with same CATH homology
 1NHZ A;  3MNE A;  5DVV A;  1LBD A;  3B65 A;  4PP6 A;  3VT8 A;  2QA8 A;  3CTB A;  1MV9 A;  3P89 A;  2Q6J A;  3KDT A;  2PIX A;  1G50 A;  1XDK A;  1Y0S A;  2O9I A;  2YLO A;  4TV1 A;  1U9E A;  4PPS A;  4PF3 A;  3SP6 A;  1XVP A;  5KCD A;  3TX7 B;  5EHJ A;  3OS8 A;  5DIG A;  1T63 A;  4S0S A;  1R20 D;  2GPU A;  3FS1 A;  5DTV A;  5DUG A;  5KCC A;  1U3Q A;  1R1K A;  5DYB A;  3R8I A;  3VHU A;  2J14 A;  4L98 A;  2OVH A;  1YYE A;  2Q6S A;  4UDD A;  4OH5 A;  1U3S A;  2ZXZ A;  1FM9 A;  2IOK A;  3CS4 A;  3FUG A;  1T7T A;  2XYX A;  5KRA A;  3RVF A;  2GIU A;  3RY9 A;  2AXA A;  4Q0A C;  3VT7 A;  4DOR A;  2AA6 A;  2B23 A;  1XV9 A;  2EWP A;  2QGT A;  2VV1 A;  3KPZ A;  3OGT A;  2NXX E;  4MG9 B;  2VV2 A;  3UU7 B;  3WGP A;  4IQR A;  2GPP A;  5KRF A;  3OMP A;  1GS4 A;  2ZK4 A;  3ERD A;  2XYW A;  3R29 A;  3CWD A;  3FLI A;  4OIU A;  4EMA A;  1N46 A;  3W5T A;  2Z4B A;  5DZI A;  1PK5 A;  2JJ3 A;  3B0W A;  2OAX A;  4QL8 A;  5DV6 A;  4PP5 A;  4JGV A;  1XAP A;  1RJK A;  5DWJ A;  4PWL A;  3W0I A;  1OVL B;  2NV7 A;  2Q60 A;  4DM6 A;  2H79 A;  5DK9 A;  5E19 A;  2JFA B;  1R6G A;  5DRM A;  3ADV A;  4J5X A;  4OC7 A;  2GWX A;  3G8O A;  5HJP A;  3A9E B;  5DKG A;  2PKL A;  3MNP A;  1I37 A;  3F7D A;  5G43 A;  4J5X C;  5GIE A;  2R40 D;  2VV0 A;  3F5C B;  1QKT A;  3OSW A;  5DID A;  3HQ5 A;  4LNX A;  3KWY A;  5DY8 A;  5AZT A;  2PJL A;  1YOK A;  3VSO A;  4ZNU A;  3WFF A;  4A4W A;  3LBD A;  4FHI A;  5DIE A;  3HZF A;  1ILH A;  1SKX A;  1ZEO A;  2AA2 A;  4OJ9 A;  5E15 A;  5DV3 A;  3KMZ A;  5GID A;  4WHF A;  1FM6 D;  3VJH A;  1X78 A;  3VTB A;  5GIC A;  1FBY A;  1XOW A;  4IW8 A;  2YHD A;  5DZ0 A;  4J26 A;  4OIL A;  2ZK0 A;  3FEJ A;  5FQP A;  3VSP A;  1S19 A;  3PLZ A;  2Q6R A;  1Z5X E;  1UHL A;  5FQR A;  2REW A;  4OZT E;  4WLB A;  2QTU A;  4ZJW A;  2PRG A;  3D6D A;  4M8E A;  3ET2 A;  3UUA A;  2ACL B;  5FQS A;  1YY4 A;  3G8I A;  3NSP A;  3B5R A;  3OOK A;  3FAL B;  4E4Q A;  4EM9 A;  2HWR A;  3E7C A;  2P1U A;  3W0A A;  2AWH A;  2ZVT A;  