5IAWA

Novel natural fxr modulator with a unique binding mode
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
228
structure length
228
Chain Sequence
LTPDQQTLLHFIMDSYNKQRMPQEITNKILKEEFSAEENFLILTEMATNHVQVLVEFTKKLPGFQTLDHEDQIALLKGSAVEAMFLRSAEIFNKKLPSGHSDLLEERIRNSGISDEYITPMFSFYKSIGELKMTQEEYALLTAIVILSPDRQYIKDREAVEKLQEPLLDVLQKLCKIHQPENPQHFACLLGRLTELRTFNHHHAEMLMSWRVNDHKFTPLLCEIWDVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Bile acid receptor
publication title A Novel Class of Natural FXR Modulators with a Unique Mode of Selective Co-regulator Assembly
pubmed doi rcsb
source organism Homo sapiens
total genus 90
structure length 228
sequence length 228
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 5iawA00
4PLDA 4IQRA 2QSEA 2PIXA 1EXAA 3H52A 2ZK0A 1T63A 3A9EB 3MNEA 4RMCA 3UUAA 4XUMA 3MNOA 2P7GA 3GZ9A 3IPQA 1PQCA 3CS8A 1XIUA 2ZXNA 1BSXA 1XNXA 3GD2A 1FM9D 3CS4A 5EJVA 3DZUD 1R20A 5B41A 2NV7A 4RZFA 3UUCA 3KMZA 1OT7A 4MGBA 1YMTA 2OM9A 4FNEA 4R2UA 5L11A 5F9BA 5E14A 5C4UA 3VN2A 3WFFA 3BEJA 1QKNA 4IUIA 4MG5A 3HQ5A 4N5GA 5GIDA 3JZBA 1X7BA 4ZJWA 5HJPA 4MG8B 2AX9A 4WVDA 5DZHA 5DWLA 3W0GA 4APUA 3UUDB 1FM9A 1NDEA 2QE4A 1N83A 4S0SA 3WWRA 1FM6D 4Q13A 4G2IA 5AVLA 1YJEA 3KDUA 5HCVA 5HZCA 2ZXMA 2J7XA 3B1MA 1T73A 2PNUA 2VV4A 3D6DA 5DXBB 2GIUA 1RDTD 5DV3A 3ZRAA 5FQPA 4DM6A 3VJIA 1PQ9A 3L3XA 5G43A 3FC6A 3G8IA 1FM6A 2YJDA 4R6SA 5KRHA 2G5OA 4XHDA 2HVCA 3WT5A 3AZ2A 2HB8A 4RFWA 4IWCA 3OS9A 1KV6A 2AX7A 5DIGA 1ZDTA 1ZKYA 3SP9A 4TV1B 1RDTA 3LBDA 2Q7JA 4OZRE 2HCDA 5E0XA 4ZNSA 5HYRA 1XLSA 5IXKA 4OARA 5KRKA 3B65A 1L2IA 4OJ9A 4F9MA 2I4PA 2ZK5A 3O1DA 3P0UA 4QE6A 2VSTA 3GBKA 4JAZA 5AWKA 2AMBA 1G5YA 3ADXA 1XZXX 2R6YA 3X31A 2IHQA 3FUGA 4M8HA 4NY9A 5DUEA 1XQCA 2FSZA 3S9SA 2PIOA 5DLRA 3V4AA 3KBAA 4REEA 2Q5PA 1SR7A 4N8RA 3V9VA 3OLFA 2GP7A 4NQAB 3OZJA 1SQNA 5C4SA 1NQ0A 2J14A 5DU5A 3VRUA 3ADWA 3IPUA 3TKCA 2NPAA 4QJRA 4IWFA 4UDAA 1T7RA 1X78A 5DVSA 2GTKA 2AO6A 1DB1A 1S9QA 2HBHA 1S0ZA 2Q8SA 4OKWA 5DZ1A 5M96A 1HJ1A 2HWRA 2Q1HA 2QA6A 2ZNOA 2XHSA 3A78A 4RUPA 4UDCA 2QMVA 2ACLA 5JI0D 2P7AA 5CJ6A 5DRJA 3OSAA 3B0WA 3W0YA 2A3IA 5DXQA 1YOKA 4KZMA 4IV2A 4LSJA 1ZH7A 3V3QA 5E1CA 2QABA 4MGAB 4NIEA 1R6GA 4PP3A 3F5CB 4XLDA 5KCEA 4K4JA 1XDKB 2ZK4A 1S9PA 4UDBA 1MVCA 2AA7A 4LNWA 4MGDA 5DX3B 3X1HA 5C4OA 5G45A 1ZDUA 4M8EA 3FEIA 4Q50A 5DVVA 2B1VA 3WTQA 3QT0A 1KKQA 5A86A 4G2HA 3D90A 3HO0A 2W8YA 3F5CA 4ZNWA 3G8OA 4LBDA 2ATHA 2O4JA 2OZ7A 3RY9A 1YIMA 3BQDA 1UHLB 3VSOA 1YP0A 4WHFA 5EHJA 3OOFA 3PRGA 1XVPB 3L03A 1S19A 5KRMA 2H77A 2Z4BA 3CWDA 4WQPA 5DYDA 4PRGA 1XV9A 5DP0A 3ZRBA 2Q3YA 5KCTA 3FXVA 3AN3A 5G44A 3SP6A 3VT3A 3H0AD 5AWJA 1VJBA 2QNVA 4G21A 3WJ5A 3NOAA 3HM1A 4L96A 5L7EA 1T7FA 1N46A 2NXXE 2QTUA 2PIQA 2Q59A 2Q5GA 3OAPA 1YUCA 4OEAA 2VV0A 3RVFA 3ZR7A 5KCUA 1A28A 4PPSA 2P7ZA 5DXEA 3UP3A 4E2JA 5IAWA 4S0TA 3DR1A 4J5WA 4JYHA 2NW4A 2QZOA 3FURA 2Q6RA 3OGTA 5FQRA 4DQMA 3B0TA 4WPFA 2XYJA 1GS4A 3GWXA 1YY4A 4G1YA 3OMPA 1FD0A 2YLQA 3OZ0A 5AAVA 3VJTA 4ZJRA 4MGBB 4FN9A 4ZNVA 3VT8A 3AUQA 3VT6A 3OOKA 5DXPA 1XNNA 5DXMA 1RK3A 3HODA 4IA1A 5HJPB 1ILHA 1Z5XU 4K7AA 4OC7A 2HB7A 1ZGYA 3OMQA 1M7WA 1NAXA 1DKFA 2AAXA 3VHWA 2AM9A 1SJ0A 5DKEA 3W0HA 3OSIA 2PIUA 4OZTE 2BJ4A 3OMKA 4RMDA 2VV4B 1RKGA 5DZIA 1EXXA 3WT6A 5LWPA 3E00A 1M13A 3KPZA 2ZASA 4P6XA 3W0IA 3FEJA 3NSPA 3P8XA 4J5XA 4A4VA 3FC6B 1K4WA 3AZ1A 3VHUA 3SZ1A 2ZBSA 3TX7B 3KMGA 2V7CA 3CS6A 3RUTA 2G0HA 1FBYA 1IE9A 2J7YA 4OLMA 4IA7A 2AXAA 3L3ZA 1Z95A 4N1YA 5DXKA 1NYXA 5DWIA 1XPCA 3LMPA 4OKBA 2AYRA 5DV8A 3K8SA 3R5MA 1QKTA 2HAMA 3B5RA 5DZ3A 2PITA 4PP5A 1R1KA 4IW8A 4XT9A 4YNKA 5EC9A 4J5XC 1S0XA 1G50A 3RLLA 4XAOA 2R6WA 2O9IA 1E3KA 2IOKA 2YATA 5KRCA 4XI3A 1PDUA 1XB7A 4MG7A 3B0RA 1LV2A 2QXSA 3GYUA 3VRWA 4A4WA 3D57A 4ZNTA 1ZAFA 4MGCA 5DIDA 3F7DA 4ZO1X 3U9QA 4ITEA 3CDSA 1OSHA 1XP6A 4OFUA 1QKUA 2ZMJA 3R2AA 4IS8A 4XUHA 4G20A 1PRGA 5JY3A 1YOWA 3G9EA 3V9TA 1T79A 2QR9A 2LBDA 4RUJA 2QGTA 4NUFA 2Q6JA 4RUOX 2B23A 4OKXA 2I4ZA 3FS1A 3V3EA 2IOGA 5DMFA 4OILA 3Q95A 4OKTA 4Q0AC 5KCCA 2ZL9A 2AX6A 3ADVA 5KYJA 3EYBA 3AN4A 3FLIA 3A2IA 5AK2A 2PINA 4PP6A 3WGPA 1SKXA 2ACLB 4BCRA 3HC5A 1ERRA 2VSRA 2AB2A 3P89A 2I4JA 5ACCA 3O1EA 1K7LA 3R29A 4DMAA 1PCGA 3ET1A 5LGAA 4OK1A 1G1UA 1IE8A 1M2ZA 3L1BA 4POJA 4PPPA 4RE8A 2OAXA 4NB6A 3IA6A 2G44A 4OIUA 4ITFA 4MGDB 1OVLA 3RLJA 2Z4JA 1NQ1A 1X7RA 2I0GA 4RAKA 3K6PA 3ILZA 3VTDA 2YHDA 2ZVTA 4OH6A 3OMOA 2P15A 2Q7KA 2I0JA 1R5KA 3AUNA 1XP1A 4JGVA 4CI5A 5DUGA 2JJ3A 3OS8A 4G1DA 3CLDA 5DXRA 2FAIA 3ET0A 3R8DA 3W5RA 4OH5A 3W5QA 5APKA 4IA2A 1XV9B 3K22A 4MDDA 4OHAA 2JFAA 2OVHA 4UDDA 3PCUA 4ZO1B 5G5WA 3UP0A 5KCWA 2PIPL 5K13A 2ZNQA 4IV4A 4X1FA 4ZNUA 3AURA 2YFEA 3B67A 4MG6A 2Q70A 1I37A 2GWXA 5EI1A 3TKMA 3DZYA 1ILGA 2Q59B 5L7HA 1TFCA 5L7GA 2ZNNA 3OS8C 1P93A 1NQ2A 2PJLA 2YLPA 3HC6A 3PBAA 3R5NA 4JYGA 2HASA 5GIEA 3VTCA 3ET2A 4KZIA 4MG9B 1NUOA 4N73A 1XLSE 1Y0XX 4L98A 1RJKA 2QZOB 4OIVA 5JJMA 1Y9RA 3IPSA 3KMRA 2P1VA 1YA3A 4CI4A 3ERTA 1U3QA 3W0CA 5AAVB 2GPPA 3VSPA 4MG9A 3OSWA 1PK5A 4TUZA 2O4RA 1XP9A 1Q4XA 4LTWA 4OJBA 4RZGA 1Z5XE 3ADTA 1NHZA 2ABIA 2QA8A 3ET3A 1MV9A 1FCZA 5DUHA 4XTAA 2Q7LA 3DCTA 4K6IA 4Y29A 5DTVA 4IVYA 5APJA 5KYAA 2VV1A 2VV2A 3KYTA 3NSQA 3OLSA 4OEZA 4OJ4A 1DKFB 3UVVA 4PWLA 2R40D 1E3GA 5GICA 1WM0X 3E00D 2P1UA 5DXGA 5DKGA 3N00A 2ZKCA 2BJ4B 2AA2A 4J5WC 2F4BA 4LNXA 5DKBA 1UPVA 3UU7A 4ZI1A 3HZFA 1XJ7A 3W5TA 1MZNA 5E7VA 4J24A 3RUUA 5H1EA 1GWRA 2P54A 5DV6A 4JL4A 3CQVA 3TY0A 1X76A 5DK9A 2R40A 5KRAA 5ETHA 3W0JA 5DWGA 2ZY0A 5KRLA 2Q5SA 1K74D 4ZN7A 4QL8A 3VJHA 3V49A 3AZ3A 1R1KD 4O8FA 3VHVA 4DM8A 4OEYA 3K23A 1UOMA 4OGHA 4PVUA 4HLWA 1YYEA 4YT1A 2J4AA 4RZEA 4P6WA 4QM0A 3A9EA 4E4QA 4MG7B 2V0VA 2ZLAA 1TXIA 1K74A 4EMAA 4G1ZA 1T7MA 3CJWA 3A2HA 5AYGA 4DORA 1GWQA 1ZUCA 4R06A 1P8DA 3ZQTA 2AMAA 4DK8A 3ADSA 3AX8A 3T03A 3GWSX 2ZLCA 1XAPA 1I38A 3DZUA 1LBDA 4FGYA 3ERDA 1T65A 3Q95B 4J26A 4MG8A 4ONIA 3WT7A 1PQ6A 2AA5A 2EWPA 2ZK2A 1X7JA 5DL4A 3VT7A 3UUDA 4OZTU 1FCXA 1T76A 2ZMIA 5FQVA 3B0QA 3CTBA 5GT4A 5HJSA 1I7GA 2QXMA 3KFCA 4DOSA 3B68A 3IXPD 4S14A 5SYZA 3R8IA 3B66A 3A3ZX 1QKMA 1KNUA 2HFPA 3CDPA 3PEQA 3FALB 4WHGA 2HWQA 5DXBA 5DY8A 3OLLA 4DK7A 2HARA 5KRJA 4ZN9A 3E94A 4OEDA 5FQTA 2PIRA 2ZK3A 5KR9A 3A2JA 4YMQA 1RKHA 1T5ZA 4YPQA 3VT9A 2Q61A 3JZCA 3KDTA 3OKIA 2NXXA 4QE8A 5DMCA 2XYXA 3FALA 3G0WA 5EITA 2PKLA 5DIEA 3IXPA 5DKSA 1OVLB 2POGA 2QGWA 1ZEOA 4TV1A 2OCFA 2PRGA 2REWA 1U3SA 2E2RA 3L0EA 4QK4A 3BC5A 5IZ0A 3D24A 5KCDA 4ZOMA 1UPWA 1FCYA 1T7TA 4IU7A 1NRLA 3VRTA 2PIVA 4OZRU 5G3JA 4E4KA 3HLVA 2ZK1A 3W0AA 