5IXKA

Rorgamma in complex with inverse agonist bio399.
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
219
structure length
219
Chain Sequence
EIEHLVQSVCKSYRETCQLRLEDLLRQRSNIFSREEVTGYQRKSMWEMWERCAHHLTEAIQYVVEFAKRLSGFMELCQNDQIVLLKAGAMEVVLVRMCRAYNADNRTVFFEGKYGGMELFRALGCSELISSIFDFSHSLSALHFSEDEIALYTALVLINAHRPGLQEKRKVEQLQYNLELAFHHHLCKTHRQSILAKLPPKGKLRSLCSQHVERLQIFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Immune system
molecule keywords Nuclear receptor ROR-gamma
publication title Structural determinant for inducing RORgamma specific inverse agonism triggered by a synthetic benzoxazinone ligand.
pubmed doi rcsb
source organism Homo sapiens
total genus 84
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-03-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 5ixkA00
3ET0A 2AB2A 4G21A 3CQVA 1P8DA 2ATHA 2REWA 5LGAA 2Q5SA 2J7XA 3UUAB 2NXXE 3KBAA 1XDKA 5DMCA 5H1EA 2V0VA 3WTQA 4REEA 4JGVA 2ZLCA 4QK4A 4X1FA 4M8HA 4DK8A 1S19A 1EXXA 3VRTA 5JY3A 3UP0A 3P89A 2P4YA 4M8EA 2R40D 4IWCA 4N8RA 1RJKA 3VT5A 2BAWA 2PIWA 3IPQA 5FQPA 5KRJA 4OHAA 2P1UA 1Q4XA 4PRGA 4PPSA 3TY0A 4IQRA 3BC5A 2QH6A 4HEEX 1I7GA 1X7EA 3OMQA 4MDDA 5L11A 3R8AA 2R6WA 2YJDA 3A3ZX 5HZCA 2HWRA 3MNOA 5DWJA 1L2IA 1NDEA 5DZHA 3RLLA 3UP3A 2QGTA 2VSRA 4MG8A 2GPUA 4PVUA 2AA5A 3FLIA 3H0AD 2Q1VA 3HVLA 2PITA 2GP7A 3VI8A 3WGPA 3OKHA 3VT9A 2OVHA 3G0WA 5C4TA 5KRLA 4FGYA 3WFGA 1ZEOA 4DM6A 3HZFA 1IE9A 1RKGA 5KRMA 1XQCA 4NY9A 3B0QA 4IV2A 5L7GA 1KV6A 2OCFA 5KCTA 2B23A 4J5WA 3KMRA 5APJA 4LNXA 5SYZA 3W0IA 1ZDUA 1XB7A 3W0YA 2O9IA 1P93A 5E1CA 5EJVA 3W5RA 1PQ9A 1R5KA 4ZNHA 4JAZA 3KMGA 5DWGA 5DUHA 5DIDA 1ZAFA 1YMTA 1I38A 2QMVA 4UDBA 5KCCA 3MNPA 1FCYA 2EWPA 1M7WA 2Q5GA 4OFUA 5DXGA 5HJSA 4R6SA 2AX9A 3VHWA 3VN2A 5KRCA 5CJ6A 5EI1A 1S9PA 3W5TA 3FEIA 2HCDA 2I0GA 3O1EA 3HC5A 4E2JA 4QJRA 4TV1B 4P6XA 4OLMA 1SKXA 1FM6D 1I7IA 1Y0SA 2AMAA 1RDTD 3OSWA 3F7DA 2VV0A 4S14A 4TUZA 1L2JA 5GICA 3V3QA 1NQ0A 1YJEA 2O4RA 1OT7A 4G1YA 4OZRU 3RUUA 2I4ZA 5DXBB 2QTUA 1S0XA 1X78A 2JF9A 1R20D 2P7AA 2PRGA 1E3GA 3ADSA 3E94A 1X76A 3L03A 4KZIA 4XT9A 5DY8A 5AAVA 2VV1A 1G2NA 4RFWA 3SZ1A 1R1KA 3HM1A 2HB8A 3OMMA 1NHZA 3OMPA 2G44A 1I37A 2B1VA 4OJBA 3V49A 1GWRA 2YJAB 4A2JA 3A2JA 3SP6A 3DZYD 4ZI1A 1PZLA 5FQTA 3GWSX 4OH5A 3VTBA 2QXSA 1U3RA 3LBDA 2NW4A 3D6DA 5KR9A 3ADTA 1VJBA 1G50A 2Q7IA 2ZNOA 3NSPA 4IA3A 4L96A 4UDDA 2HASA 5AVIA 5C4OA 3WT6A 3E00D 3B67A 3DCTA 5C4UA 4ZNTA 4PP3A 5E0XA 5KYJA 5I4VA 3A2IA 1K4WA 2ZNQA 3K6PA 3B5RA 4TUZB 3DZUA 4N73A 5GIDA 1OVLA 1H9UA 4N1YA 4EM9A 2ZK5A 3DR1A 4IU7A 5DKSA 5AAVB 2ZK3A 2XHSA 1RKHA 1R6GA 2V7CA 2VV1B 3WJ5A 3VJIA 3CWDA 3DT3A 3B1MA 3OGTA 4Q13A 3IA6A 2I0JA 4OILA 4O8FA 4OKBA 2OVMA 3GWXA 3UUAA 2HARA 5DZ0A 3G8IA 2ZMJA 2ZK6A 4OKXA 5IAWA 2Q6JA 5DU5A 2ACLB 4RUJA 2PINA 3IXPA 1T73A 4IA1A 4KZJA 4N5GA 4P6WA 5JJMB 1K74D 1PQ6A 2I4PA 4ITFA 5DIGA 5JI0D 2ZKCA 3AUQA 3V9TA 3ZRBA 4OJ4A 3PO9A 