4WPF A;  2ZK3 A;  1SR7 A;  3GYU A;  2QNV A;  2PIW A;  2QE4 A;  4NB6 A;  3UU7 A;  4POJ A;  2HB7 A;  4LBD A;  4Q50 A;  4MG6 A;  4RMD A;  1T7F A;  2I0J A;  3H52 A;  4N5G A;  5L11 A;  5DXB B;  2A3I A;  3WWR A;  2GTK A;  5KRJ A;  5KCE A;  4RZF A;  3KDU A;  4OKX A;  2VST A;  3AZ3 A;  1OVL A;  4JYI A;  1WM0 X;  3PO9 A;  4IS8 A;  3TKM A;  5DKS A;  4DQM A;  1U3R A;  3DY6 A;  3HVL A;  3CQV A;  4MDD A;  1XPC A;  5DVC A;  3FC6 B;  2ZK5 A;  3A9E A;  2PIR A;  1Z95 A;  5CJ6 A;  4S0T A;  4OH6 A;  5KYA A;  3F5C A;  3U9Q A;  4Y29 A;  4OEY A;  3VTD A;  4YPQ A;  1ZKY A;  5DI7 A;  5IZ0 A;  2ZKC A;  3X36 A;  2YJA B;  1T79 A;  5M96 A;  3B3K A;  1PQ6 A;  2ZAS A;  1MZN A;  3UUD B;  5DZH A;  5DYD A;  5DVS A;  5DXM A;  5KRC A;  1S0Z A;  3VTC A;  4WVD A;  5DSH A;  3W0C A;  4N8R A;  3ILZ A;  4RZE A;  5LGA A;  3OMQ A;  2AA7 A;  2P1T A;  3ET1 A;  4OIV A;  2I0G A;  5LWP A;  1P8D A;  3V9V A;  2HC4 A;  2Q8S A;  1ILG A;  3P88 A;  2Q3Y A;  4OFR A;  3V3Q A;  2NW4 A;  2R6W A;  3V9T A;  2ACL A;  3CLD A;  2V7C A;  3CJW A;  2AB2 A;  4X1F A;  3IPQ A;  3IXP A;  2AX7 A;  3FAL A;  4OHA A;  1GWQ A;  2QGW A;  3D5F A;  1G1U A;  1T74 A;  2Q7J A;  2ZK6 A;  5I4V A;  3A3Z X;  4OJB A;  4ZNH A;  2XHS A;  3R2A A;  1XP1 A;  4P6X A;  4MGD B;  4APU A;  5IXK A;  3VHV A;  4MG8 B;  3WT6 A;  4ZN9 A;  3BEJ A;  4LTW A;  3FEI A;  1E3G A;  4OEZ A;  5DXB A;  1RKG A;  1T65 A;  2QA6 A;  4N73 A;  4ZNT A;  1M13 A;  5DV8 A;  2AX9 A;  2ZBS A;  5HYR A;  3HLV A;  3JZC A;  5KCF A;  2HB8 A;  1M7W A;  1N83 A;  1T5Z A;  3OS9 A;  2IHQ A;  3OLF A;  4UDC A;  5E14 A;  4NQA B;  3ZRA A;  2QW4 A;  1R5K A;  2ABI A;  1PDU A;  3FC6 A;  1XIU A;  5AWJ A;  1ZAF A;  1Z5X U;  5E0X A;  1GWX A;  3GWX A;  2I4P A;  2AMB A;  4ITE A;  3WT7 A;  2QSE A;  2ZFX A;  1YIN A;  1FCX A;  2QZO B;  1FCY A;  4RAK A;  4QE6 A;  1S0X A;  4JAZ A;  5DKB A;  3UVV B;  2V0V A;  1YA3 A;  2ZXN A;  2Q5P A;  1YUC A;  5DL4 A;  5K13 A;  5DUH A;  4RFW A;  3V49 A;  4R6S A;  1XLS A;  4G21 A;  3V4A A;  3UUD A;  2XYJ A;  5JJM B;  1P93 