1YINA 3L0JA 5AZTA 4IVWA 4EM9A 1GWXA 4REFA 2AA6A 1EREA 3OMMA 4PLEA 3V9YA 2JFAB 2YLOA 1OSVA 2ZMHA 3DY6A 3B3KA 4X1GA 3L0LA 3VTBA 3PLZA 1PZLA 2Q7IA 1L2JA 3P88A 3DZYD 1NQ7A 2Q6SA 5ICKA 5AZVA 3DT3A 2Q1VA 3OKHA 5KRFA 5I4VA 5C4TA 5KROA 2G0GA 3GN8A 2XYWA 1U9EA 2YLYA 5DWEA 1I7IA 1T74A 3GYTA 4FHHA 5DVCA 5AVIA 3E7CA 4B7WA 3ADUA 2AWHA 1HG4A 2GPVA 2OVMA 5EGVA 5KD9A 2POBA 5JJMB 2FVJA 4S15A 1NAVA 2OUZA 1G2NA 3AFRA 4FHIA 3KWYA 1N4HA 5G46A 3DCUA 1U3RA 1XQ3A 2B50A 5APHA 2BAWA 1XOWA 2HC4A 4TUZB 2Q60A 4MGAA 4ZNHA 5KCFA 3A40X 4PF3A 2QA8B 2ZXZA 2B1ZA 2P4YA 2QPYA 1XDKA 2PIWA 5DX3A 5E15A 4WLBA 4PXMA 2VV1B 2YJAB 2QW4A 2GL8A 2ZFXA 3UVVB 2H79A 5AAUA 3WMHA 2AX8A 1Y0SA 4KZJA 4IW6A 5HYKA 2ZK6A 3D5FA 3HVLA 4HEEX 4IA3A 2QH6A 3VRVA 2GPOA 3VT5A 3WFGA 3UU7B 1UHLA 5DWJA 3PO9A 1A52A 4POHA 5G42A 3M7RA 5E0WA 1XVPA 5KRIA 4JYIA 2GPUA 3X1IA 3W5PA 1H9UA 4OFRA 3WJ4A 2VV3A 3X36A 3IMYA 4RWVA 4RMEA 3MNPA 3VJSA 3VI8A 5DI7A 1X7EA 5E19A 4A2JA 5DZ0A 5FQSA 3UUAB 2ZNPA 4CSJA 5DRMA 3R8AA 3H0AA 5B5BA 3VT4A 2P1TA 2XKWA 5DSHA 2JF9A 1R20D 5DYBA
chains in the Genus database with same CATH superfamily
4PLDA 4IQRA 2QSEA 2PIXA 1EXAA 3H52A 2ZK0A 1T63A 3A9EB 3MNEA 4RMCA 3UUAA 4XUMA 3MNOA 2P7GA 3GZ9A 3IPQA 1PQCA 3CS8A 1XIUA 2ZXNA 1BSXA 1XNXA 3GD2A 1FM9D 3CS4A 5EJVA 3DZUD 1R20A 5B41A 2NV7A 4RZFA 3UUCA 3KMZA 1OT7A 4MGBA 1YMTA 2OM9A 4FNEA 4R2UA 5L11A 5F9BA 5E14A 5C4UA 3VN2A 3WFFA 3BEJA 1QKNA 4IUIA 4MG5A 3HQ5A 4N5GA 5GIDA 3JZBA 1X7BA 4ZJWA 5HJPA 4MG8B 2AX9A 4WVDA 5DZHA 5DWLA 3W0GA 4APUA 3UUDB 1FM9A 1NDEA 2QE4A 1N83A 4S0SA 3WWRA 1FM6D 4Q13A 4G2IA 5AVLA 1YJEA 3KDUA 5HCVA 5HZCA 2ZXMA 2J7XA 3B1MA 1T73A 2PNUA 2VV4A 3D6DA 5DXBB 2GIUA 1RDTD 5DV3A 3ZRAA 5FQPA 4DM6A 3VJIA 1PQ9A 3L3XA 5G43A 3FC6A 3G8IA 1FM6A 2YJDA 4R6SA 5KRHA 2G5OA 4XHDA 2HVCA 3WT5A 3AZ2A 2HB8A 4RFWA 4IWCA 3OS9A 1KV6A 2AX7A 5DIGA 1ZDTA 1ZKYA 3SP9A 4TV1B 1RDTA 3LBDA 2Q7JA 4OZRE 2HCDA 5E0XA 4ZNSA 5HYRA 1XLSA 5IXKA 4OARA 5KRKA 3B65A 1L2IA 4OJ9A 4F9MA 2I4PA 2ZK5A 3O1DA 3P0UA 4QE6A 2VSTA 3GBKA 4JAZA 5AWKA 2AMBA 1G5YA 3ADXA 1XZXX 2R6YA 3X31A 2IHQA 3FUGA 4M8HA 4NY9A 5DUEA 1XQCA 2FSZA 3S9SA 2PIOA 5DLRA 3V4AA 3KBAA 4REEA 2Q5PA 1SR7A 4N8RA 3V9VA 3OLFA 2GP7A 4NQAB 3OZJA 1SQNA 5C4SA 1NQ0A 2J14A 5DU5A 3VRUA 3ADWA 3IPUA 3TKCA 2NPAA 4QJRA 4IWFA 4UDAA 1T7RA 1X78A 5DVSA 2GTKA 2AO6A 1DB1A 1S9QA 2HBHA 1S0ZA 2Q8SA 4OKWA 5DZ1A 5M96A 1HJ1A 2HWRA 2Q1HA 2QA6A 2ZNOA 2XHSA 3A78A 4RUPA 4UDCA 2QMVA 2ACLA 5JI0D 2P7AA 5CJ6A 5DRJA 3OSAA 3B0WA 3W0YA 2A3IA 5DXQA 1YOKA 4KZMA 4IV2A 4LSJA 1ZH7A 3V3QA 5E1CA 2QABA 4MGAB 4NIEA 1R6GA 4PP3A 3F5CB 4XLDA 5KCEA 4K4JA 1XDKB 2ZK4A 1S9PA 4UDBA 1MVCA 2AA7A 4LNWA 4MGDA 5DX3B 3X1HA 5C4OA 5G45A 1ZDUA 4M8EA 3FEIA 4Q50A 5DVVA 2B1VA 3WTQA 3QT0A 1KKQA 5A86A 4G2HA 3D90A 3HO0A 2W8YA 3F5CA 4ZNWA 3G8OA 4LBDA 2ATHA 2O4JA 2OZ7A 3RY9A 1YIMA 3BQDA 1UHLB 3VSOA 1YP0A 4WHFA 5EHJA 3OOFA 3PRGA 1XVPB 3L03A 1S19A 5KRMA 2H77A 2Z4BA 3CWDA 4WQPA 5DYDA 4PRGA 1XV9A 5DP0A 3ZRBA 2Q3YA 5KCTA 3FXVA 3AN3A 5G44A 3SP6A 3VT3A 3H0AD 5AWJA 1VJBA 2QNVA 4G21A 3WJ5A 3NOAA 3HM1A 4L96A 5L7EA 1T7FA 1N46A 2NXXE 2QTUA 2PIQA 2Q59A 2Q5GA 3OAPA 1YUCA 4OEAA 2VV0A 3RVFA 3ZR7A 5KCUA 1A28A 4PPSA 2P7ZA 5DXEA 3UP3A 4E2JA 5IAWA 4S0TA 3DR1A 4J5WA 4JYHA 2NW4A 2QZOA 3FURA 2Q6RA 3OGTA 5FQRA 4DQMA 3B0TA 4WPFA 2XYJA 1GS4A 3GWXA 1YY4A 4G1YA 3OMPA 1FD0A 2YLQA 3OZ0A 5AAVA 3VJTA 4ZJRA 4MGBB 4FN9A 4ZNVA 3VT8A 3AUQA 3VT6A 3OOKA 5DXPA 1XNNA 5DXMA 1RK3A 3HODA 4IA1A 5HJPB 1ILHA 1Z5XU 4K7AA 4OC7A 2HB7A 1ZGYA 3OMQA 1M7WA 1NAXA 1DKFA 2AAXA 3VHWA 2AM9A 1SJ0A 5DKEA 3W0HA 3OSIA 2PIUA 4OZTE 2BJ4A 3OMKA 4RMDA 2VV4B 1RKGA 5DZIA 1EXXA 3WT6A 5LWPA 3E00A 1M13A 3KPZA 2ZASA 4P6XA 3W0IA 3FEJA 3NSPA 3P8XA 4J5XA 4A4VA 3FC6B 1K4WA 3AZ1A 3VHUA 3SZ1A 2ZBSA 3TX7B 3KMGA 2V7CA 3CS6A 3RUTA 2G0HA 1FBYA 1IE9A 2J7YA 4OLMA 4IA7A 2AXAA 3L3ZA 1Z95A 4N1YA 5DXKA 1NYXA 5DWIA 1XPCA 3LMPA 4OKBA 2AYRA 5DV8A 3K8SA 3R5MA 1QKTA 2HAMA 3B5RA 5DZ3A 2PITA 4PP5A 1R1KA 4IW8A 4XT9A 4YNKA 5EC9A 4J5XC 1S0XA 1G50A 3RLLA 4XAOA 2R6WA 2O9IA 1E3KA 2IOKA 2YATA 5KRCA 4XI3A 1PDUA 1XB7A 4MG7A 3B0RA 1LV2A 2QXSA 3GYUA 3VRWA 4A4WA 3D57A 4ZNTA 1ZAFA 4MGCA 5DIDA 3F7DA 4ZO1X 3U9QA 4ITEA 3CDSA 1OSHA 1XP6A 4OFUA 1QKUA 2ZMJA 3R2AA 4IS8A 4XUHA 4G20A 1PRGA 5JY3A 1YOWA 3G9EA 3V9TA 1T79A 2QR9A 2LBDA 4RUJA 2QGTA 4NUFA 2Q6JA 4RUOX 2B23A 4OKXA 2I4ZA 3FS1A 3V3EA 2IOGA 5DMFA 4OILA 3Q95A 4OKTA 4Q0AC 5KCCA 2ZL9A 2AX6A 3ADVA 5KYJA 3EYBA 3AN4A 3FLIA 3A2IA 5AK2A 2PINA 4PP6A 3WGPA 1SKXA 2ACLB 4BCRA 3HC5A 1ERRA 2VSRA 2AB2A 3P89A 2I4JA 5ACCA 3O1EA 1K7LA 3R29A 4DMAA 1PCGA 3ET1A 5LGAA 4OK1A 1G1UA 1IE8A 1M2ZA 3L1BA 4POJA 4PPPA 4RE8A 2OAXA 4NB6A 3IA6A 2G44A 4OIUA 4ITFA 4MGDB 1OVLA 3RLJA 2Z4JA 1NQ1A 1X7RA 2I0GA 4RAKA 3K6PA 3ILZA 3VTDA 2YHDA 2ZVTA 4OH6A 3OMOA 2P15A 2Q7KA 2I0JA 1R5KA 3AUNA 1XP1A 4JGVA 4CI5A 5DUGA 2JJ3A 3OS8A 4G1DA 3CLDA 5DXRA 2FAIA 3ET0A 3R8DA 3W5RA 4OH5A 3W5QA 5APKA 4IA2A 1XV9B 3K22A 4MDDA 4OHAA 2JFAA 2OVHA 4UDDA 3PCUA 4ZO1B 5G5WA 3UP0A 5KCWA 2PIPL 5K13A 2ZNQA 4IV4A 4X1FA 4ZNUA 3AURA 2YFEA 3B67A 4MG6A 2Q70A 1I37A 2GWXA 5EI1A 3TKMA 3DZYA 1ILGA 2Q59B 5L7HA 1TFCA 5L7GA 2ZNNA 3OS8C 1P93A 1NQ2A 2PJLA 2YLPA 3HC6A 3PBAA 3R5NA 4JYGA 2HASA 5GIEA 3VTCA 3ET2A 4KZIA 4MG9B 1NUOA 4N73A 1XLSE 1Y0XX 4L98A 1RJKA 2QZOB 4OIVA 5JJMA 1Y9RA 3IPSA 3KMRA 2P1VA 1YA3A 4CI4A 3ERTA 1U3QA 3W0CA 5AAVB 2GPPA 3VSPA 4MG9A 3OSWA 1PK5A 4TUZA 2O4RA 1XP9A 1Q4XA 4LTWA 4OJBA 4RZGA 1Z5XE 3ADTA 1NHZA 2ABIA 2QA8A 3ET3A 1MV9A 1FCZA 5DUHA 4XTAA 2Q7LA 3DCTA 4K6IA 4Y29A 5DTVA 4IVYA 5APJA 5KYAA 2VV1A 2VV2A 3KYTA 3NSQA 3OLSA 4OEZA 4OJ4A 1DKFB 3UVVA 4PWLA 2R40D 1E3GA 5GICA 1WM0X 3E00D 2P1UA 5DXGA 5DKGA 3N00A 2ZKCA 2BJ4B 2AA2A 4J5WC 2F4BA 4LNXA 5DKBA 1UPVA 3UU7A 4ZI1A 3HZFA 1XJ7A 3W5TA 1MZNA 5E7VA 4J24A 3RUUA 5H1EA 1GWRA 2P54A 5DV6A 4JL4A 3CQVA 3TY0A 1X76A 5DK9A 2R40A 5KRAA 5ETHA 3W0JA 5DWGA 2ZY0A 5KRLA 2Q5SA 1K74D 4ZN7A 4QL8A 3VJHA 3V49A 3AZ3A 1R1KD 4O8FA 3VHVA 4DM8A 4OEYA 3K23A 1UOMA 4OGHA 4PVUA 4HLWA 1YYEA 4YT1A 2J4AA 4RZEA 4P6WA 4QM0A 3A9EA 4E4QA 4MG7B 2V0VA 2ZLAA 1TXIA 1K74A 4EMAA 4G1ZA 1T7MA 3CJWA 3A2HA 5AYGA 4DORA 1GWQA 1ZUCA 4R06A 1P8DA 3ZQTA 2AMAA 4DK8A 3ADSA 3AX8A 3T03A 3GWSX 2ZLCA 1XAPA 1I38A 3DZUA 1LBDA 4FGYA 3ERDA 1T65A 3Q95B 4J26A 4MG8A 4ONIA 3WT7A 1PQ6A 2AA5A 2EWPA 2ZK2A 1X7JA 5DL4A 3VT7A 3UUDA 4OZTU 1FCXA 1T76A 2ZMIA 5FQVA 3B0QA 3CTBA 5GT4A 5HJSA 1I7GA 2QXMA 3KFCA 4DOSA 3B68A 3IXPD 4S14A 5SYZA 3R8IA 3B66A 3A3ZX 1QKMA 1KNUA 2HFPA 3CDPA 3PEQA 3FALB 4WHGA 2HWQA 5DXBA 5DY8A 3OLLA 4DK7A 2HARA 5KRJA 4ZN9A 3E94A 4OEDA 5FQTA 