4MG6A 1QKUA 4XI3A 4R06A 1OVLB 3VJHA 5G45A 2XYJA 4WHGA 3KMZA 4OC7A 1T7TA 4OEYA 1Z95A 2AMBA 2R6YA 2Q7LA 4RE8A 3KDUA 1ZUCA 3OS9A 4IWFA 1NQ2A 1QKMA 3GYTA 2H77A 4XHDA 2G5OA 3ZQTA 4K6IA 3GD2A 2FSZA 1N46A 4G20A 5DZ3A 4EMAA 3N00A 4NQAB 3R5NA 5DUEA 2HC4A 4J5XC 4XUMA 3UUDA 1UPVA 4ZNUA 3WT5A 4MG9A 3P8XA 1S0ZA 4RMCA 3M7RA 1ILHA 2H79A 4HLWA 2GTKA 3ADXA 4IW8A 5E0WA 5EGVA 5DV3A 2Q6SA 2AA2A 2Q8SA 2QSEA 4YPQA 1RK3A 5K13A 2YLQA 5AVLA 1G5YA 3AZ1A 2Q70A 2G0HA 2YLPA 4ZO1X 1TFCA 3AZ3A 3L0LA 4A4VA 4E4KA 4WHFA 1Y0XX 4RMDA 2R40A 3A78A 3B0RA 3OS8C 2Q1HA 5KRFA 4POJA 1PQCA 5F9BA 1FBYA 4QE6A 4TV1A 2AX8A 5EITA 2AAXA 5KYAA 2QA6A 2QNVA 5E14A 3PRGA 3BEJA 1QKNA 3UUDB 1G1UA 5KRKA 4MG9B 3RUTA 2Q6RA 2J4AA 4OEZA 5DV6A 5DZIA 4WPFA 3OSAA 2QE4A 3H0AA 3K23A 3PLZA 5DXBA 1U9EA 5B41A 5LWPA 5GIEA 1FD0A 2QZOB 5KD9A 5DLRA 4Y29A 5DWEA 4RAKA 2VSTA 4ONIA 4B7WA 4S0TA 1ZGYA 2ZK1A 3L3ZA 2XKWA 2BJ4A 3RY9A 3D5FA 5A86A 5DVVA 2W8YA 2PIOA 3VRWA 4RUPA 1KNUA 2PKLA 4MGDA 2ZK2A 1FM9A 1GS4A 3D90A 3OLSA 4JYIA 4XTAA 3ZR7A 1SR7A 3AUNA 3PBAA 3ZRAA 1T7FA 4YNKA 5DKEA 3B0WA 1X7JA 2POBA 3Q95A 4IVWA 5KRIA 3UUCA 1N4HA 1DKFA 1NQ1A 3FURA 3WMHA 2PIUA 4PP5A 4NUFA 5DV8A 2VV2A 3L0EA 5DRMA 4OZRE 3VT8A 3T03A 2ZVTA 5KCDA 3OMKA 2GPOA 3A2HA 4S0SA 5G43A 2A3IA 4ZNWA 1RDTA 2AA7A 3DCUA 3TKCA 4R2UA 3O1DA 2QW4A 5ACCA 4RMEA 3ET1A 2ZXZA 2JFAA 3CS8A 5DKGA 1EREA 5E7VA 3VTDA 1N83A 5KRHA 2BJ4B 3B3KA 4OKTA 5EC9A 2ACLA 4FN9A 3WFFA 1XV9A 5HJPB 1ILGA 3R29A 4MGDB 5DVSA 4ZN7A 2ZXNA 3HODA 1NUOA 3NOAA 3QT0A 3WWRA 5JJMA 4IS8A 4RUOX 2ZNNA 3LMPA 5AYGA 1YINA 4XUHA 1DB1A 3VHVA 3Q95B 3AN4A 3OSIA 3EYBA 3E7CA 4J26A 1DKFB 3HO0A 3VHUA 2XYXA 3IPUA 3W5QA 2AWHA 2YFEA 4UDCA 3V3EA 3ERDA 2P7ZA 1T65A 3E00A 5DWIA 3HLVA 1XPCA 5DVCA 1YIMA 5DL4A 5DXQA 3DZUD 5L7EA 3H52A 4KZMA 1WM0X 1PCGA 1XOWA 3X1HA 1LBDA 3UU7A 5KRAA 2PIPL 2I4JA 1PDUA 1YOKA 4YMQA 2JFAB 5KCEA 3B65A 2GPPA 3GBKA 5G3JA 1PRGA 4PLEA 2YHDA 4J5XA 1XIUA 4PF3A 4ZO1B 2HB7A 2PIRA 1XV9B 5EHJA 2Q7KA 4PLDA 3F5CA 1XP6A 3OAPA 5ICKA 2P7GA 1ZKYA 1LV2A 1GWQA 1NQ7A 4LTWA 3P88A 1M2ZA 3PCUA 4IW6A 4QL8A 2Q7JA 2GL8A 3FS1A 3IXPD 2PIVA 4DM8A 2POGA 3D24A 3FALA 3W0HA 2PNUA 2VV3A 3RLJA 1K74A 1E3KA 2AX7A 2QXMA 2F4BA 5DRJA 2AX6A 3R8IA 1YP0A 3VT7A 4BCRA 1X7BA 2Z4JA 3UU7B 1YY4A 3OS8A 3PEQA 2NV7A 1XZXX 2E2RA 2ZXMA 2B50A 2JJ3A 3AURA 3CS6A 5DYBA 3FUGA 4RZGA 3VTCA 1ZH7A 4OZTU 2IOKA 1XP1A 3ADWA 3CLDA 3F5CB 4PPPA 3VRUA 4YT1A 2G0GA 5C4SA 3MNEA 3G8OA 3AN3A 1EXAA 1T7MA 1MZNA 4OKWA 5DMFA 2QZOA 1T76A 2Q3YA 2HBHA 3ILZA 1ERRA 4MGAA 2OM9A 2ZMIA 3FXVA 3VRVA 4ZJRA 5IXKA 3FALB 4WLBA 4DORA 4XAOA 3CDSA 5FQSA 3FC6A 3KWYA 5AAUA 4MGCA 5DZ1A 3A9EA 3R8DA 3OOKA 2QR9A 4OEAA 5B5BA 3V4AA 1U3QA 1Z5XU 2O4JA 3A40X 5DXKA 3VT3A 5G46A 5HCVA 1Z5XE 4E4QA 4APUA 4UDAA 3BQDA 2NPAA 4IVYA 3NSQA 1XNXA 5DXMA 5IZ0A 3RVFA 3KFCA 5DSHA 3P0UA 2Q5PA 3L3XA 3UVVA 3WJ4A 1MVCA 3S9SA 1YA3A 4MGBA 4NIEA 5ETHA 4ZJWA 1FCXA 4FHHA 4OK1A 1OSVA 5APHA 3W0AA 