A;  4REE A;  4IWC A;  2Q61 A;  1XNN A;  2ZMJ A;  3ERT A;  1ZGY A;  3V3E A;  3NSQ A;  3P8X A;  1R20 A;  3B67 A;  3L3Z A;  3ADT A;  3B0Q A;  4PXM A;  2Q5S A;  3UUC A;  3ZR7 A;  3L0L A;  4R06 A;  1X76 A;  4JYG A;  1XP9 A;  2YJD A;  4XAO A;  2QH6 A;  3OSA A;  3IMY A;  5L7H A;  3X31 A;  1EXA A;  2Q59 B;  4DM8 A;  4FN9 A;  4PLE A;  1XQ3 A;  3AUN A;  3VHW A;  3BQD A;  4YMQ A;  1VJB A;  2ZL9 A;  2AM9 A;  4N1Y A;  1YMT A;  5E0W A;  1X7E A;  4MGD A;  4MGA B;  3VRV A;  5IAW A;  5DXP A;  4PLD A;  1LV2 A;  2BJ4 B;  2Q1V A;  2ZY0 A;  4IV4 A;  1G5Y A;  2BAW A;  4KZI A;  5E7V A;  3HO0 A;  4KZM A;  4LSJ A;  4WHG A;  3W0J A;  2P7G A;  2QAB A;  3ADW A;  5EI1 A;  2AMA A;  5DZ1 A;  5DRJ A;  4CSJ A;  1RDT D;  5HZC A;  5KRI A;  3CDS A;  3S9S A;  4XT9 A;  4OKT A;  2G44 A;  4K4J A;  5DXG A;  4XLD A;  3CS6 A;  5G42 A;  2ZLC A;  2Z4J A;  4IVW A;  3E00 D;  3PCU A;  4G1Y A;  2ZNP A;  4PRG A;  3SZ1 A;  4OEA A;  5KCU A;  3H0A D;  4IA7 A;  5L7E A;  4F9M A;  3K6P A;  2QZO A;  2R40 A;  1HG4 A;  4B7W A;  5JY3 A;  4PP3 A;  3KMR A;  3UVV A;  3OLL A;  1K74 D;  3W0H A;  1T73 A;  4FGY A;  3TKC A;  3CDP A;  3FUR A;  5JJM A;  1PRG A;  3W5R A;  1YP0 A;  3B1M A;  1PQ9 A;  1FM6 A;  1S9Q A;  4MG9 A;  1RKH A;  3K8S A;  3GD2 A;  4ITF A;  1HJ1 A;  4DMA A;  2POB A;  3OMK A;  3QT0 A;  3AX8 A;  4E2J A;  1NYX A;  2HFP A;  4BCR A;  3ET0 A;  3GBK A;  3H0A A;  4RUJ A;  4ZNS A;  3AZ1 A;  1G2N A;  4M8H A;  1ERR A;  3A78 A;  2YLP A;  5EIT A;  3DT3 A;  2XKW A;  2HAS A;  2J7Y A;  5DWI A;  2Q5G A;  4ZI1 A;  1RK3 A;  1XB7 A;  1K7L A;  2JFA A;  4NY9 A;  3AN3 A;  3KMG A;  3WT5 A;  3X1I A;  3VT5 A;  2PIO A;  4MGA A;  3UP3 A;  5HJS A;  2B1Z A;  1L2I A;  3D57 A;  5DXE A;  3WJ4 A;  4RUO X;  1QKN A;  2BJ4 A;  3A2H A;  4IU7 A;  2B50 A;  2P4Y A;  4POH A;  4RMC A;  5DMC A;  5EJV A;  1OSH A;  5H1E A;  5KCW A;  2LBD A;  1X7B A;  2AA5 A;  3L0J A;  5AK2 A;  3PEQ A;  4MG7 B;  5AAV B;  5KD9 A;  1FD0 A;  1NAV A;  5DXQ A;  1Y9R A;  1QKM A;  1KV6 A;  3BC5 A;  3ET3 A;  3OAP A;  4OLM A;  