2PIRA 2ZK3A 5KR9A 3A2JA 4YMQA 1RKHA 1T5ZA 4YPQA 3VT9A 2Q61A 3JZCA 3KDTA 3OKIA 2NXXA 4QE8A 5DMCA 2XYXA 3FALA 3G0WA 5EITA 2PKLA 5DIEA 3IXPA 5DKSA 1OVLB 2POGA 2QGWA 1ZEOA 4TV1A 2OCFA 2PRGA 2REWA 1U3SA 2E2RA 3L0EA 4QK4A 3BC5A 5IZ0A 3D24A 5KCDA 4ZOMA 1UPWA 1FCYA 1T7TA 4IU7A 1NRLA 3VRTA 2PIVA 4OZRU 5G3JA 4E4KA 3HLVA 2ZK1A 3W0AA 1YINA 3L0JA 5AZTA 4IVWA 4EM9A 1GWXA 4REFA 2AA6A 1EREA 3OMMA 4PLEA 3V9YA 2JFAB 2YLOA 1OSVA 2ZMHA 3DY6A 3B3KA 4X1GA 3L0LA 3VTBA 3PLZA 1PZLA 2Q7IA 1L2JA 3P88A 3DZYD 1NQ7A 2Q6SA 5ICKA 5AZVA 3DT3A 2Q1VA 3OKHA 5KRFA 5I4VA 5C4TA 5KROA 2G0GA 3GN8A 2XYWA 1U9EA 2YLYA 5DWEA 1I7IA 1T74A 3GYTA 4FHHA 5DVCA 5AVIA 3E7CA 4B7WA 3ADUA 2AWHA 1HG4A 2GPVA 2OVMA 5EGVA 5KD9A 2POBA 5JJMB 2FVJA 4S15A 1NAVA 2OUZA 1G2NA 3AFRA 4FHIA 3KWYA 1N4HA 5G46A 3DCUA 1U3RA 1XQ3A 2B50A 5APHA 2BAWA 1XOWA 2HC4A 4TUZB 2Q60A 4MGAA 4ZNHA 5KCFA 3A40X 4PF3A 2QA8B 2ZXZA 2B1ZA 2P4YA 2QPYA 1XDKA 2PIWA 5DX3A 5E15A 4WLBA 4PXMA 2VV1B 2YJAB 2QW4A 2GL8A 2ZFXA 3UVVB 2H79A 5AAUA 3WMHA 2AX8A 1Y0SA 4KZJA 4IW6A 5HYKA 2ZK6A 3D5FA 3HVLA 4HEEX 4IA3A 2QH6A 3VRVA 2GPOA 3VT5A 3WFGA 3UU7B 1UHLA 5DWJA 3PO9A 1A52A 4POHA 5G42A 3M7RA 5E0WA 1XVPA 5KRIA 4JYIA 2GPUA 3X1IA 3W5PA 1H9UA 4OFRA 3WJ4A 2VV3A 3X36A 3IMYA 4RWVA 4RMEA 3MNPA 3VJSA 3VI8A 5DI7A 1X7EA 5E19A 4A2JA 5DZ0A 5FQSA 3UUAB 2ZNPA 4CSJA 5DRMA 3R8AA 3H0AA 5B5BA 3VT4A 2P1TA 2XKWA 5DSHA 2JF9A 1R20D 5DYBA
chains in the Genus database with same CATH topology
4PLDA 4IQRA 2QSEA 2PIXA 1EXAA 3H52A 2ZK0A 1T63A 3A9EB 3MNEA 4RMCA 3UUAA 4XUMA 3MNOA 2P7GA 3GZ9A 3IPQA 1PQCA 3CS8A 1XIUA 2ZXNA 1BSXA 1XNXA 3GD2A 1FM9D 3CS4A 5EJVA 3DZUD 1R20A 5B41A 2NV7A 4RZFA 3UUCA 3KMZA 1OT7A 4MGBA 1YMTA 2OM9A 4FNEA 4R2UA 5L11A 5F9BA 5E14A 5C4UA 3VN2A 3WFFA 3BEJA 1QKNA 4IUIA 4MG5A 3HQ5A 4N5GA 5GIDA 3JZBA 1X7BA 4ZJWA 5HJPA 4MG8B 2AX9A 4WVDA 5DZHA 5DWLA 3W0GA 4APUA 3UUDB 1FM9A 1NDEA 2QE4A 1N83A 4S0SA 3WWRA 1FM6D 4Q13A 4G2IA 5AVLA 1YJEA 3KDUA 5HCVA 5HZCA 2ZXMA 2J7XA 3B1MA 1T73A 2PNUA 2VV4A 3D6DA 5DXBB 2GIUA 1RDTD 5DV3A 3ZRAA 5FQPA 4DM6A 3VJIA 1PQ9A 3L3XA 5G43A 3FC6A 3G8IA 1FM6A 2YJDA 4R6SA 5KRHA 2G5OA 4XHDA 2HVCA 3WT5A 3AZ2A 2HB8A 4RFWA 4IWCA 3OS9A 1KV6A 2AX7A 5DIGA 1ZDTA 1ZKYA 3SP9A 4TV1B 1RDTA 3LBDA 2Q7JA 4OZRE 2HCDA 5E0XA 4ZNSA 5HYRA 1XLSA 5IXKA 4OARA 5KRKA 3B65A 1L2IA 4OJ9A 4F9MA 2I4PA 2ZK5A 3O1DA 3P0UA 4QE6A 2VSTA 3GBKA 4JAZA 5AWKA 2AMBA 1G5YA 3ADXA 1XZXX 2R6YA 3X31A 2IHQA 3FUGA 4M8HA 4NY9A 5DUEA 1XQCA 2FSZA 3S9SA 2PIOA 5DLRA 3V4AA 3KBAA 4REEA 2Q5PA 1SR7A 4N8RA 3V9VA 3OLFA 2GP7A 4NQAB 3OZJA 1SQNA 5C4SA 1NQ0A 2J14A 5DU5A 3VRUA 3ADWA 3IPUA 3TKCA 2NPAA 4QJRA 4IWFA 4UDAA 1T7RA 1X78A 5DVSA 2GTKA 2AO6A 1DB1A 1S9QA 2HBHA 1S0ZA 2Q8SA 4OKWA 5DZ1A 5M96A 1HJ1A 2HWRA 2Q1HA 2QA6A 2ZNOA 2XHSA 3A78A 4RUPA 4UDCA 2QMVA 2ACLA 5JI0D 2P7AA 5CJ6A 5DRJA 3OSAA 3B0WA 3W0YA 2A3IA 5DXQA 1YOKA 4KZMA 4IV2A 4LSJA 1ZH7A 3V3QA 5E1CA 2QABA 4MGAB 4NIEA 1R6GA 4PP3A 3F5CB 4XLDA 5KCEA 4K4JA 1XDKB 2ZK4A 1S9PA 4UDBA 1MVCA 2AA7A 4LNWA 4MGDA 5DX3B 3X1HA 5C4OA 5G45A 1ZDUA 4M8EA 3FEIA 4Q50A 5DVVA 2B1VA 3WTQA 3QT0A 1KKQA 5A86A 4G2HA 3D90A 3HO0A 2W8YA 3F5CA 4ZNWA 3G8OA 4LBDA 2ATHA 2O4JA 2OZ7A 3RY9A 1YIMA 3BQDA 1UHLB 3VSOA 1YP0A 4WHFA 5EHJA 3OOFA 3PRGA 1XVPB 3L03A 1S19A 5KRMA 2H77A 2Z4BA 3CWDA 4WQPA 5DYDA 4PRGA 1XV9A 5DP0A 3ZRBA 2Q3YA 5KCTA 3FXVA 3AN3A 5G44A 3SP6A 3VT3A 3H0AD 5AWJA 1VJBA 2QNVA 4G21A 3WJ5A 3NOAA 3HM1A 4L96A 5L7EA 1T7FA 1N46A 2NXXE 2QTUA 2PIQA 2Q59A 2Q5GA 3OAPA 1YUCA 4OEAA 2VV0A 3RVFA 3ZR7A 5KCUA 1A28A 4PPSA 2P7ZA 5DXEA 3UP3A 4E2JA 5IAWA 4S0TA 3DR1A 4J5WA 4JYHA 2NW4A 2QZOA 3FURA 2Q6RA 3OGTA 5FQRA 4DQMA 3B0TA 4WPFA 2XYJA 1GS4A 3GWXA 1YY4A 4G1YA 3OMPA 1FD0A 2YLQA 3OZ0A 5AAVA 3VJTA 4ZJRA 4MGBB 4FN9A 4ZNVA 3VT8A 3AUQA 3VT6A 3OOKA 5DXPA 1XNNA 5DXMA 1RK3A 3HODA 4IA1A 5HJPB 1ILHA 1Z5XU 4K7AA 4OC7A 2HB7A 1ZGYA 3OMQA 1M7WA 1NAXA 1DKFA 2AAXA 3VHWA 2AM9A 1SJ0A 5DKEA 3W0HA 3OSIA 2PIUA 4OZTE 2BJ4A 3OMKA 4RMDA 2VV4B 1RKGA 5DZIA 1EXXA 3WT6A 5LWPA 3E00A 1M13A 3KPZA 2ZASA 4P6XA 3W0IA 3FEJA 3NSPA 3P8XA 4J5XA 4A4VA 3FC6B 1K4WA 3AZ1A 3VHUA 3SZ1A 2ZBSA 3TX7B 3KMGA 2V7CA 3CS6A 3RUTA 2G0HA 1FBYA 1IE9A 2J7YA 4OLMA 4IA7A 2AXAA 3L3ZA 1Z95A 4N1YA 5DXKA 1NYXA 5DWIA 1XPCA 3LMPA 4OKBA 2AYRA 5DV8A 3K8SA 3R5MA 1QKTA 2HAMA 3B5RA 5DZ3A 2PITA 4PP5A 1R1KA 4IW8A 4XT9A 4YNKA 5EC9A 4J5XC 1S0XA 1G50A 3RLLA 4XAOA 2R6WA 2O9IA 1E3KA 2IOKA 2YATA 5KRCA 4XI3A 1PDUA 1XB7A 4MG7A 3B0RA 1LV2A 2QXSA 3GYUA 3VRWA 4A4WA 3D57A 4ZNTA 1ZAFA 4MGCA 5DIDA 3F7DA 4ZO1X 3U9QA 4ITEA 3CDSA 1OSHA 1XP6A 4OFUA 1QKUA 2ZMJA 3R2AA 4IS8A 4XUHA 4G20A 1PRGA 5JY3A 1YOWA 3G9EA 3V9TA 1T79A 2QR9A 2LBDA 4RUJA 2QGTA 4NUFA 2Q6JA 4RUOX 2B23A 4OKXA 2I4ZA 3FS1A 3V3EA 2IOGA 5DMFA 4OILA 3Q95A 4OKTA 4Q0AC 5KCCA 2ZL9A 2AX6A 3ADVA 5KYJA 3EYBA 3AN4A 3FLIA 3A2IA 5AK2A 2PINA 4PP6A 3WGPA 1SKXA 2ACLB 4BCRA 3HC5A 1ERRA 2VSRA 2AB2A 3P89A 2I4JA 5ACCA 3O1EA 1K7LA 3R29A 4DMAA 1PCGA 3ET1A 5LGAA 4OK1A 1G1UA 1IE8A 1M2ZA 3L1BA 4POJA 4PPPA 4RE8A 2OAXA 4NB6A 3IA6A 2G44A 4OIUA 4ITFA 4MGDB 1OVLA 3RLJA 2Z4JA 1NQ1A 1X7RA 2I0GA 4RAKA 3K6PA 3ILZA 3VTDA 2YHDA 2ZVTA 4OH6A 3OMOA 2P15A 2Q7KA 2I0JA 1R5KA 3AUNA 1XP1A 4JGVA 4CI5A 5DUGA 2JJ3A 3OS8A 4G1DA 3CLDA 5DXRA 2FAIA 3ET0A 3R8DA 3W5RA 4OH5A 3W5QA 5APKA 4IA2A 1XV9B 3K22A 4MDDA 4OHAA 2JFAA 2OVHA 4UDDA 3PCUA 4ZO1B 5G5WA 3UP0A 5KCWA 2PIPL 5K13A 2ZNQA 4IV4A 4X1FA 4ZNUA 3AURA 2YFEA 3B67A 4MG6A 2Q70A 1I37A 2GWXA 5EI1A 3TKMA 3DZYA 1ILGA 2Q59B 5L7HA 1TFCA 5L7GA 2ZNNA 3OS8C 1P93A 1NQ2A 2PJLA 2YLPA 3HC6A 3PBAA 3R5NA 4JYGA 2HASA 5GIEA 3VTCA 3ET2A 4KZIA 4MG9B 1NUOA 4N73A 1XLSE 1Y0XX 4L98A 1RJKA 2QZOB 4OIVA 5JJMA 1Y9RA 3IPSA 3KMRA 2P1VA 1YA3A 4CI4A 3ERTA 1U3QA 3W0CA 5AAVB 2GPPA 3VSPA 4MG9A 3OSWA 1PK5A 4TUZA 2O4RA 1XP9A 1Q4XA 4LTWA 4OJBA 4RZGA 1Z5XE 3ADTA 1NHZA 2ABIA 2QA8A 3ET3A 1MV9A 1FCZA 5DUHA 4XTAA 2Q7LA 3DCTA 4K6IA 4Y29A 5DTVA 4IVYA 5APJA 5KYAA 2VV1A 2VV2A 3KYTA 3NSQA 3OLSA 4OEZA 4OJ4A 1DKFB 3UVVA 4PWLA 2R40D 1E3GA 5GICA 1WM0X 3E00D 2P1UA 5DXGA 5DKGA 3N00A 2ZKCA 2BJ4B 2AA2A 4J5WC 2F4BA 4LNXA 5DKBA 1UPVA 3UU7A 4ZI1A 3HZFA 1XJ7A 3W5TA 1MZNA 5E7VA 4J24A 3RUUA 5H1EA 1GWRA 2P54A 5DV6A 4JL4A 3CQVA 3TY0A 1X76A 5DK9A 2R40A 5KRAA 5ETHA 3W0JA 5DWGA 2ZY0A 5KRLA 2Q5SA 1K74D 4ZN7A 4QL8A 3VJHA 3V49A 3AZ3A 1R1KD 4O8FA 3VHVA 4DM8A 4OEYA 3K23A 1UOMA 4OGHA 4PVUA 4HLWA 1YYEA 4YT1A 2J4AA 4RZEA 4P6WA 4QM0A 3A9EA 4E4QA 4MG7B 2V0VA 2ZLAA 1TXIA 1K74A 4EMAA 4G1ZA 1T7MA 3CJWA 3A2HA 5AYGA 4DORA 1GWQA 1ZUCA 4R06A 1P8DA 3ZQTA 2AMAA 4DK8A 3ADSA 3AX8A 3T03A 3GWSX 2ZLCA 1XAPA 1I38A 3DZUA 1LBDA 