1XLSA 3OZ0A 3AFRA 2AO6A 3ERTA 1TXIA 3B0TA 3R5MA 5DUGA 1KKQA 1M13A 4MGAB 1UHLA 2FVJA 4PWLA 3JZCA 2Q60A 3CDPA 2AM9A 3GYUA 5DI7A 3FC6B 5HYKA 1XQ3A 2PJLA 3L0JA 4REFA 5DXRA 1T63A 3A9EB 1XDKB 2YLYA 4FHIA 4G1DA 1FCZA 5HJPA 1T5ZA 3CS4A 3OKIA 2Q61A 1YOWA 5DXEA 1SJ0A 1A28A 2GPVA 2IHQA 4MG5A 3CTBA 3VJSA 5DK9A 4Q0AC 1XLSE 3OLFA 3AX8A 3UVVB 4OFRA 4RZFA 1K7LA 3ADVA 4OARA 4QE8A 5DXPA 1FM9D 4MGBB 5AK2A 5APKA 3SP9A 4PP6A 3K22A 2OZ7A 1HG4A 2B1ZA 4OGHA 3B66A 4PXMA 3X1IA 3VT4A 4DK7A 1XVPA 4RZEA 4G2HA 3FEJA 1FM6A 4G2IA 4LBDA 5AZTA 3DY6A 3GN8A 4IUIA 4MG8B 4RWVA 4F9MA 1UHLB 1SQNA 1T74A 2AXAA 3ET2A 2GIUA 4DOSA 4WVDA 2ZMHA 1R20A 2PIXA 5DTVA 3L1BA 3R2AA 5FQVA 5G44A 1R1KD 2ABIA 4ZOMA 3VJTA 1MV9A 3KYTA 4ITEA 4IV4A 3IPSA 4J5WC 4CSJA 1YYEA 3W0GA 3VSOA 3ADUA 5AWKA 2P54A 5AWJA 5DYDA 2PIQA 3V9YA 3DZYA 2XYWA 1T7RA 1QKTA 2FAIA 2HFPA 2Z4BA 2GWXA 4OEDA 2QABA 5L7HA 4FNEA 4ZN9A 4OH6A 5FQRA 4CI5A 4ZNVA 4OIUA 4JYHA 2ZL9A 5DP0A 2QGWA 4XLDA 5GT4A 5KCUA 1X7RA 2J14A 1A52A 1BSXA 4MG7A 1NAXA 1XVPB 3K8SA 2P1TA 1NYXA 4S15A 1XJ7A 2ZBSA 1UOMA 2VV4A 3JZBA 5DX3A 2OAXA 3HQ5A 1YUCA 4ZNSA 5DIEA 3V9VA 3W5PA 3X36A 5DWLA 2Q59A 2ZLAA 2HAMA 1PK5A 5G42A 3VT6A 3OZJA 1ZDTA 4OJ9A 1XP9A 2ZNPA 4IA2A 4Q50A 5G5WA 2YLOA 1GWXA 2ZY0A 3IMYA 3OMOA 4K7AA 1HJ1A 1T79A 2QA8A 4POHA 5HYRA 4LNWA 3D57A 5M96A 2ZK0A 2AYRA 4OIVA 3OOFA 3W0CA 5E19A 2IOGA 2P15A 3KDTA 4JYGA 3TX7B 4IA7A 4G1ZA 5E15A 3ET3A 3WT7A 5KCWA 2AA6A 2HVCA 4J24A 1NRLA 4K4JA 3CJWA 2OUZA 1XNNA 4MG7B 3U9QA 5DX3B 2VV4B 2ZASA 2QPYA 3G9EA 3HC6A 2HWQA 1UPWA 2P1VA 3W0JA 5KROA 4WQPA 2NXXA 3B68A 2ZFXA 3TKMA 2Q59B 4CI4A 4QM0A 2ZK4A 3VSPA 3GZ9A 1S9QA 4DMAA 2YATA 4OZTE 1IE8A 1XAPA 4LSJA 1NAVA 3KPZA 5AZVA 4DQMA 1Y9RA 3AZ2A 2J7YA 3OLLA 5DKBA 1U3SA 2QA8B 5KCFA 4A4WA 4X1GA 4JL4A 2LBDA 4NB6A 1OSHA 4L98A 3X31A
chains in the Genus database with same CATH superfamily
3ET0A 2AB2A 4G21A 3CQVA 1P8DA 2ATHA 2REWA 5LGAA 2Q5SA 2J7XA 3UUAB 2NXXE 3KBAA 1XDKA 5DMCA 5H1EA 2V0VA 3WTQA 4REEA 4JGVA 2ZLCA 4QK4A 4X1FA 4M8HA 4DK8A 1S19A 1EXXA 3VRTA 5JY3A 3UP0A 3P89A 2P4YA 4M8EA 2R40D 4IWCA 4N8RA 1RJKA 3VT5A 2BAWA 2PIWA 3IPQA 5FQPA 5KRJA 4OHAA 2P1UA 1Q4XA 4PRGA 4PPSA 3TY0A 4IQRA 3BC5A 2QH6A 4HEEX 1I7GA 1X7EA 3OMQA 4MDDA 5L11A 3R8AA 2R6WA 2YJDA 3A3ZX 5HZCA 2HWRA 3MNOA 5DWJA 1L2IA 1NDEA 5DZHA 3RLLA 3UP3A 2QGTA 2VSRA 4MG8A 2GPUA 4PVUA 2AA5A 3FLIA 3H0AD 2Q1VA 3HVLA 2PITA 2GP7A 3VI8A 3WGPA 3OKHA 3VT9A 2OVHA 3G0WA 5C4TA 5KRLA 4FGYA 3WFGA 1ZEOA 4DM6A 3HZFA 1IE9A 1RKGA 5KRMA 1XQCA 4NY9A 3B0QA 4IV2A 5L7GA 1KV6A 2OCFA 5KCTA 2B23A 4J5WA 3KMRA 5APJA 4LNXA 5SYZA 3W0IA 1ZDUA 1XB7A 3W0YA 2O9IA 1P93A 5E1CA 5EJVA 3W5RA 1PQ9A 1R5KA 4ZNHA 4JAZA 3KMGA 5DWGA 5DUHA 5DIDA 1ZAFA 1YMTA 1I38A 2QMVA 4UDBA 5KCCA 3MNPA 1FCYA 2EWPA 1M7WA 2Q5GA 4OFUA 5DXGA 5HJSA 4R6SA 2AX9A 3VHWA 3VN2A 5KRCA 5CJ6A 5EI1A 1S9PA 3W5TA 3FEIA 2HCDA 2I0GA 3O1EA 3HC5A 4E2JA 4QJRA 4TV1B 4P6XA 4OLMA 1SKXA 1FM6D 