5AZV A;  2NPA A;  5JI0 D;  2ZXM A;  4S15 A;  3AN4 A;  1I7G A;  1YOW A;  2OZ7 A;  1X7R A;  1NUO A;  2PIT A;  1XDK B;  2HAR A;  3D24 A;  2PIQ A;  4DOS A;  5AAU A;  4QJR A;  3VRW A;  4IW6 A;  4OZR E;  2QR9 A;  4XUH A;  3W5P A;  2OVM A;  2Q7L A;  2IOG A;  1T7M A;  3O1D A;  3B0T A;  4NUF A;  4RME A;  4FNE A;  2OUZ A;  5A86 A;  2AAX A;  3ADS A;  2HCD A;  4XTA A;  4G1Z A;  1XQC A;  2YAT A;  2GPO A;  5GT4 A;  2GL8 A;  2Q1H A;  3ADU A;  2VV4 B;  5E1C A;  1YIM A;  5G45 A;  1E3K A;  1XLS E;  2FVJ A;  4UDB A;  3R8A A;  1UOM A;  5DX3 B;  1X7J A;  4R2U A;  4XI3 A;  3GZ9 A;  2E2R A;  3B0R A;  5DZ3 A;  5G46 A;  1UPV A;  4PPP A;  3VJT A;  1PQC A;  4OKB A;  4REF A;  2P54 A;  3K23 A;  4Q13 A;  5SYZ A;  3W0Y A;  3JZB A;  3N00 A;  3A40 X;  3KFC A;  3L0E A;  3VJI A;  2J4A A;  4MGB B;  1MVC A;  4IWF A;  4OZT U;  3GYT A;  2P7A A;  4RWV A;  1DKF B;  2GP7 A;  2W8Y A;  3RUU A;  4CI4 A;  5C4O A;  1S9P A;  5EC9 A;  5AVI A;  4A4V A;  3OZ0 A;  4RZG A;  3EYB A;  1FM9 D;  4X1G A;  3WTQ A;  5AAV A;  3B68 A;  2YFE A;  4MG7 A;  4IV2 A;  3OKI A;  3FXV A;  3O1E A;  1TFC A;  2HVC A;  4O8F A;  5KRH A;  4YNK A;  2ATH A;  4UDA A;  1M2Z A;  4IA1 A;  2G0H A;  5KRM A;  2HAM A;  4ONI A;  1ZDT A;  2P15 A;  2Q7I A;  3G9E A;  4OGH A;  3R8D A;  3RUT A;  2PIP L;  4JYH A;  3IA6 A;  3VJS A;  3VRU A;  1SQN A;  2QXS A;  3DZU D;  2O4R A;  5B41 A;  1NRL A;  1XNX A;  2I4J A;  2AYR A;  3OS8 C;  5G5W A;  5L7G A;  3K22 A;  4G2H A;  3OLS A;  5DWL A;  1UHL B;  4L96 A;  4A2J A;  3L03 A;  3UUA B;  5HYK A;  2O4J A;  4G1D A;  1OSV A;  2VV4 A;  4MGC A;  2AX8 A;  2OM9 A;  5KR9 A;  4OKW A;  4IA2 A;  3HC5 A;  3RLL A;  1XJ7 A;  3ZRB A;  4TUZ B;  5APH A;  2PIV A;  4MG8 A;  5DX3 A;  4IVY A;  3WJ5 A;  3AFR A;  4IUI A;  2VV3 A;  4QM0 A;  5AYG A;  4DK8 A;  1OT7 A;  4ZNV A;  3DZU A;  2QMV A;  4JL4 A;  5HCV A;  1XZX X;  2ZNN A;  3D90 A;  4OFU A;  1ERE A;  4DK7 A;  3IPU A;  4ZNW A;  4IA3 A;  1H9U A;  4XUM A;  3VT4 A;  3RLJ A;  1T76 A;  1QKU A;  5KRO A;  3UP0 A;  4E4K A;  3HC6 A;  1SJ0 A;  