4FGYA 3ERDA 1T65A 3Q95B 4J26A 4MG8A 4ONIA 3WT7A 1PQ6A 2AA5A 2EWPA 2ZK2A 1X7JA 5DL4A 3VT7A 3UUDA 4OZTU 1FCXA 1T76A 2ZMIA 5FQVA 3B0QA 3CTBA 5GT4A 5HJSA 1I7GA 2QXMA 3KFCA 4DOSA 3B68A 3IXPD 4S14A 5SYZA 3R8IA 3B66A 3A3ZX 1QKMA 1KNUA 2HFPA 3CDPA 3PEQA 3FALB 4WHGA 2HWQA 5DXBA 5DY8A 3OLLA 4DK7A 2HARA 5KRJA 4ZN9A 3E94A 4OEDA 5FQTA 2PIRA 2ZK3A 5KR9A 3A2JA 4YMQA 1RKHA 1T5ZA 4YPQA 3VT9A 2Q61A 3JZCA 3KDTA 3OKIA 2NXXA 4QE8A 5DMCA 2XYXA 3FALA 3G0WA 5EITA 2PKLA 5DIEA 3IXPA 5DKSA 1OVLB 2POGA 2QGWA 1ZEOA 4TV1A 2OCFA 2PRGA 2REWA 1U3SA 2E2RA 3L0EA 4QK4A 3BC5A 5IZ0A 3D24A 5KCDA 4ZOMA 1UPWA 1FCYA 1T7TA 4IU7A 1NRLA 3VRTA 2PIVA 4OZRU 5G3JA 4E4KA 3HLVA 2ZK1A 3W0AA 1YINA 3L0JA 5AZTA 4IVWA 4EM9A 1GWXA 4REFA 2AA6A 1EREA 3OMMA 4PLEA 3V9YA 2JFAB 2YLOA 1OSVA 2ZMHA 3DY6A 3B3KA 4X1GA 3L0LA 3VTBA 3PLZA 1PZLA 2Q7IA 1L2JA 3P88A 3DZYD 1NQ7A 2Q6SA 5ICKA 5AZVA 3DT3A 2Q1VA 3OKHA 5KRFA 5I4VA 5C4TA 5KROA 2G0GA 3GN8A 2XYWA 1U9EA 2YLYA 5DWEA 1I7IA 1T74A 3GYTA 4FHHA 5DVCA 5AVIA 3E7CA 4B7WA 3ADUA 2AWHA 1HG4A 2GPVA 2OVMA 5EGVA 5KD9A 2POBA 5JJMB 2FVJA 4S15A 1NAVA 2OUZA 1G2NA 3AFRA 4FHIA 3KWYA 1N4HA 5G46A 3DCUA 1U3RA 1XQ3A 2B50A 5APHA 2BAWA 1XOWA 2HC4A 4TUZB 2Q60A 4MGAA 4ZNHA 5KCFA 3A40X 4PF3A 2QA8B 2ZXZA 2B1ZA 2P4YA 2QPYA 1XDKA 2PIWA 5DX3A 5E15A 4WLBA 4PXMA 2VV1B 2YJAB 2QW4A 2GL8A 2ZFXA 3UVVB 2H79A 5AAUA 3WMHA 2AX8A 1Y0SA 4KZJA 4IW6A 5HYKA 2ZK6A 3D5FA 3HVLA 4HEEX 4IA3A 2QH6A 3VRVA 2GPOA 3VT5A 3WFGA 3UU7B 1UHLA 5DWJA 3PO9A 1A52A 4POHA 5G42A 3M7RA 5E0WA 1XVPA 5KRIA 4JYIA 2GPUA 3X1IA 3W5PA 1H9UA 4OFRA 3WJ4A 2VV3A 3X36A 3IMYA 4RWVA 4RMEA 3MNPA 3VJSA 3VI8A 5DI7A 1X7EA 5E19A 4A2JA 5DZ0A 5FQSA 3UUAB 2ZNPA 4CSJA 5DRMA 3R8AA 3H0AA 5B5BA 3VT4A 2P1TA 2XKWA 5DSHA 2JF9A 1R20D 5DYBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PLD A;  4IQR A;  2QSE A;  2PIX A;  1EXA A;  3H52 A;  2ZK0 A;  1T63 A;  3A9E B;  3MNE A;  4RMC A;  3UUA A;  4XUM A;  3MNO A;  2P7G A;  3GZ9 A;  3IPQ A;  1PQC A;  3CS8 A;  1XIU A;  2ZXN A;  1BSX A;  1XNX A;  3GD2 A;  1FM9 D;  3CS4 A;  5EJV A;  3DZU D;  1R20 A;  5B41 A;  2NV7 A;  4RZF A;  3UUC A;  3KMZ A;  1OT7 A;  4MGB A;  1YMT A;  2OM9 A;  4FNE A;  4R2U A;  5L11 A;  5F9B A;  5E14 A;  5C4U A;  3VN2 A;  3WFF A;  3BEJ A;  1QKN A;  4IUI A;  4MG5 A;  3HQ5 A;  4N5G A;  5GID A;  3JZB A;  1X7B A;  4ZJW A;  5HJP A;  4MG8 B;  2AX9 A;  4WVD A;  5DZH A;  5DWL A;  3W0G A;  4APU A;  3UUD B;  1FM9 A;  1NDE A;  2QE4 A;  1N83 A;  4S0S A;  3WWR A;  1FM6 D;  4Q13 A;  4G2I A;  5AVL A;  1YJE A;  3KDU A;  5HCV A;  5HZC A;  2ZXM A;  2J7X A;  3B1M A;  1T73 A;  2PNU A;  2VV4 A;  3D6D A;  5DXB B;  2GIU A;  1RDT D;  5DV3 A;  3ZRA A;  5FQP A;  4DM6 A;  3VJI A;  1PQ9 A;  3L3X A;  5G43 A;  3FC6 A;  3G8I A;  1FM6 A;  2YJD A;  4R6S A;  5KRH A;  2G5O A;  4XHD A;  2HVC A;  3WT5 A;  3AZ2 A;  2HB8 A;  4RFW A;  4IWC A;  3OS9 A;  1KV6 A;  2AX7 A;  5DIG A;  1ZDT A;  1ZKY A;  3SP9 A;  4TV1 B;  1RDT A;  3LBD A;  2Q7J A;  4OZR E;  2HCD A;  5E0X A;  4ZNS A;  5HYR A;  1XLS A;  5IXK A;  4OAR A;  5KRK A;  3B65 A;  1L2I A;  4OJ9 A;  4F9M A;  2I4P A;  2ZK5 A;  3O1D A;  3P0U A;  4QE6 A;  2VST A;  3GBK A;  4JAZ A;  5AWK A;  2AMB A;  1G5Y A;  3ADX A;  1XZX X;  2R6Y A;  3X31 A;  2IHQ A;  3FUG A;  4M8H A;  4NY9 A;  5DUE A;  1XQC A;  2FSZ A;  3S9S A;  2PIO A;  5DLR A;  3V4A A;  3KBA A;  4REE A;  2Q5P A;  1SR7 A;  4N8R A;  3V9V A;  3OLF A;  2GP7 A;  4NQA B;  3OZJ A;  1SQN A;  5C4S A;  1NQ0 A;  2J14 A;  5DU5 A;  3VRU A;  3ADW A;  3IPU A;  3TKC A;  2NPA A;  4QJR A;  4IWF A;  4UDA A;  1T7R A;  1X78 A;  5DVS A;  2GTK A;  2AO6 A;  1DB1 A;  1S9Q A;  2HBH A;  1S0Z A;  2Q8S A;  4OKW A;  5DZ1 A;  5M96 A;  1HJ1 A;  2HWR A;  2Q1H A;  2QA6 A;  2ZNO A;  2XHS A;  3A78 A;  4RUP A;  4UDC A;  2QMV A;  2ACL A;  5JI0 D;  2P7A A;  5CJ6 A;  5DRJ A;  3OSA A;  3B0W A;  3W0Y A;  2A3I A;  5DXQ A;  1YOK A;  4KZM A;  4IV2 A;  4LSJ A;  1ZH7 A;  3V3Q A;  5E1C A;  2QAB A;  4MGA B;  4NIE A;  1R6G A;  4PP3 A;  3F5C B;  4XLD A;  5KCE A;  4K4J A;  1XDK B;  2ZK4 A;  1S9P A;  4UDB A;  1MVC A;  2AA7 A;  4LNW A;  4MGD A;  5DX3 B;  3X1H A;  5C4O A;  5G45 A;  1ZDU A;  4M8E A;  3FEI A;  4Q50 A;  5DVV A;  2B1V A;  3WTQ A;  3QT0 A;  1KKQ A;  5A86 A;  4G2H A;  3D90 A;  3HO0 A;  2W8Y A;  3F5C A;  4ZNW A;  3G8O A;  4LBD A;  2ATH A;  2O4J A;  2OZ7 A;  3RY9 A;  1YIM A;  3BQD A;  1UHL B;  3VSO A;  1YP0 A;  4WHF A;  5EHJ A;  3OOF A;  3PRG A;  1XVP B;  3L03 A;  1S19 A;  5KRM A;  2H77 A;  2Z4B A;  3CWD A;  4WQP A;  5DYD A;  4PRG A;  1XV9 A;  5DP0 A;  3ZRB A;  2Q3Y A;  5KCT A;  3FXV A;  3AN3 A;  5G44 A;  3SP6 A;  3VT3 A;  3H0A D;  5AWJ A;  1VJB A;  2QNV A;  4G21 A;  3WJ5 A;  3NOA A;  3HM1 A;  4L96 A;  5L7E A;  1T7F A;  1N46 A;  2NXX E;  2QTU A;  2PIQ A;  2Q59 A;  2Q5G A;  3OAP A;  1YUC A;  4OEA A;  2VV0 A;  3RVF A;  3ZR7 A;  5KCU A;  1A28 A;  4PPS A;  2P7Z A;  5DXE A;  3UP3 A;  4E2J A;  5IAW A;  4S0T A;  3DR1 A;  4J5W A;  4JYH A;  2NW4 A;  2QZO A;  3FUR A;  2Q6R A;  3OGT A;  5FQR A;  4DQM A;  3B0T A;  4WPF A;  2XYJ A;  1GS4 A;  3GWX A;  1YY4 A;  4G1Y A;  3OMP A;  1FD0 A;  2YLQ A;  3OZ0 A;  5AAV A;  3VJT A;  4ZJR A;  4MGB B;  4FN9 A;  4ZNV A;  3VT8 A;  3AUQ A;  3VT6 A;  3OOK A;  5DXP A;  1XNN A;  5DXM A;  1RK3 A;  3HOD A;  4IA1 A;  5HJP B;  1ILH A;  1Z5X U;  4K7A A;  4OC7 A;  2HB7 A;  1ZGY A;  3OMQ A;  1M7W A;  1NAX A;  1DKF A;  2AAX A;  3VHW A;  2AM9 A;  1SJ0 A;  5DKE A;  3W0H A;  3OSI A;  2PIU A;  4OZT E;  2BJ4 A;  3OMK A;  4RMD A;  2VV4 B;  1RKG A;  5DZI A;  1EXX A;  3WT6 A;  5LWP A;  3E00 A;  1M13 A;  3KPZ A;  2ZAS A;  4P6X A;  3W0I A;  3FEJ A;  3NSP A;  3P8X A;  4J5X A;  4A4V A;  3FC6 B;  1K4W A;  3AZ1 A;  3VHU A;  3SZ1 A;  2ZBS A;  3TX7 B;  3KMG A;  2V7C A;  3CS6 A;  3RUT A;  2G0H A;  1FBY A;  1IE9 A;  2J7Y A;  4OLM A;  4IA7 A;  2AXA A;  3L3Z A;  1Z95 A;  4N1Y A;  5DXK A;  1NYX A;  5DWI A;  1XPC A;  3LMP A;  4OKB A;  2AYR A;  5DV8 A;  3K8S A;  3R5M A;  1QKT A;  2HAM A;  3B5R A;  5DZ3 A;  2PIT A;  4PP5 A;  1R1K A;  4IW8 A;  4XT9 A;  4YNK A;  5EC9 A;  4J5X C;  1S0X A;  1G50 A;  3RLL A;  4XAO A;  2R6W A;  2O9I A;  1E3K A;  2IOK A;  2YAT A;  5KRC A;  4XI3 A;  1PDU A;  1XB7 A;  4MG7 A;  3B0R A;  1LV2 A;  2QXS A;  3GYU A;  3VRW A;  4A4W A;  3D57 A;  4ZNT A;  1ZAF A;  4MGC A;  5DID A;  3F7D A;  4ZO1 X;  3U9Q A;  4ITE A;  3CDS A;  1OSH A;  1XP6 A;  4OFU A;  1QKU A;  2ZMJ A;  3R2A A;  4IS8 A;  4XUH A;  4G20 A;  1PRG A;  5JY3 A;  1YOW A;  3G9E A;  3V9T A;  1T79 A;  2QR9 A;  2LBD