1I7IA 1Y0SA 2AMAA 1RDTD 3OSWA 3F7DA 2VV0A 4S14A 4TUZA 1L2JA 5GICA 3V3QA 1NQ0A 1YJEA 2O4RA 1OT7A 4G1YA 4OZRU 3RUUA 2I4ZA 5DXBB 2QTUA 1S0XA 1X78A 2JF9A 1R20D 2P7AA 2PRGA 1E3GA 3ADSA 3E94A 1X76A 3L03A 4KZIA 4XT9A 5DY8A 5AAVA 2VV1A 1G2NA 4RFWA 3SZ1A 1R1KA 3HM1A 2HB8A 3OMMA 1NHZA 3OMPA 2G44A 1I37A 2B1VA 4OJBA 3V49A 1GWRA 2YJAB 4A2JA 3A2JA 3SP6A 3DZYD 4ZI1A 1PZLA 5FQTA 3GWSX 4OH5A 3VTBA 2QXSA 1U3RA 3LBDA 2NW4A 3D6DA 5KR9A 3ADTA 1VJBA 1G50A 2Q7IA 2ZNOA 3NSPA 4IA3A 4L96A 4UDDA 2HASA 5AVIA 5C4OA 3WT6A 3E00D 3B67A 3DCTA 5C4UA 4ZNTA 4PP3A 5E0XA 5KYJA 5I4VA 3A2IA 1K4WA 2ZNQA 3K6PA 3B5RA 4TUZB 3DZUA 4N73A 5GIDA 1OVLA 1H9UA 4N1YA 4EM9A 2ZK5A 3DR1A 4IU7A 5DKSA 5AAVB 2ZK3A 2XHSA 1RKHA 1R6GA 2V7CA 2VV1B 3WJ5A 3VJIA 3CWDA 3DT3A 3B1MA 3OGTA 4Q13A 3IA6A 2I0JA 4OILA 4O8FA 4OKBA 2OVMA 3GWXA 3UUAA 2HARA 5DZ0A 3G8IA 2ZMJA 2ZK6A 4OKXA 5IAWA 2Q6JA 5DU5A 2ACLB 4RUJA 2PINA 3IXPA 1T73A 4IA1A 4KZJA 4N5GA 4P6WA 5JJMB 1K74D 1PQ6A 2I4PA 4ITFA 5DIGA 5JI0D 2ZKCA 3AUQA 3V9TA 3ZRBA 4OJ4A 3PO9A 4MG6A 1QKUA 4XI3A 4R06A 1OVLB 3VJHA 5G45A 2XYJA 4WHGA 3KMZA 4OC7A 1T7TA 4OEYA 1Z95A 2AMBA 2R6YA 2Q7LA 4RE8A 3KDUA 1ZUCA 3OS9A 4IWFA 1NQ2A 1QKMA 3GYTA 2H77A 4XHDA 2G5OA 3ZQTA 4K6IA 3GD2A 2FSZA 1N46A 4G20A 5DZ3A 4EMAA 3N00A 4NQAB 3R5NA 5DUEA 2HC4A 4J5XC 4XUMA 3UUDA 1UPVA 4ZNUA 3WT5A 4MG9A 3P8XA 1S0ZA 4RMCA 3M7RA 1ILHA 2H79A 4HLWA 2GTKA 3ADXA 4IW8A 5E0WA 5EGVA 5DV3A 2Q6SA 2AA2A 2Q8SA 2QSEA 4YPQA 1RK3A 5K13A 2YLQA 5AVLA 1G5YA 3AZ1A 2Q70A 2G0HA 2YLPA 4ZO1X 1TFCA 3AZ3A 3L0LA 4A4VA 4E4KA 4WHFA 1Y0XX 4RMDA 2R40A 3A78A 3B0RA 3OS8C 2Q1HA 5KRFA 4POJA 1PQCA 5F9BA 1FBYA 4QE6A 4TV1A 2AX8A 5EITA 2AAXA 5KYAA 2QA6A 2QNVA 5E14A 3PRGA 3BEJA 1QKNA 3UUDB 1G1UA 5KRKA 4MG9B 3RUTA 2Q6RA 2J4AA 4OEZA 5DV6A 5DZIA 4WPFA 3OSAA 2QE4A 3H0AA 3K23A 3PLZA 5DXBA 1U9EA 5B41A 5LWPA 5GIEA 1FD0A 2QZOB 5KD9A 5DLRA 4Y29A 5DWEA 4RAKA 2VSTA 4ONIA 4B7WA 4S0TA 1ZGYA 2ZK1A 3L3ZA 2XKWA 2BJ4A 3RY9A 3D5FA 5A86A 5DVVA 2W8YA 2PIOA 3VRWA 4RUPA 1KNUA 2PKLA 4MGDA 2ZK2A 1FM9A 1GS4A 3D90A 3OLSA 4JYIA 4XTAA 3ZR7A 1SR7A 3AUNA 3PBAA 3ZRAA 1T7FA 4YNKA 5DKEA 3B0WA 1X7JA 2POBA 3Q95A 4IVWA 5KRIA 3UUCA 1N4HA 1DKFA 1NQ1A 3FURA 3WMHA 2PIUA 4PP5A 4NUFA 5DV8A 2VV2A 3L0EA 5DRMA 4OZRE 3VT8A 3T03A 2ZVTA 5KCDA 3OMKA 2GPOA 3A2HA 4S0SA 5G43A 2A3IA 4ZNWA 1RDTA 2AA7A 3DCUA 3TKCA 4R2UA 3O1DA 2QW4A 5ACCA 4RMEA 3ET1A 2ZXZA 2JFAA 3CS8A 5DKGA 1EREA 5E7VA 3VTDA 1N83A 5KRHA 2BJ4B 3B3KA 4OKTA 5EC9A 2ACLA 4FN9A 3WFFA 1XV9A 5HJPB 1ILGA 3R29A 4MGDB 5DVSA 4ZN7A 2ZXNA 3HODA 1NUOA 3NOAA 3QT0A 3WWRA 5JJMA 4IS8A 4RUOX 2ZNNA 3LMPA 5AYGA 1YINA 4XUHA 1DB1A 3VHVA 3Q95B 3AN4A 3OSIA 3EYBA 3E7CA 4J26A 1DKFB 3HO0A 3VHUA 2XYXA 3IPUA 3W5QA 2AWHA 2YFEA 4UDCA 3V3EA 3ERDA 2P7ZA 1T65A 3E00A 5DWIA 3HLVA 1XPCA 5DVCA 1YIMA 5DL4A 5DXQA 3DZUD 5L7EA 3H52A 4KZMA 1WM0X 1PCGA 1XOWA 3X1HA 1LBDA 3UU7A 5KRAA 2PIPL 2I4JA 1PDUA 1YOKA 4YMQA 2JFAB 5KCEA 3B65A 2GPPA 3GBKA 