4HEE X;  2P1V A;  4OZR U;  4MGB A;  3VRT A;  3DR1 A;  3ZQT A;  1PCG A;  1YJE A;  3T03 A;  4LNW A;  1DKF A;  3HM1 A;  3AZ2 A;  2ZK2 A;  1A28 A;  1K4W A;  1Y0X X;  3DZY D;  5KRL A;  3WFG A;  5DLR A;  4ZJR A;  1EXX A;  3NOA A;  5G44 A;  4RE8 A;  2JF9 A;  5DUE A;  1ZH7 A;  1A52 A;  1RDT A;  2AX6 A;  3Q95 B;  1GWR A;  5DWG A;  4NIE A;  5APK A;  3VI8 A;  4WQP A;  4OK1 A;  2ZLA A;  3CS8 A;  2NXX A;  3AUQ A;  3M7R A;  4ZN7 A;  5AVL A;  3E00 A;  2VSR A;  5F9B A;  5C4S A;  3GN8 A;  3VT6 A;  3P0U A;  3DZY A;  2Q59 A;  1I7I A;  4ZOM A;  1K74 A;  4P6W A;  5DWE A;  3MNO A;  4KZJ A;  5FQT A;  3VT3 A;  1KNU A;  3HOD A;  4TUZ A;  5DKE A;  1NQ1 A;  3G0W A;  2F4B A;  4HLW A;  5APJ A;  3X1H A;  1PZL A;  3KBA A;  2OCF A;  4OAR A;  1NQ2 A;  3KYT A;  3PRG A;  5KYJ A;  4PVU A;  2I4Z A;  4FHH A;  2B1V A;  1I38 A;  1FCZ A;  2J7X A;  5EGV A;  4CI5 A;  2QA8 B;  3OMO A;  2ZK1 A;  2ZMI A;  2G5O A;  4S14 A;  3VT9 A;  1BSX A;  3V9Y A;  4TV1 B;  5DMF A;  2G0G A;  4XHD A;  1XVP B;  3OSI A;  1DB1 A;  3OKH A;  1Q4X A;  5C4U A;  5FQV A;  5G3J A;  4G20 A;  3WMH A;  4YT1 A;  1IE9 A;  3ADX A;  3R5M A;  2GPV A;  4QK4 A;  5DU5 A;  1ZDU A;  1NQ0 A;  2ZNQ A;  3IXP D;  3W5Q A;  2YLQ A;  4ZO1 B;  5DXR A;  2FSZ A;  1XP6 A;  2HBH A;  2Q70 A;  3A2J A;  3Q95 A;  4MG5 A;  5DP0 A;  5AWK A;  2HWQ A;  3R5N A;  3E94 A;  3AUR A;  1ZUC A;  3IPS A;  1XV9 B;  2VV1 B;  1N4H A;  3L3X A;  4OJ4 A;  4J5W A;  1KKQ A;  3GWS X;  2QPY A;  1UPW A;  2H77 A;  3DCU A;  3PBA A;  1T7R A;  4J24 A;  3L1B A;  4J5W C;  1IE8 A;  2AO6 A;  1TXI A;  5C4T A;  1NAX A;  1L2J A;  5KRK A;  5KCT A;  2QXM A;  4ZO1 X;  2POG A;  2R6Y A;  2YLY A;  3OZJ A;  4G2I A;  2P7Z A;  4QE8 A;  5DXK A;  3LMP A;  2PIN A;  3B66 A;  5ACC A;  2PIU A;  4OED A;  2PNU A;  3A2I A;  1NDE A;  4K7A A;  2FAI A;  3DCT A;  5ICK A;  1R1K D;  2ZMH A;  3TY0 A;  3OOF A;  5HJP B;  4K6I A;  4RUP A;  3OMM A;  3SP9 A;  2Q7K A;  3W0G A;  2ZNO A;  3VN2 A;  5B5B A;  5ETH A;  1NQ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...