A;  4RUJ A;  2QGT A;  4NUF A;  2Q6J A;  4RUO X;  2B23 A;  4OKX A;  2I4Z A;  3FS1 A;  3V3E A;  2IOG A;  5DMF A;  4OIL A;  3Q95 A;  4OKT A;  4Q0A C;  5KCC A;  2ZL9 A;  2AX6 A;  3ADV A;  5KYJ A;  3EYB A;  3AN4 A;  3FLI A;  3A2I A;  5AK2 A;  2PIN A;  4PP6 A;  3WGP A;  1SKX A;  2ACL B;  4BCR A;  3HC5 A;  1ERR A;  2VSR A;  2AB2 A;  3P89 A;  2I4J A;  5ACC A;  3O1E A;  1K7L A;  3R29 A;  4DMA A;  1PCG A;  3ET1 A;  5LGA A;  4OK1 A;  1G1U A;  1IE8 A;  1M2Z A;  3L1B A;  4POJ A;  4PPP A;  4RE8 A;  2OAX A;  4NB6 A;  3IA6 A;  2G44 A;  4OIU A;  4ITF A;  4MGD B;  1OVL A;  3RLJ A;  2Z4J A;  1NQ1 A;  1X7R A;  2I0G A;  4RAK A;  3K6P A;  3ILZ A;  3VTD A;  2YHD A;  2ZVT A;  4OH6 A;  3OMO A;  2P15 A;  2Q7K A;  2I0J A;  1R5K A;  3AUN A;  1XP1 A;  4JGV A;  4CI5 A;  5DUG A;  2JJ3 A;  3OS8 A;  4G1D A;  3CLD A;  5DXR A;  2FAI A;  3ET0 A;  3R8D A;  3W5R A;  4OH5 A;  3W5Q A;  5APK A;  4IA2 A;  1XV9 B;  3K22 A;  4MDD A;  4OHA A;  2JFA A;  2OVH A;  4UDD A;  3PCU A;  4ZO1 B;  5G5W A;  3UP0 A;  5KCW A;  2PIP L;  5K13 A;  2ZNQ A;  4IV4 A;  4X1F A;  4ZNU A;  3AUR A;  2YFE A;  3B67 A;  4MG6 A;  2Q70 A;  1I37 A;  2GWX A;  5EI1 A;  3TKM A;  3DZY A;  1ILG A;  2Q59 B;  5L7H A;  1TFC A;  5L7G A;  2ZNN A;  3OS8 C;  1P93 A;  1NQ2 A;  2PJL A;  2YLP A;  3HC6 A;  3PBA A;  3R5N A;  4JYG A;  2HAS A;  5GIE A;  3VTC A;  3ET2 A;  4KZI A;  4MG9 B;  1NUO A;  4N73 A;  1XLS E;  1Y0X X;  4L98 A;  1RJK A;  2QZO B;  4OIV A;  5JJM A;  1Y9R A;  3IPS A;  3KMR A;  2P1V A;  1YA3 A;  4CI4 A;  3ERT A;  1U3Q A;  3W0C A;  5AAV B;  2GPP A;  3VSP A;  4MG9 A;  3OSW A;  1PK5 A;  4TUZ A;  2O4R A;  1XP9 A;  1Q4X A;  4LTW A;  4OJB A;  4RZG A;  1Z5X E;  3ADT A;  1NHZ A;  2ABI A;  2QA8 A;  3ET3 A;  1MV9 A;  1FCZ A;  5DUH A;  4XTA A;  2Q7L A;  3DCT A;  4K6I A;  4Y29 A;  5DTV A;  4IVY A;  5APJ A;  5KYA A;  2VV1 A;  2VV2 A;  3KYT A;  3NSQ A;  3OLS A;  4OEZ A;  4OJ4 A;  1DKF B;  3UVV A;  4PWL A;  2R40 D;  1E3G A;  5GIC A;  1WM0 X;  3E00 D;  2P1U A;  5DXG A;  5DKG A;  3N00 A;  2ZKC A;  2BJ4 B;  2AA2 A;  4J5W C;  2F4B A;  4LNX A;  5DKB A;  1UPV A;  3UU7 A;  4ZI1 A;  3HZF A;  1XJ7 A;  3W5T A;  1MZN A;  5E7V A;  4J24 A;  3RUU A;  5H1E A;  1GWR A;  2P54 A;  5DV6 A;  4JL4 A;  3CQV A;  3TY0 A;  1X76 A;  5DK9 A;  2R40 A;  5KRA A;  5ETH A;  3W0J A;  5DWG A;  2ZY0 A;  5KRL A;  2Q5S A;  1K74 D;  4ZN7 A;  4QL8 A;  3VJH A;  3V49 A;  3AZ3 A;  1R1K D;  4O8F A;  3VHV A;  4DM8 A;  4OEY A;  3K23 A;  1UOM A;  4OGH A;  4PVU A;  4HLW A;  1YYE A;  4YT1 A;  2J4A A;  4RZE A;  4P6W A;  4QM0 A;  3A9E A;  4E4Q A;  4MG7 B;  2V0V A;  2ZLA A;  1TXI A;  1K74 A;  4EMA A;  4G1Z A;  1T7M A;  3CJW A;  3A2H A;  5AYG A;  4DOR A;  1GWQ A;  1ZUC A;  4R06 A;  1P8D A;  3ZQT A;  2AMA A;  4DK8 A;  3ADS A;  3AX8 A;  3T03 A;  3GWS X;  2ZLC A;  1XAP A;  1I38 A;  3DZU A;  1LBD A;  4FGY A;  3ERD A;  1T65 A;  3Q95 B;  4J26 A;  4MG8 A;  4ONI A;  3WT7 A;  1PQ6 A;  2AA5 A;  2EWP A;  2ZK2 A;  1X7J A;  5DL4 A;  3VT7 A;  3UUD A;  4OZT U;  1FCX A;  1T76 A;  2ZMI A;  5FQV A;  3B0Q A;  3CTB A;  5GT4 A;  5HJS A;  1I7G A;  2QXM A;  3KFC A;  4DOS A;  3B68 A;  3IXP D;  4S14 A;  5SYZ A;  3R8I A;  3B66 A;  3A3Z X;  1QKM A;  1KNU A;  2HFP A;  3CDP A;  3PEQ A;  3FAL B;  4WHG A;  2HWQ A;  5DXB A;  5DY8 A;  3OLL A;  4DK7 A;  2HAR A;  5KRJ A;  4ZN9 A;  3E94 A;  4OED A;  5FQT A;  2PIR A;  2ZK3 A;  5KR9 A;  3A2J A;  4YMQ A;  1RKH A;  1T5Z A;  4YPQ A;  3VT9 A;  2Q61 A;  3JZC A;  3KDT A;  3OKI A;  2NXX A;  4QE8 A;  5DMC A;  2XYX A;  3FAL A;  3G0W A;  5EIT A;  2PKL A;  5DIE A;  3IXP A;  5DKS A;  1OVL B;  2POG A;  2QGW A;  1ZEO A;  4TV1 A;  2OCF A;  2PRG A;  2REW A;  1U3S A;  2E2R A;  3L0E A;  4QK4 A;  3BC5 A;  5IZ0 A;  3D24 A;  5KCD A;  4ZOM A;  1UPW A;  1FCY A;  1T7T A;  4IU7 A;  1NRL A;  3VRT A;  2PIV A;  4OZR U;  5G3J A;  4E4K A;  3HLV A;  2ZK1 A;  3W0A A;  1YIN A;  3L0J A;  5AZT A;  4IVW A;  4EM9 A;  1GWX A;  4REF A;  2AA6 A;  1ERE A;  3OMM A;  4PLE A;  3V9Y A;  2JFA B;  2YLO A;  1OSV A;  2ZMH A;  3DY6 A;  3B3K A;  4X1G A;  3L0L A;  3VTB A;  3PLZ A;  1PZL A;  2Q7I A;  1L2J A;  3P88 A;  3DZY D;  1NQ7 A;  2Q6S A;  5ICK A;  5AZV A;  3DT3 A;  2Q1V A;  3OKH A;  5KRF A;  5I4V A;  5C4T A;  5KRO A;  2G0G A;  3GN8 A;  2XYW A;  1U9E A;  2YLY A;  5DWE A;  1I7I A;  1T74 A;  3GYT A;  4FHH A;  5DVC A;  5AVI A;  3E7C A;  4B7W A;  3ADU A;  2AWH A;  1HG4 A;  2GPV A;  2OVM A;  5EGV A;  5KD9 A;  2POB A;  5JJM B;  2FVJ A;  4S15 A;  1NAV A;  2OUZ A;  1G2N A;  3AFR A;  4FHI A;  3KWY A;  1N4H A;  5G46 A;  3DCU A;  1U3R A;  1XQ3 A;  2B50 A;  5APH A;  2BAW A;  1XOW A;  2HC4 A;  4TUZ B;  2Q60 A;  4MGA A;  4ZNH A;  5KCF A;  3A40 X;  4PF3 A;  2QA8 B;  2ZXZ A;  2B1Z A;  2P4Y A;  2QPY A;  1XDK A;  2PIW A;  5DX3 A;  5E15 A;  4WLB A;  4PXM A;  2VV1 B;  2YJA B;  2QW4 A;  2GL8 A;  2ZFX A;  3UVV B;  2H79 A;  5AAU A;  3WMH A;  2AX8 A;  1Y0S A;  4KZJ A;  4IW6 A;  5HYK A;  2ZK6 A;  3D5F A;  3HVL A;  4HEE X;  4IA3 A;  2QH6 A;  3VRV A;  2GPO A;  3VT5 A;  3WFG A;  3UU7 B;  1UHL A;  5DWJ A;  3PO9 A;  1A52 A;  4POH A;  5G42 A;  3M7R A;  5E0W A;  1XVP A;  5KRI A;  4JYI A;  2GPU A;  3X1I A;  3W5P A;  1H9U A;  4OFR A;  3WJ4 A;  2VV3 A;  3X36 A;  3IMY A;  4RWV A;  4RME A;  3MNP A;  3VJS A;  3VI8 A;  5DI7 A;  1X7E A;  5E19 A;  4A2J A;  5DZ0 A;  5FQS A;  3UUA B;  2ZNP A;  4CSJ A;  5DRM A;  3R8A A;  3H0A A;  5B5B A;  3VT4 A;  2P1T A;  2XKW A;  5DSH A;  2JF9 A;  1R20 D;  5DYB A; 
#chains in the Genus database with same CATH topology