5G3JA 1PRGA 4PLEA 2YHDA 4J5XA 1XIUA 4PF3A 4ZO1B 2HB7A 2PIRA 1XV9B 5EHJA 2Q7KA 4PLDA 3F5CA 1XP6A 3OAPA 5ICKA 2P7GA 1ZKYA 1LV2A 1GWQA 1NQ7A 4LTWA 3P88A 1M2ZA 3PCUA 4IW6A 4QL8A 2Q7JA 2GL8A 3FS1A 3IXPD 2PIVA 4DM8A 2POGA 3D24A 3FALA 3W0HA 2PNUA 2VV3A 3RLJA 1K74A 1E3KA 2AX7A 2QXMA 2F4BA 5DRJA 2AX6A 3R8IA 1YP0A 3VT7A 4BCRA 1X7BA 2Z4JA 3UU7B 1YY4A 3OS8A 3PEQA 2NV7A 1XZXX 2E2RA 2ZXMA 2B50A 2JJ3A 3AURA 3CS6A 5DYBA 3FUGA 4RZGA 3VTCA 1ZH7A 4OZTU 2IOKA 1XP1A 3ADWA 3CLDA 3F5CB 4PPPA 3VRUA 4YT1A 2G0GA 5C4SA 3MNEA 3G8OA 3AN3A 1EXAA 1T7MA 1MZNA 4OKWA 5DMFA 2QZOA 1T76A 2Q3YA 2HBHA 3ILZA 1ERRA 4MGAA 2OM9A 2ZMIA 3FXVA 3VRVA 4ZJRA 5IXKA 3FALB 4WLBA 4DORA 4XAOA 3CDSA 5FQSA 3FC6A 3KWYA 5AAUA 4MGCA 5DZ1A 3A9EA 3R8DA 3OOKA 2QR9A 4OEAA 5B5BA 3V4AA 1U3QA 1Z5XU 2O4JA 3A40X 5DXKA 3VT3A 5G46A 5HCVA 1Z5XE 4E4QA 4APUA 4UDAA 3BQDA 2NPAA 4IVYA 3NSQA 1XNXA 5DXMA 5IZ0A 3RVFA 3KFCA 5DSHA 3P0UA 2Q5PA 3L3XA 3UVVA 3WJ4A 1MVCA 3S9SA 1YA3A 4MGBA 4NIEA 5ETHA 4ZJWA 1FCXA 4FHHA 4OK1A 1OSVA 5APHA 3W0AA 1XLSA 3OZ0A 3AFRA 2AO6A 3ERTA 1TXIA 3B0TA 3R5MA 5DUGA 1KKQA 1M13A 4MGAB 1UHLA 2FVJA 4PWLA 3JZCA 2Q60A 3CDPA 2AM9A 3GYUA 5DI7A 3FC6B 5HYKA 1XQ3A 2PJLA 3L0JA 4REFA 5DXRA 1T63A 3A9EB 1XDKB 2YLYA 4FHIA 4G1DA 1FCZA 5HJPA 1T5ZA 3CS4A 3OKIA 2Q61A 1YOWA 5DXEA 1SJ0A 1A28A 2GPVA 2IHQA 4MG5A 3CTBA 3VJSA 5DK9A 4Q0AC 1XLSE 3OLFA 3AX8A 3UVVB 4OFRA 4RZFA 1K7LA 3ADVA 4OARA 4QE8A 5DXPA 1FM9D 4MGBB 5AK2A 5APKA 3SP9A 4PP6A 3K22A 2OZ7A 1HG4A 2B1ZA 4OGHA 3B66A 4PXMA 3X1IA 3VT4A 4DK7A 1XVPA 4RZEA 4G2HA 3FEJA 1FM6A 4G2IA 4LBDA 5AZTA 3DY6A 3GN8A 4IUIA 4MG8B 4RWVA 4F9MA 1UHLB 1SQNA 1T74A 2AXAA 3ET2A 2GIUA 4DOSA 4WVDA 2ZMHA 1R20A 2PIXA 5DTVA 3L1BA 3R2AA 5FQVA 5G44A 1R1KD 2ABIA 4ZOMA 3VJTA 1MV9A 3KYTA 4ITEA 4IV4A 3IPSA 4J5WC 4CSJA 1YYEA 3W0GA 3VSOA 3ADUA 5AWKA 2P54A 5AWJA 5DYDA 2PIQA 3V9YA 3DZYA 2XYWA 1T7RA 1QKTA 2FAIA 2HFPA 2Z4BA 2GWXA 4OEDA 2QABA 5L7HA 4FNEA 4ZN9A 4OH6A 5FQRA 4CI5A 4ZNVA 4OIUA 4JYHA 2ZL9A 5DP0A 2QGWA 4XLDA 5GT4A 5KCUA 1X7RA 2J14A 1A52A 1BSXA 4MG7A 1NAXA 1XVPB 3K8SA 2P1TA 1NYXA 4S15A 1XJ7A 2ZBSA 1UOMA 2VV4A 3JZBA 5DX3A 2OAXA 3HQ5A 1YUCA 4ZNSA 5DIEA 3V9VA 3W5PA 3X36A 5DWLA 2Q59A 2ZLAA 2HAMA 1PK5A 5G42A 3VT6A 3OZJA 1ZDTA 4OJ9A 1XP9A 2ZNPA 4IA2A 4Q50A 5G5WA 2YLOA 1GWXA 2ZY0A 3IMYA 3OMOA 4K7AA 1HJ1A 1T79A 2QA8A 4POHA 5HYRA 4LNWA 3D57A 5M96A 2ZK0A 2AYRA 4OIVA 3OOFA 3W0CA 5E19A 2IOGA 2P15A 3KDTA 4JYGA 3TX7B 4IA7A 4G1ZA 5E15A 3ET3A 3WT7A 5KCWA 2AA6A 2HVCA 4J24A 1NRLA 4K4JA 3CJWA 2OUZA 1XNNA 4MG7B 3U9QA 5DX3B 2VV4B 2ZASA 2QPYA 3G9EA 3HC6A 2HWQA 1UPWA 2P1VA 3W0JA 5KROA 4WQPA 2NXXA 3B68A 2ZFXA 3TKMA 2Q59B 4CI4A 4QM0A 2ZK4A 3VSPA 3GZ9A 1S9QA 4DMAA 2YATA 4OZTE 1IE8A 1XAPA 4LSJA 1NAVA 3KPZA 5AZVA 4DQMA 1Y9RA 3AZ2A 2J7YA 3OLLA 5DKBA 1U3SA 2QA8B 5KCFA 4A4WA 4X1GA 4JL4A 2LBDA 4NB6A 1OSHA 4L98A 3X31A
chains in the Genus database with same CATH topology