 4PLD A;  4IQR A;  2QSE A;  2PIX A;  1EXA A;  3H52 A;  2ZK0 A;  1T63 A;  3A9E B;  3MNE A;  4RMC A;  3UUA A;  4XUM A;  3MNO A;  2P7G A;  3GZ9 A;  3IPQ A;  1PQC A;  3CS8 A;  1XIU A;  2ZXN A;  1BSX A;  1XNX A;  3GD2 A;  1FM9 D;  3CS4 A;  5EJV A;  3DZU D;  1R20 A;  5B41 A;  2NV7 A;  4RZF A;  3UUC A;  3KMZ A;  1OT7 A;  4MGB A;  1YMT A;  2OM9 A;  4FNE A;  4R2U A;  5L11 A;  5F9B A;  5E14 A;  5C4U A;  3VN2 A;  3WFF A;  3BEJ A;  1QKN A;  4IUI A;  4MG5 A;  3HQ5 A;  4N5G A;  5GID A;  3JZB A;  1X7B A;  4ZJW A;  5HJP A;  4MG8 B;  2AX9 A;  4WVD A;  5DZH A;  5DWL A;  3W0G A;  4APU A;  3UUD B;  1FM9 A;  1NDE A;  2QE4 A;  1N83 A;  4S0S A;  3WWR A;  1FM6 D;  4Q13 A;  4G2I A;  5AVL A;  1YJE A;  3KDU A;  5HCV A;  5HZC A;  2ZXM A;  2J7X A;  3B1M A;  1T73 A;  2PNU A;  2VV4 A;  3D6D A;  5DXB B;  2GIU A;  1RDT D;  5DV3 A;  3ZRA A;  5FQP A;  4DM6 A;  3VJI A;  1PQ9 A;  3L3X A;  5G43 A;  3FC6 A;  3G8I A;  1FM6 A;  2YJD A;  4R6S A;  5KRH A;  2G5O A;  4XHD A;  2HVC A;  3WT5 A;  3AZ2 A;  2HB8 A;  4RFW A;  4IWC A;  3OS9 A;  1KV6 A;  2AX7 A;  5DIG A;  1ZDT A;  1ZKY A;  3SP9 A;  4TV1 B;  1RDT A;  3LBD A;  2Q7J A;  4OZR E;  2HCD A;  5E0X A;  4ZNS A;  5HYR A;  1XLS A;  5IXK A;  4OAR A;  5KRK A;  3B65 A;  1L2I A;  4OJ9 A;  4F9M A;  2I4P A;  2ZK5 A;  3O1D A;  3P0U A;  4QE6 A;  2VST A;  3GBK A;  4JAZ A;  5AWK A;  2AMB A;  1G5Y A;  3ADX A;  1XZX X;  2R6Y A;  3X31 A;  2IHQ A;  3FUG A;  4M8H A;  4NY9 A;  5DUE A;  1XQC A;  2FSZ A;  3S9S A;  2PIO A;  5DLR A;  3V4A A;  3KBA A;  4REE A;  2Q5P A;  1SR7 A;  4N8R A;  3V9V A;  3OLF A;  2GP7 A;  4NQA B;  3OZJ A;  1SQN A;  5C4S A;  1NQ0 A;  2J14 A;  5DU5 A;  3VRU A;  3ADW A;  3IPU A;  3TKC A;  2NPA A;  4QJR A;  4IWF A;  4UDA A;  1T7R A;  1X78 A;  5DVS A;  2GTK A;  2AO6 A;  1DB1 A;  1S9Q A;  2HBH A;  1S0Z A;  2Q8S A;  4OKW A;  5DZ1 A;  5M96 A;  1HJ1 A;  2HWR A;  2Q1H A;  2QA6 A;  2ZNO A;  2XHS A;  3A78 A;  4RUP A;  4UDC A;  2QMV A;  2ACL A;  5JI0 D;  2P7A A;  5CJ6 A;  5DRJ A;  3OSA A;  3B0W A;  3W0Y A;  2A3I A;  5DXQ A;  1YOK A;  4KZM A;  4IV2 A;  4LSJ A;  1ZH7 A;  3V3Q A;  5E1C A;  2QAB A;  4MGA B;  4NIE A;  1R6G A;  4PP3 A;  3F5C B;  4XLD A;  5KCE A;  4K4J A;  1XDK B;  2ZK4 A;  1S9P A;  4UDB A;  1MVC A;  2AA7 A;  4LNW A;  4MGD A;  5DX3 B;  3X1H A;  5C4O A;  5G45 A;  1ZDU A;  4M8E A;  3FEI A;  4Q50 A;  5DVV A;  2B1V A;  3WTQ A;  3QT0 A;  1KKQ A;  5A86 A;  4G2H A;  3D90 A;  3HO0 A;  2W8Y A;  3F5C A;  4ZNW A;  3G8O A;  4LBD A;  2ATH A;  2O4J A;  2OZ7 A;  3RY9 A;  1YIM A;  3BQD A;  1UHL B;  3VSO A;  1YP0 A;  4WHF A;  5EHJ A;  3OOF A;  3PRG A;  1XVP B;  3L03 A;  1S19 A;  5KRM A;  2H77 A;  2Z4B A;  3CWD A;  4WQP A;  5DYD A;  4PRG A;  1XV9 A;  5DP0 A;  3ZRB A;  2Q3Y A;  5KCT A;  3FXV A;  3AN3 A;  5G44 A;  3SP6 A;  3VT3 A;  3H0A D;  5AWJ A;  1VJB A;  2QNV A;  4G21 A;  3WJ5 A;  3NOA A;  3HM1 A;  4L96 A;  5L7E A;  1T7F A;  1N46 A;  2NXX E;  2QTU A;  2PIQ A;  2Q59 A;  2Q5G A;  3OAP A;  1YUC A;  4OEA A;  2VV0 A;  3RVF A;  3ZR7 A;  5KCU A;  1A28 A;  4PPS A;  2P7Z A;  5DXE A;  3UP3 A;  4E2J A;  5IAW A;  4S0T A;  3DR1 A;  4J5W A;  4JYH A;  2NW4 A;  2QZO A;  3FUR A;  2Q6R A;  3OGT A;  5FQR A;  4DQM A;  3B0T A;  4WPF A;  2XYJ A;  1GS4 A;  3GWX A;  1YY4 A;  4G1Y A;  3OMP A;  1FD0 A;  2YLQ A;  3OZ0 A;  5AAV A;  3VJT A;  4ZJR A;  4MGB B;  4FN9 A;  4ZNV A;  3VT8 A;  3AUQ A;  3VT6 A;  3OOK A;  5DXP A;  1XNN A;  5DXM A;  1RK3 A;  3HOD A;  4IA1 A;  5HJP B;  1ILH A;  1Z5X U;  4K7A A;  4OC7 A;  2HB7 A;  1ZGY A;  3OMQ A;  1M7W A;  1NAX A;  1DKF A;  2AAX A;  3VHW A;  2AM9 A;  1SJ0 A;  5DKE A;  3W0H A;  3OSI A;  2PIU A;  4OZT E;  2BJ4 A;  3OMK A;  4RMD A;  2VV4 B;  1RKG A;  5DZI A;  1EXX A;  3WT6 A;  5LWP A;  3E00 A;  1M13 A;  3KPZ A;  2ZAS A;  4P6X A;  3W0I A;  3FEJ A;  3NSP A;  3P8X A;  4J5X A;  4A4V A;  3FC6 B;  1K4W A;  3AZ1 A;  3VHU A;  3SZ1 A;  2ZBS A;  3TX7 B;  3KMG A;  2V7C A;  3CS6 A;  3RUT A;  2G0H A;  1FBY A;  1IE9 A;  2J7Y A;  4OLM A;  4IA7 A;  2AXA A;  3L3Z A;  1Z95 A;  4N1Y A;  5DXK A;  1NYX A;  5DWI A;  1XPC A;  3LMP A;  4OKB A;  2AYR A;  5DV8 A;  3K8S A;  3R5M A;  1QKT A;  2HAM A;  3B5R A;  5DZ3 A;  2PIT A;  4PP5 A;  1R1K A;  4IW8 A;  4XT9 A;  4YNK A;  5EC9 A;  4J5X C;  1S0X A;  1G50 A;  3RLL A;  4XAO A;  2R6W A;  2O9I A;  1E3K A;  2IOK A;  2YAT A;  5KRC A;  4XI3 A;  1PDU A;  1XB7 A;  4MG7 A;  3B0R A;  1LV2 A;  2QXS A;  3GYU A;  3VRW A;  4A4W A;  3D57 A;  4ZNT A;  1ZAF A;  4MGC A;  5DID A;  3F7D A;  4ZO1 X;  3U9Q A;  4ITE A;  3CDS A;  1OSH A;  1XP6 A;  4OFU A;  1QKU A;  2ZMJ A;  3R2A A;  4IS8 A;  4XUH A;  4G20 A;  1PRG A;  5JY3 A;  1YOW A;  3G9E A;  3V9T A;  1T79 A;  2QR9 A;  2LBD A;  4RUJ A;  2QGT A;  4NUF A;  2Q6J A;  4RUO X;  2B23 A;  4OKX A;  2I4Z A;  3FS1 A;  3V3E A;  2IOG A;  5DMF A;  4OIL A;  3Q95 A;  4OKT A;  4Q0A C;  5KCC A;  2ZL9 A;  2AX6 A;  3ADV A;  5KYJ A;  3EYB A;  3AN4 A;  3FLI A;  3A2I A;  5AK2 A;  2PIN A;  4PP6 A;  3WGP A;  1SKX A;  2ACL B;  4BCR A;  3HC5 A;  1ERR A;  2VSR A;  2AB2 A;  3P89 A;  2I4J A;  5ACC A;  3O1E A;  1K7L A;  3R29 A;  4DMA A;  1PCG A;  3ET1 A;  5LGA A;  4OK1 A;  1G1U A;  1IE8 A;  1M2Z A;  3L1B A;  4POJ A;  4PPP A;  4RE8 A;  2OAX A;  4NB6 A;  3IA6 A;  2G44 A;  4OIU A;  4ITF A;  4MGD B;  1OVL A;  3RLJ A;  2Z4J A;  1NQ1 A;  1X7R A;  2I0G A;  4RAK A;  3K6P A;  3ILZ A;  3VTD A;  2YHD A;  2ZVT A;  4OH6 A;  3OMO A;  2P15 A;  2Q7K A;  2I0J A;  1R5K A;  3AUN A;  1XP1 A;  4JGV A;  4CI5 A;  5DUG A;  2JJ3 A;  3OS8 A;  4G1D A;  3CLD A;  5DXR A;  2FAI A;  3ET0 A;  3R8D A;  3W5R A;  4OH5 A;  3W5Q A;  5APK A;  4IA2 A;  1XV9 B;  3K22 A;  4MDD A;  4OHA A;  2JFA A;  2OVH A;  4UDD A;  3PCU A;  4ZO1 B;  5G5W A;  3UP0 A;  5KCW A;  2PIP L;  5K13 A;  2ZNQ A;  4IV4 A;  4X1F A;  4ZNU A;  3AUR A;  2YFE A;  3B67 A;  4MG6 A;  2Q70 A;  1I37 A;  2GWX A;  5EI1 A;  3TKM A;  3DZY A;  1ILG A;  2Q59 B;  5L7H A;  1TFC A;  5L7G A;  2ZNN A;  3OS8 C;  1P93 A;  1NQ2 A;  2PJL A;  2YLP A;  3HC6 A;  3PBA A;  3R5N A;  4JYG A;  2HAS A;  5GIE A;  3VTC A;  3ET2 A;  4KZI A;  4MG9 B;  1NUO A;  4N73 A;  1XLS E;  1Y0X X;  4L98 A;  1RJK A;  2QZO B;  4OIV A;  5JJM A;  1Y9R A;  3IPS A;  3KMR A;  2P1V A;  1YA3 A;  4CI4 A;  3ERT A;  1U3Q A;  3W0C A;  5AAV B;  2GPP A;  3VSP A;  4MG9 A;  3OSW A;  1PK5 A;  4TUZ A;  2O4R A;  1XP9 A;  1Q4X A;  4LTW A;  4OJB A;  4RZG A;  1Z5X E;  3ADT A;  1NHZ A;  2ABI A;  2QA8 A;  3ET3 A;  1MV9 A;  1FCZ A;  5DUH A;  4XTA A;  2Q7L A;  3DCT A;  4K6I A;  4Y29 A;  5DTV A;  4IVY A;  5APJ A;  5KYA A;  2VV1 A;  2VV2 A;  3KYT A;  3NSQ A;  3OLS A;  4OEZ A;  4OJ4 A;  1DKF B;  3UVV A;  4PWL A;  2R40 D;  1E3G A;  5GIC A;  1WM0 X;  3E00 D;  2P1U A;  5DXG A;  5DKG A;  3N00 A;  2ZKC A;  2BJ4 B;  2AA2 A;  4J5W C;  2F4B A;  4LNX A;  5DKB A;  1UPV A;  3UU7 A;  4ZI1 A;  3HZF A;  1XJ7 A;  3W5T A;  1MZN A;  5E7V A;  4J24 A;  3RUU A;  5H1E A;  1GWR A;  2P54 A;  5DV6 A;  4JL4 A;  3CQV A;  3TY0 A;  1X76 A;  5DK9 A;  2R40 A;  5KRA A;  5ETH A;  3W0J A;  5DWG A;  2ZY0 A;  5KRL A;  2Q5S A;  1K74 D;  4ZN7 A;  4QL8 A;  3VJH A;  3V49 A;  3AZ3 A;  1R1K D;  4O8F A;  3VHV A;  4DM8 A;  4OEY A;  3K23 A;  1UOM A;  4OGH A;  4PVU A;  4HLW A;  1YYE A;  4YT1 A;  2J4A A;  4RZE A;  4P6W A;  4QM0 A;  3A9E A;  4E4Q A;  4MG7 B;  2V0V A;  2ZLA A;  1TXI A;  1K74 A;  4EMA A;  4G1Z A;  1T7M A;  3CJW A;  3A2H A;  5AYG A;  4DOR A;  1GWQ A;  1ZUC A;  4R06 A;  1P8D A;  3ZQT A;  2AMA A;  4DK8 A;  3ADS A;  3AX8 A;  3T03 A;  3GWS X;  2ZLC A;  1XAP A;  1I38 A;  3DZU A;  1LBD A;  4FGY A;  3ERD A;  1T65 A;  3Q95 B;  4J26 A;  4MG8 A;  4ONI A;  3WT7 A;  1PQ6 A;  2AA5 A;  2EWP A;  2ZK2 A;  1X7J A;  5DL4 A;  3VT7 A;  3UUD A;  4OZT U;  1FCX A;  1T76 A;  2ZMI A;  5FQV A;  3B0Q A;  3CTB A;  5GT4 A;  5HJS A;  1I7G A;  2QXM A;  3KFC A;  4DOS A;  3B68 A;  3IXP D;  4S14 A;  5SYZ A;  3R8I A;  3B66 A;  3A3Z X;  1QKM A;  1KNU A;  2HFP A;  3CDP A;  3PEQ A;  3FAL B;  4WHG A;  2HWQ A;  5DXB A;  5DY8 A;  3OLL A;  4DK7 A;  2HAR A;  5KRJ A;  4ZN9 A;  3E94 A;  4OED A;  5FQT A;  2PIR A;  2ZK3 A;  5KR9 A;  3A2J A;  4YMQ A;  1RKH A;  1T5Z A;  4YPQ A;  3VT9 A;  2Q61 A;  3JZC A;  3KDT A;  3OKI A;  2NXX A;  4QE8 A;  5DMC A;  2XYX A;  3FAL A;  3G0W A;  5EIT A;  2PKL A;  5DIE A;  3IXP A;  5DKS A;  1OVL B;  2POG A;  2QGW A;  1ZEO A;  4TV1 A;  2OCF A;  2PRG A;  2REW A;  1U3S A;  2E2R A;  3L0E A;  4QK4 A;  3BC5 A;  5IZ0 A;  3D24 A;  5KCD A;  4ZOM A;  1UPW A;  1FCY A;  1T7T A;  4IU7 A;  1NRL A;  3VRT A;  2PIV A;  4OZR U;  5G3J A;  4E4K A;  3HLV A;  2ZK1 A;  3W0A A;  1YIN A;  3L0J A;  5AZT A;  4IVW A;  4EM9 A;  1GWX A;  4REF A;  2AA6 A;  1ERE A;  3OMM A;  4PLE A;  3V9Y A;  2JFA B;  2YLO A;  1OSV A;  2ZMH A;  3DY6 A;  3B3K A;  4X1G A;  3L0L A;  3VTB A;  3PLZ A;  1PZL A;  2Q7I A;  1L2J A;  3P88 A;  3DZY D;  1NQ7 A;  2Q6S A;  5ICK A;  5AZV A;  3DT3 A;  2Q1V A;  3OKH A;  5KRF A;  5I4V A;  5C4T A;  5KRO A;  2G0G A;  3GN8 A;  2XYW A;  1U9E A;  2YLY A;  5DWE A;  1I7I A;  1T74 A;  3GYT A;  4FHH A;  5DVC A;  5AVI A;  3E7C A;  4B7W A;  3ADU A;  2AWH A;  1HG4 A;  2GPV A;  2OVM A;  5EGV A;  5KD9 A;  2POB A;  5JJM B;  2FVJ A;  4S15 A;  1NAV A;  2OUZ A;  1G2N A;  3AFR A;  4FHI A;  3KWY A;  1N4H A;  5G46 A;  3DCU A;  1U3R A;  1XQ3 A;  2B50 A;  5APH A;  2BAW A;  1XOW A;  2HC4 A;  4TUZ B;  2Q60 A;  4MGA A;  4ZNH A;  5KCF A;  3A40 X;  4PF3 A;  2QA8 B;  2ZXZ A;  2B1Z A;  2P4Y A;  2QPY A;  1XDK A;  2PIW A;  5DX3 A;  5E15 A;  4WLB A;  4PXM A;  2VV1 B;  2YJA B;  2QW4 A;  2GL8 A;  2ZFX A;  3UVV B;  2H79 A;  5AAU A;  3WMH A;  2AX8 A;  1Y0S A;  4KZJ A;  4IW6 A;  5HYK A;  2ZK6 A;  3D5F A;  3HVL A;  4HEE X;  4IA3 A;  2QH6 A;  3VRV A;  2GPO A;  3VT5 A;  3WFG A;  3UU7 B;  1UHL A;  5DWJ A;  3PO9 A;  1A52 A;  4POH A;  5G42 A;  3M7R A;  5E0W A;  1XVP A;  5KRI A;  4JYI A;  2GPU A;  3X1I A;  3W5P A;  1H9U A;  4OFR A;  3WJ4 A;  2VV3 A;  3X36 A;  3IMY A;  4RWV A;  4RME A;  3MNP A;  3VJS A;  3VI8 A;  5DI7 A;  1X7E A;  5E19 A;  4A2J A;  5DZ0 A;  5FQS A;  3UUA B;  2ZNP A;  4CSJ A;  5DRM A;  3R8A A;  3H0A A;  5B5B A;  3VT4 A;  2P1T A;  2XKW A;  5DSH A;  2JF9 A;  1R20 D;  5DYB A; 
#chains in the Genus database with same CATH homology
 4PLD A;  4IQR A;  2QSE A;  2PIX A;  1EXA A;  3H52 A;  2ZK0 A;  1T63 A;  3A9E B;  3MNE A;  4RMC A;  3UUA A;  4XUM A;  3MNO A;  2P7G A;  3GZ9 A;  3IPQ A;  1PQC A;  3CS8 A;  1XIU A;  2ZXN A;  1BSX A;  1XNX A;  3GD2 A;  1FM9 D;  3CS4 A;  5EJV A;  3DZU D;  1R20 A;  5B41 A;  2NV7 A;  4RZF A;  3UUC A;  3KMZ A;  1OT7 A;  4MGB A;  1YMT A;  2OM9 A;  4FNE A;  4R2U A;  5L11 A;  5F9B A;  5E14 A;  5C4U A;  3VN2 A;  3WFF A;  3BEJ A;  1QKN A;  4IUI A;  4MG5 A;  3HQ5 A;  4N5G A;  5GID A;  3JZB A;  1X7B A;  4ZJW A;  5HJP A;  4MG8 B;  2AX9 A;  4WVD A;  5DZH A;  5DWL A;  3W0G A;  4APU A;  3UUD B;  1FM9 A;  1NDE A;  2QE4 A;  1N83 A;  4S0S A;  3WWR A;  1FM6 D;  4Q13 A;  4G2I A;  5AVL A;  1YJE A;  3KDU A;  5HCV A;  5HZC A;  2ZXM A;  2J7X A;  3B1M A;  1T73 A;  2PNU A;  2VV4 A;  3D6D A;  5DXB B;  2GIU A;  1RDT D;  5DV3 A;  3ZRA A;  5FQP A;  4DM6 A;  3VJI A;  1PQ9 A;  3L3X A;  5G43 A;  3FC6 A;  3G8I A;  1FM6 A;  2YJD A;  4R6S A;  5KRH A;  2G5O A;  4XHD A;  2HVC A;  3WT5 A;  3AZ2 A;  2HB8 A;  4RFW A;  4IWC A;  3OS9 A;  1KV6 A;  2AX7 A;  5DIG A;  1ZDT A;  1ZKY A;  3SP9 A;  4TV1 B;  1RDT A;  3LBD A;  2Q7J A;  4OZR E;  2HCD A;  5E0X A;  4ZNS A;  5HYR A;  1XLS A;  5IXK A;  4OAR A;  5KRK A;  3B65 A;  1L2I A;  4OJ9 A;  4F9M A;  2I4P A;  2ZK5 A;  3O1D A;  3P0U A;  4QE6 A;  2VST A;  3GBK A;  4JAZ A;  5AWK A;  2AMB A;  1G5Y A;  3ADX A;  1XZX X;  2R6Y A;  3X31 A;  2IHQ A;  3FUG A;  4M8H A;  4NY9 A;  5DUE A;  1XQC A;  2FSZ A;  3S9S A;  2PIO A;  5DLR A;  3V4A A;  3KBA A;  4REE A;  2Q5P A;  1SR7 A;  4N8R A;  3V9V A;  3OLF A;  2GP7 A;  4NQA B;  3OZJ A;  1SQN A;  5C4S A;  1NQ0 A;  2J14 A;  5DU5 A;  3VRU A;  3ADW A;  3IPU A;  3TKC A;  2NPA A;  4QJR A;  4IWF A;  4UDA A;  1T7R A;  1X78 A;  5DVS A;  2GTK A;  2AO6 A;  1DB1 A;  1S9Q A;  2HBH A;  1S0Z A;  2Q8S A;  4OKW A;  5DZ1 A;  5M96 A;  1HJ1 A;  2HWR A;  2Q1H A;  2QA6 A;  2ZNO A;  2XHS A;  3A78 A;  4RUP A;  4UDC A;  2QMV A;  2ACL A;  5JI0 D;  2P7A A;  5CJ6 A;  5DRJ A;  3OSA A;  3B0W A;  3W0Y A;  2A3I A;  5DXQ A;  1YOK A;  4KZM A;  4IV2 A;  4LSJ A;  1ZH7 A;  3V3Q A;  5E1C A;  2QAB A;  4MGA B;  4NIE A;  1R6G A;  4PP3 A;  3F5C B;  4XLD A;  5KCE A;  4K4J A;  1XDK B;  2ZK4 A;  1S9P A;  4UDB A;  1MVC A;  2AA7 A;  4LNW A;  4MGD A;  5DX3 B;  3X1H A;  5C4O A;  5G45 A;  1ZDU A;  4M8E A;  3FEI A;  4Q50 A;  5DVV A;  2B1V A;  3WTQ A;  3QT0 A;  1KKQ A;  5A86 A;  4G2H A;  3D90 A;  3HO0 A;  2W8Y A;  3F5C A;  4ZNW A;  3G8O A;  4LBD A;  2ATH A;  2O4J A;  2OZ7 A;  3RY9 A;  1YIM A;  3BQD A;  1UHL B;  3VSO A;  1YP0 A;  4WHF A;  5EHJ A;  3OOF A;  3PRG A;  1XVP B;  3L03 A;  1S19 A;  5KRM A;  2H77 A;  2Z4B A;  3CWD A;  4WQP A;  5DYD A;  4PRG A;  1XV9 A;  5DP0 A;  3ZRB A;  2Q3Y A;  5KCT A;  3FXV A;  3AN3 A;  5G44 A;  3SP6 A;  3VT3 A;  3H0A D;  5AWJ A;  1VJB A;  2QNV A;  4G21 A;  3WJ5 A;  3NOA A;  3HM1 A;  4L96 A;  5L7E A;  1T7F A;  1N46 A;  2NXX E;  2QTU A;  2PIQ A;  2Q59 A;  2Q5G A;  3OAP A;  1YUC A;  4OEA A;  2VV0 A;  3RVF A;  3ZR7 A;  5KCU A;  1A28 A;  4PPS A;  2P7Z A;  5DXE A;  3UP3 A;  4E2J A;  5IAW A;  4S0T A;  3DR1 A;  4J5W A;  4JYH A;  2NW4 A;  2QZO A;  3FUR A;  2Q6R A;  3OGT A;  5FQR A;  4DQM A;  3B0T A;  4WPF A;  2XYJ A;  1GS4 A;  3GWX A;  1YY4 A;  4G1Y A;  3OMP A;  1FD0 A;  2YLQ A;  3OZ0 A;  5AAV A;  3VJT A;  4ZJR A;  4MGB B;  4FN9 A;  4ZNV A;  3VT8 A;  3AUQ A;  3VT6 A;  3OOK A;  5DXP A;  1XNN A;  5DXM A;  1RK3 A;  3HOD A;  4IA1 A;  5HJP B;  1ILH A;  1Z5X U;  4K7A A;  4OC7 A;  2HB7 A;  1ZGY A;  3OMQ A;  1M7W A;  1NAX A;  1DKF A;  2AAX A;  3VHW A;  2AM9 A;  1SJ0 A;  5DKE A;  3W0H A;  3OSI A;  2PIU A;  4OZT E;  2BJ4 A;  3OMK A;  4RMD A;  2VV4 B;  1RKG A;  5DZI A;  1EXX A;  3WT6 