3ET0A 2AB2A 4G21A 3CQVA 1P8DA 2ATHA 2REWA 5LGAA 2Q5SA 2J7XA 3UUAB 2NXXE 3KBAA 1XDKA 5DMCA 5H1EA 2V0VA 3WTQA 4REEA 4JGVA 2ZLCA 4QK4A 4X1FA 4M8HA 4DK8A 1S19A 1EXXA 3VRTA 5JY3A 3UP0A 3P89A 2P4YA 4M8EA 2R40D 4IWCA 4N8RA 1RJKA 3VT5A 2BAWA 2PIWA 3IPQA 5FQPA 5KRJA 4OHAA 2P1UA 1Q4XA 4PRGA 4PPSA 3TY0A 4IQRA 3BC5A 2QH6A 4HEEX 1I7GA 1X7EA 3OMQA 4MDDA 5L11A 3R8AA 2R6WA 2YJDA 3A3ZX 5HZCA 2HWRA 3MNOA 5DWJA 1L2IA 1NDEA 5DZHA 3RLLA 3UP3A 2QGTA 2VSRA 4MG8A 2GPUA 4PVUA 2AA5A 3FLIA 3H0AD 2Q1VA 3HVLA 2PITA 2GP7A 3VI8A 3WGPA 3OKHA 3VT9A 2OVHA 3G0WA 5C4TA 5KRLA 4FGYA 3WFGA 1ZEOA 4DM6A 3HZFA 1IE9A 1RKGA 5KRMA 1XQCA 4NY9A 3B0QA 4IV2A 5L7GA 1KV6A 2OCFA 5KCTA 2B23A 4J5WA 3KMRA 5APJA 4LNXA 5SYZA 3W0IA 1ZDUA 1XB7A 3W0YA 2O9IA 1P93A 5E1CA 5EJVA 3W5RA 1PQ9A 1R5KA 4ZNHA 4JAZA 3KMGA 5DWGA 5DUHA 5DIDA 1ZAFA 1YMTA 1I38A 2QMVA 4UDBA 5KCCA 3MNPA 1FCYA 2EWPA 1M7WA 2Q5GA 4OFUA 5DXGA 5HJSA 4R6SA 2AX9A 3VHWA 3VN2A 5KRCA 5CJ6A 5EI1A 1S9PA 3W5TA 3FEIA 2HCDA 2I0GA 3O1EA 3HC5A 4E2JA 4QJRA 4TV1B 4P6XA 4OLMA 1SKXA 1FM6D 1I7IA 1Y0SA 2AMAA 1RDTD 3OSWA 3F7DA 2VV0A 4S14A 4TUZA 1L2JA 5GICA 3V3QA 1NQ0A 1YJEA 2O4RA 1OT7A 4G1YA 4OZRU 3RUUA 2I4ZA 5DXBB 2QTUA 1S0XA 1X78A 2JF9A 1R20D 2P7AA 2PRGA 1E3GA 3ADSA 3E94A 1X76A 3L03A 4KZIA 4XT9A 5DY8A 5AAVA 2VV1A 1G2NA 4RFWA 3SZ1A 1R1KA 3HM1A 2HB8A 3OMMA 1NHZA 3OMPA 2G44A 1I37A 2B1VA 4OJBA 3V49A 1GWRA 2YJAB 4A2JA 3A2JA 3SP6A 3DZYD 4ZI1A 1PZLA 5FQTA 3GWSX 4OH5A 3VTBA 2QXSA 1U3RA 3LBDA 2NW4A 3D6DA 5KR9A 3ADTA 1VJBA 1G50A 2Q7IA 2ZNOA 3NSPA 4IA3A 4L96A 4UDDA 2HASA 5AVIA 5C4OA 3WT6A 3E00D 3B67A 3DCTA 5C4UA 4ZNTA 4PP3A 5E0XA 5KYJA 5I4VA 3A2IA 1K4WA 2ZNQA 3K6PA 3B5RA 4TUZB 3DZUA 4N73A 5GIDA 1OVLA 1H9UA 4N1YA 4EM9A 2ZK5A 3DR1A 4IU7A 5DKSA 5AAVB 2ZK3A 2XHSA 1RKHA 1R6GA 2V7CA 2VV1B 3WJ5A 3VJIA 3CWDA 3DT3A 3B1MA 3OGTA 4Q13A 3IA6A 2I0JA 4OILA 4O8FA 4OKBA 2OVMA 3GWXA 3UUAA 2HARA 5DZ0A 3G8IA 2ZMJA 2ZK6A 4OKXA 5IAWA 2Q6JA 5DU5A 2ACLB 4RUJA 2PINA 3IXPA 1T73A 4IA1A 4KZJA 4N5GA 4P6WA 5JJMB 1K74D 1PQ6A 2I4PA 4ITFA 5DIGA 5JI0D 2ZKCA 3AUQA 3V9TA 3ZRBA 4OJ4A 3PO9A 4MG6A 1QKUA 4XI3A 4R06A 1OVLB 3VJHA 5G45A 2XYJA 4WHGA 3KMZA 4OC7A 1T7TA 4OEYA 1Z95A 2AMBA 2R6YA 2Q7LA 4RE8A 3KDUA 1ZUCA 3OS9A 4IWFA 1NQ2A 1QKMA 3GYTA 2H77A 4XHDA 2G5OA 3ZQTA 4K6IA 3GD2A 2FSZA 1N46A 4G20A 5DZ3A 4EMAA 3N00A 4NQAB 3R5NA 5DUEA 2HC4A 4J5XC 4XUMA 3UUDA 1UPVA 4ZNUA 3WT5A 4MG9A 3P8XA 1S0ZA 4RMCA 3M7RA 1ILHA 2H79A 4HLWA 2GTKA 3ADXA 4IW8A 5E0WA 5EGVA 5DV3A 2Q6SA 2AA2A 2Q8SA 2QSEA 4YPQA 1RK3A 5K13A 2YLQA 5AVLA 1G5YA 3AZ1A 2Q70A 2G0HA 2YLPA 4ZO1X 1TFCA 3AZ3A 3L0LA 4A4VA 4E4KA 4WHFA 1Y0XX 4RMDA 2R40A 3A78A 3B0RA 3OS8C 2Q1HA 5KRFA 4POJA 1PQCA 5F9BA 1FBYA 4QE6A 4TV1A 2AX8A 5EITA 2AAXA 5KYAA 2QA6A 2QNVA 5E14A 3PRGA 3BEJA 1QKNA 3UUDB 1G1UA 5KRKA 4MG9B 3RUTA 2Q6RA 2J4AA 4OEZA 5DV6A 5DZIA 4WPFA 3OSAA 2QE4A 3H0AA 3K23A 3PLZA 5DXBA 1U9EA 5B41A 5LWPA 5GIEA 1FD0A 2QZOB 5KD9A 5DLRA 4Y29A 5DWEA 4RAKA 2VSTA 4ONIA 4B7WA 4S0TA 1ZGYA 2ZK1A 3L3ZA 2XKWA 2BJ4A 3RY9A 3D5FA 5A86A 5DVVA 2W8YA 2PIOA 3VRWA 4RUPA 1KNUA 2PKLA 4MGDA 2ZK2A 1FM9A 1GS4A 3D90A 3OLSA 4JYIA 4XTAA 3ZR7A 1SR7A 3AUNA 3PBAA 3ZRAA 1T7FA 4YNKA 5DKEA 3B0WA 1X7JA 2POBA 3Q95A 4IVWA 5KRIA 3UUCA 1N4HA 1DKFA 1NQ1A 3FURA 3WMHA 2PIUA 4PP5A 4NUFA 5DV8A 2VV2A 3L0EA 5DRMA 4OZRE 3VT8A 3T03A 2ZVTA 5KCDA 3OMKA 2GPOA 3A2HA 4S0SA 5G43A 2A3IA 4ZNWA 1RDTA 2AA7A 3DCUA 3TKCA 4R2UA 3O1DA 2QW4A 5ACCA 4RMEA 3ET1A 2ZXZA 2JFAA 3CS8A 5DKGA 1EREA 5E7VA 3VTDA 1N83A 5KRHA 2BJ4B 3B3KA 4OKTA 5EC9A 2ACLA 4FN9A 3WFFA 1XV9A 5HJPB 1ILGA 3R29A 4MGDB 5DVSA 4ZN7A 2ZXNA 3HODA 1NUOA 3NOAA 3QT0A 3WWRA 5JJMA 4IS8A 4RUOX 2ZNNA 3LMPA 5AYGA 1YINA 4XUHA 1DB1A 3VHVA 3Q95B 3AN4A 3OSIA 3EYBA 3E7CA 4J26A 1DKFB 3HO0A 3VHUA 2XYXA 3IPUA 3W5QA 2AWHA 2YFEA 4UDCA 3V3EA 3ERDA 2P7ZA 1T65A 3E00A 5DWIA 3HLVA 1XPCA 5DVCA 1YIMA 5DL4A 5DXQA 3DZUD 5L7EA 3H52A 4KZMA 1WM0X 1PCGA 1XOWA 3X1HA 1LBDA 3UU7A 5KRAA 2PIPL 2I4JA 1PDUA 1YOKA 4YMQA 2JFAB 5KCEA 3B65A 2GPPA 3GBKA 5G3JA 1PRGA 4PLEA 2YHDA 4J5XA 1XIUA 4PF3A 4ZO1B 2HB7A 2PIRA 1XV9B 5EHJA 2Q7KA 4PLDA 3F5CA 1XP6A 3OAPA 5ICKA 2P7GA 1ZKYA 1LV2A 1GWQA 1NQ7A 4LTWA 3P88A 1M2ZA 3PCUA 4IW6A 4QL8A 2Q7JA 2GL8A 3FS1A 3IXPD 2PIVA 4DM8A 2POGA 3D24A 3FALA 3W0HA 2PNUA 2VV3A 3RLJA 1K74A 1E3KA 2AX7A 2QXMA 2F4BA 5DRJA 2AX6A 3R8IA 1YP0A 3VT7A 4BCRA 1X7BA 2Z4JA 3UU7B 1YY4A 3OS8A 3PEQA 2NV7A 1XZXX 2E2RA 2ZXMA 2B50A 2JJ3A 3AURA 3CS6A 5DYBA 3FUGA 4RZGA 3VTCA 1ZH7A 4OZTU 2IOKA 1XP1A 3ADWA 3CLDA 3F5CB 4PPPA 3VRUA 4YT1A 2G0GA 5C4SA 3MNEA 3G8OA 3AN3A 1EXAA 1T7MA 1MZNA 4OKWA 5DMFA 2QZOA 1T76A 2Q3YA 2HBHA 3ILZA 1ERRA 4MGAA 2OM9A 2ZMIA 3FXVA 3VRVA 4ZJRA 5IXKA 3FALB 4WLBA 4DORA 4XAOA 3CDSA 5FQSA 3FC6A 3KWYA 5AAUA 4MGCA 5DZ1A 3A9EA 3R8DA 3OOKA 2QR9A 4OEAA 5B5BA 3V4AA 1U3QA 1Z5XU 2O4JA 3A40X 5DXKA 3VT3A 5G46A 5HCVA 1Z5XE 4E4QA 4APUA 4UDAA 3BQDA 2NPAA 4IVYA 3NSQA 1XNXA 5DXMA 5IZ0A 3RVFA 3KFCA 5DSHA 3P0UA 2Q5PA 3L3XA 3UVVA 3WJ4A 1MVCA 3S9SA 1YA3A 4MGBA 4NIEA 5ETHA 4ZJWA 1FCXA 4FHHA 4OK1A 1OSVA 5APHA 3W0AA 1XLSA 3OZ0A 3AFRA 2AO6A 3ERTA 1TXIA 3B0TA 3R5MA 5DUGA 1KKQA 1M13A 4MGAB 1UHLA 2FVJA 4PWLA 3JZCA 2Q60A 3CDPA 2AM9A 3GYUA 5DI7A 3FC6B 5HYKA 1XQ3A 2PJLA 3L0JA 4REFA 5DXRA 1T63A 3A9EB 1XDKB 2YLYA 4FHIA 4G1DA 1FCZA 5HJPA 1T5ZA 3CS4A 3OKIA 2Q61A 1YOWA 5DXEA 1SJ0A 1A28A 2GPVA 2IHQA 4MG5A 3CTBA 3VJSA 5DK9A 4Q0AC 1XLSE 3OLFA 3AX8A 3UVVB 4OFRA 4RZFA 1K7LA 3ADVA 4OARA 4QE8A 5DXPA 1FM9D 4MGBB 5AK2A 5APKA 3SP9A 4PP6A 3K22A 2OZ7A 1HG4A 2B1ZA 4OGHA 3B66A 4PXMA 3X1IA 3VT4A 4DK7A 1XVPA 4RZEA 4G2HA 3FEJA 1FM6A 4G2IA 4LBDA 5AZTA 3DY6A 3GN8A 4IUIA 4MG8B 4RWVA 4F9MA 1UHLB 1SQNA 1T74A 2AXAA 3ET2A 2GIUA 4DOSA 4WVDA 2ZMHA 1R20A 2PIXA 5DTVA 3L1BA 3R2AA 5FQVA 5G44A 1R1KD 2ABIA 4ZOMA 3VJTA 1MV9A 3KYTA 4ITEA 4IV4A 3IPSA 4J5WC 4CSJA 1YYEA 3W0GA 3VSOA 3ADUA 5AWKA 2P54A 5AWJA 5DYDA 2PIQA 3V9YA 3DZYA 2XYWA 1T7RA 1QKTA 2FAIA 2HFPA 2Z4BA 2GWXA 