A;  5LWP A;  3E00 A;  1M13 A;  3KPZ A;  2ZAS A;  4P6X A;  3W0I A;  3FEJ A;  3NSP A;  3P8X A;  4J5X A;  4A4V A;  3FC6 B;  1K4W A;  3AZ1 A;  3VHU A;  3SZ1 A;  2ZBS A;  3TX7 B;  3KMG A;  2V7C A;  3CS6 A;  3RUT A;  2G0H A;  1FBY A;  1IE9 A;  2J7Y A;  4OLM A;  4IA7 A;  2AXA A;  3L3Z A;  1Z95 A;  4N1Y A;  5DXK A;  1NYX A;  5DWI A;  1XPC A;  3LMP A;  4OKB A;  2AYR A;  5DV8 A;  3K8S A;  3R5M A;  1QKT A;  2HAM A;  3B5R A;  5DZ3 A;  2PIT A;  4PP5 A;  1R1K A;  4IW8 A;  4XT9 A;  4YNK A;  5EC9 A;  4J5X C;  1S0X A;  1G50 A;  3RLL A;  4XAO A;  2R6W A;  2O9I A;  1E3K A;  2IOK A;  2YAT A;  5KRC A;  4XI3 A;  1PDU A;  1XB7 A;  4MG7 A;  3B0R A;  1LV2 A;  2QXS A;  3GYU A;  3VRW A;  4A4W A;  3D57 A;  4ZNT A;  1ZAF A;  4MGC A;  5DID A;  3F7D A;  4ZO1 X;  3U9Q A;  4ITE A;  3CDS A;  1OSH A;  1XP6 A;  4OFU A;  1QKU A;  2ZMJ A;  3R2A A;  4IS8 A;  4XUH A;  4G20 A;  1PRG A;  5JY3 A;  1YOW A;  3G9E A;  3V9T A;  1T79 A;  2QR9 A;  2LBD A;  4RUJ A;  2QGT A;  4NUF A;  2Q6J A;  4RUO X;  2B23 A;  4OKX A;  2I4Z A;  3FS1 A;  3V3E A;  2IOG A;  5DMF A;  4OIL A;  3Q95 A;  4OKT A;  4Q0A C;  5KCC A;  2ZL9 A;  2AX6 A;  3ADV A;  5KYJ A;  3EYB A;  3AN4 A;  3FLI A;  3A2I A;  5AK2 A;  2PIN A;  4PP6 A;  3WGP A;  1SKX A;  2ACL B;  4BCR A;  3HC5 A;  1ERR A;  2VSR A;  2AB2 A;  3P89 A;  2I4J A;  5ACC A;  3O1E A;  1K7L A;  3R29 A;  4DMA A;  1PCG A;  3ET1 A;  5LGA A;  4OK1 A;  1G1U A;  1IE8 A;  1M2Z A;  3L1B A;  4POJ A;  4PPP A;  4RE8 A;  2OAX A;  4NB6 A;  3IA6 A;  2G44 A;  4OIU A;  4ITF A;  4MGD B;  1OVL A;  3RLJ A;  2Z4J A;  1NQ1 A;  1X7R A;  2I0G A;  4RAK A;  3K6P A;  3ILZ A;  3VTD A;  2YHD A;  2ZVT A;  4OH6 A;  3OMO A;  2P15 A;  2Q7K A;  2I0J A;  1R5K A;  3AUN A;  1XP1 A;  4JGV A;  4CI5 A;  5DUG A;  2JJ3 A;  3OS8 A;  4G1D A;  3CLD A;  5DXR A;  2FAI A;  3ET0 A;  3R8D A;  3W5R A;  4OH5 A;  3W5Q A;  5APK A;  4IA2 A;  1XV9 B;  3K22 A;  4MDD A;  4OHA A;  2JFA A;  2OVH A;  4UDD A;  3PCU A;  4ZO1 B;  5G5W A;  3UP0 A;  5KCW A;  2PIP L;  5K13 A;  2ZNQ A;  4IV4 A;  4X1F A;  4ZNU A;  3AUR A;  2YFE A;  3B67 A;  4MG6 A;  2Q70 A;  1I37 A;  2GWX A;  5EI1 A;  3TKM A;  3DZY A;  1ILG A;  2Q59 B;  5L7H A;  1TFC A;  5L7G A;  2ZNN A;  3OS8 C;  1P93 A;  1NQ2 A;  2PJL A;  2YLP A;  3HC6 A;  3PBA A;  3R5N A;  4JYG A;  2HAS A;  5GIE A;  3VTC A;  3ET2 A;  4KZI A;  4MG9 B;  1NUO A;  4N73 A;  1XLS E;  1Y0X X;  4L98 A;  1RJK A;  2QZO B;  4OIV A;  5JJM A;  1Y9R A;  3IPS A;  3KMR A;  2P1V A;  1YA3 A;  4CI4 A;  3ERT A;  1U3Q A;  3W0C A;  5AAV B;  2GPP A;  3VSP A;  4MG9 A;  3OSW A;  1PK5 A;  4TUZ A;  2O4R A;  1XP9 A;  1Q4X A;  4LTW A;  4OJB A;  4RZG A;  1Z5X E;  3ADT A;  1NHZ A;  2ABI A;  2QA8 A;  3ET3 A;  1MV9 A;  1FCZ A;  5DUH A;  4XTA A;  2Q7L A;  3DCT A;  4K6I A;  4Y29 A;  5DTV A;  4IVY A;  5APJ A;  5KYA A;  2VV1 A;  2VV2 A;  3KYT A;  3NSQ A;  3OLS A;  4OEZ A;  4OJ4 A;  1DKF B;  3UVV A;  4PWL A;  2R40 D;  1E3G A;  5GIC A;  1WM0 X;  3E00 D;  2P1U A;  5DXG A;  5DKG A;  3N00 A;  2ZKC A;  2BJ4 B;  2AA2 A;  4J5W C;  2F4B A;  4LNX A;  5DKB A;  1UPV A;  3UU7 A;  4ZI1 A;  3HZF A;  1XJ7 A;  3W5T A;  1MZN A;  5E7V A;  4J24 A;  3RUU A;  5H1E A;  1GWR A;  2P54 A;  5DV6 A;  4JL4 A;  3CQV A;  3TY0 A;  1X76 A;  5DK9 A;  2R40 A;  5KRA A;  5ETH A;  3W0J A;  5DWG A;  2ZY0 A;  5KRL A;  2Q5S A;  1K74 D;  4ZN7 A;  4QL8 A;  3VJH A;  3V49 A;  3AZ3 A;  1R1K D;  4O8F A;  3VHV A;  4DM8 A;  4OEY A;  3K23 A;  1UOM A;  4OGH A;  4PVU A;  4HLW A;  1YYE A;  4YT1 A;  2J4A A;  4RZE A;  4P6W A;  4QM0 A;  3A9E A;  4E4Q A;  4MG7 B;  2V0V A;  2ZLA A;  1TXI A;  1K74 A;  4EMA A;  4G1Z A;  1T7M A;  3CJW A;  3A2H A;  5AYG A;  4DOR A;  1GWQ A;  1ZUC A;  4R06 A;  1P8D A;  3ZQT A;  2AMA A;  4DK8 A;  3ADS A;  3AX8 A;  3T03 A;  3GWS X;  2ZLC A;  1XAP A;  1I38 A;  3DZU A;  1LBD A;  4FGY A;  3ERD A;  1T65 A;  3Q95 B;  4J26 A;  4MG8 A;  4ONI A;  3WT7 A;  1PQ6 A;  2AA5 A;  2EWP A;  2ZK2 A;  1X7J A;  5DL4 A;  3VT7 A;  3UUD A;  4OZT U;  1FCX A;  1T76 A;  2ZMI A;  5FQV A;  3B0Q A;  3CTB A;  5GT4 A;  5HJS A;  1I7G A;  2QXM A;  3KFC A;  4DOS A;  3B68 A;  3IXP D;  4S14 A;  5SYZ A;  3R8I A;  3B66 A;  3A3Z X;  1QKM A;  1KNU A;  2HFP A;  3CDP A;  3PEQ A;  3FAL B;  4WHG A;  2HWQ A;  5DXB A;  5DY8 A;  3OLL A;  4DK7 A;  2HAR A;  5KRJ A;  4ZN9 A;  3E94 A;  4OED A;  5FQT A;  2PIR A;  2ZK3 A;  5KR9 A;  3A2J A;  4YMQ A;  1RKH A;  1T5Z A;  4YPQ A;  3VT9 A;  2Q61 A;  3JZC A;  3KDT A;  3OKI A;  2NXX A;  4QE8 A;  5DMC A;  2XYX A;  3FAL A;  3G0W A;  5EIT A;  2PKL A;  5DIE A;  3IXP A;  5DKS A;  1OVL B;  2POG A;  2QGW A;  1ZEO A;  4TV1 A;  2OCF A;  2PRG A;  2REW A;  1U3S A;  2E2R A;  3L0E A;  4QK4 A;  3BC5 A;  5IZ0 A;  3D24 A;  5KCD A;  4ZOM A;  1UPW A;  1FCY A;  1T7T A;  4IU7 A;  1NRL A;  3VRT A;  2PIV A;  4OZR U;  5G3J A;  4E4K A;  3HLV A;  2ZK1 A;  3W0A A;  1YIN A;  3L0J A;  5AZT A;  4IVW A;  4EM9 A;  1GWX A;  4REF A;  2AA6 A;  1ERE A;  3OMM A;  4PLE A;  3V9Y A;  2JFA B;  2YLO A;  1OSV A;  2ZMH A;  3DY6 A;  3B3K A;  4X1G A;  3L0L A;  3VTB A;  3PLZ A;  1PZL A;  2Q7I A;  1L2J A;  3P88 A;  3DZY D;  1NQ7 A;  2Q6S A;  5ICK A;  5AZV A;  3DT3 A;  2Q1V A;  3OKH A;  5KRF A;  5I4V A;  5C4T A;  5KRO A;  2G0G A;  3GN8 A;  2XYW A;  1U9E A;  2YLY A;  5DWE A;  1I7I A;  1T74 A;  3GYT A;  4FHH A;  5DVC A;  5AVI A;  3E7C A;  4B7W A;  3ADU A;  2AWH A;  1HG4 A;  2GPV A;  2OVM A;  5EGV A;  5KD9 A;  2POB A;  5JJM B;  2FVJ A;  4S15 A;  1NAV A;  2OUZ A;  1G2N A;  3AFR A;  4FHI A;  3KWY A;  1N4H A;  5G46 A;  3DCU A;  1U3R A;  1XQ3 A;  2B50 A;  5APH A;  2BAW A;  1XOW A;  2HC4 A;  4TUZ B;  2Q60 A;  4MGA A;  4ZNH A;  5KCF A;  3A40 X;  4PF3 A;  2QA8 B;  2ZXZ A;  2B1Z A;  2P4Y A;  2QPY A;  1XDK A;  2PIW A;  5DX3 A;  5E15 A;  4WLB A;  4PXM A;  2VV1 B;  2YJA B;  2QW4 A;  2GL8 A;  2ZFX A;  3UVV B;  2H79 A;  5AAU A;  3WMH A;  2AX8 A;  1Y0S A;  4KZJ A;  4IW6 A;  5HYK A;  2ZK6 A;  3D5F A;  3HVL A;  4HEE X;  4IA3 A;  2QH6 A;  3VRV A;  2GPO A;  3VT5 A;  3WFG A;  3UU7 B;  1UHL A;  5DWJ A;  3PO9 A;  1A52 A;  4POH A;  5G42 A;  3M7R A;  5E0W A;  1XVP A;  5KRI A;  4JYI A;  2GPU A;  3X1I A;  3W5P A;  1H9U A;  4OFR A;  3WJ4 A;  2VV3 A;  3X36 A;  3IMY A;  4RWV A;  4RME A;  3MNP A;  3VJS A;  3VI8 A;  5DI7 A;  1X7E A;  5E19 A;  4A2J A;  5DZ0 A;  5FQS A;  3UUA B;  2ZNP A;  4CSJ A;  5DRM A;  3R8A A;  3H0A A;  5B5B A;  3VT4 A;  2P1T A;  2XKW A;  5DSH A;  2JF9 A;  1R20 D;  5DYB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...