4OEDA 2QABA 5L7HA 4FNEA 4ZN9A 4OH6A 5FQRA 4CI5A 4ZNVA 4OIUA 4JYHA 2ZL9A 5DP0A 2QGWA 4XLDA 5GT4A 5KCUA 1X7RA 2J14A 1A52A 1BSXA 4MG7A 1NAXA 1XVPB 3K8SA 2P1TA 1NYXA 4S15A 1XJ7A 2ZBSA 1UOMA 2VV4A 3JZBA 5DX3A 2OAXA 3HQ5A 1YUCA 4ZNSA 5DIEA 3V9VA 3W5PA 3X36A 5DWLA 2Q59A 2ZLAA 2HAMA 1PK5A 5G42A 3VT6A 3OZJA 1ZDTA 4OJ9A 1XP9A 2ZNPA 4IA2A 4Q50A 5G5WA 2YLOA 1GWXA 2ZY0A 3IMYA 3OMOA 4K7AA 1HJ1A 1T79A 2QA8A 4POHA 5HYRA 4LNWA 3D57A 5M96A 2ZK0A 2AYRA 4OIVA 3OOFA 3W0CA 5E19A 2IOGA 2P15A 3KDTA 4JYGA 3TX7B 4IA7A 4G1ZA 5E15A 3ET3A 3WT7A 5KCWA 2AA6A 2HVCA 4J24A 1NRLA 4K4JA 3CJWA 2OUZA 1XNNA 4MG7B 3U9QA 5DX3B 2VV4B 2ZASA 2QPYA 3G9EA 3HC6A 2HWQA 1UPWA 2P1VA 3W0JA 5KROA 4WQPA 2NXXA 3B68A 2ZFXA 3TKMA 2Q59B 4CI4A 4QM0A 2ZK4A 3VSPA 3GZ9A 1S9QA 4DMAA 2YATA 4OZTE 1IE8A 1XAPA 4LSJA 1NAVA 3KPZA 5AZVA 4DQMA 1Y9RA 3AZ2A 2J7YA 3OLLA 5DKBA 1U3SA 2QA8B 5KCFA 4A4WA 4X1GA 4JL4A 2LBDA 4NB6A 1OSHA 4L98A 3X31A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ET0 A;  2AB2 A;  4G21 A;  3CQV A;  1P8D A;  2ATH A;  2REW A;  5LGA A;  2Q5S A;  2J7X A;  3UUA B;  2NXX E;  3KBA A;  1XDK A;  5DMC A;  5H1E A;  2V0V A;  3WTQ A;  4REE A;  4JGV A;  2ZLC A;  4QK4 A;  4X1F A;  4M8H A;  4DK8 A;  1S19 A;  1EXX A;  3VRT A;  5JY3 A;  3UP0 A;  3P89 A;  2P4Y A;  4M8E A;  2R40 D;  4IWC A;  4N8R A;  1RJK A;  3VT5 A;  2BAW A;  2PIW A;  3IPQ A;  5FQP A;  5KRJ A;  4OHA A;  2P1U A;  1Q4X A;  4PRG A;  4PPS A;  3TY0 A;  4IQR A;  3BC5 A;  2QH6 A;  4HEE X;  1I7G A;  1X7E A;  3OMQ A;  4MDD A;  5L11 A;  3R8A A;  2R6W A;  2YJD A;  3A3Z X;  5HZC A;  2HWR A;  3MNO A;  5DWJ A;  1L2I A;  1NDE A;  5DZH A;  3RLL A;  3UP3 A;  2QGT A;  2VSR A;  4MG8 A;  2GPU A;  4PVU A;  2AA5 A;  3FLI A;  3H0A D;  2Q1V A;  3HVL A;  2PIT A;  2GP7 A;  3VI8 A;  3WGP A;  3OKH A;  3VT9 A;  2OVH A;  3G0W A;  5C4T A;  5KRL A;  4FGY A;  3WFG A;  1ZEO A;  4DM6 A;  3HZF A;  1IE9 A;  1RKG A;  5KRM A;  1XQC A;  4NY9 A;  3B0Q A;  4IV2 A;  5L7G A;  1KV6 A;  2OCF A;  5KCT A;  2B23 A;  4J5W A;  3KMR A;  5APJ A;  4LNX A;  5SYZ A;  3W0I A;  1ZDU A;  1XB7 A;  3W0Y A;  2O9I A;  1P93 A;  5E1C A;  5EJV A;  3W5R A;  1PQ9 A;  1R5K A;  4ZNH A;  4JAZ A;  3KMG A;  5DWG A;  5DUH A;  5DID A;  1ZAF A;  1YMT A;  1I38 A;  2QMV A;  4UDB A;  5KCC A;  3MNP A;  1FCY A;  2EWP A;  1M7W A;  2Q5G A;  4OFU A;  5DXG A;  5HJS A;  4R6S A;  2AX9 A;  3VHW A;  3VN2 A;  5KRC A;  5CJ6 A;  5EI1 A;  1S9P A;  3W5T A;  3FEI A;  2HCD A;  2I0G A;  3O1E A;  3HC5 A;  4E2J A;  4QJR A;  4TV1 B;  4P6X A;  4OLM A;  1SKX A;  1FM6 D;  1I7I A;  1Y0S A;  2AMA A;  1RDT D;  3OSW A;  3F7D A;  2VV0 A;  4S14 A;  4TUZ A;  1L2J A;  5GIC A;  3V3Q A;  1NQ0 A;  1YJE A;  2O4R A;  1OT7 A;  4G1Y A;  4OZR U;  3RUU A;  2I4Z A;  5DXB B;  2QTU A;  1S0X A;  1X78 A;  2JF9 A;  1R20 D;  2P7A A;  2PRG A;  1E3G A;  3ADS A;  3E94 A;  1X76 A;  3L03 A;  4KZI A;  4XT9 A;  5DY8 A;  5AAV A;  2VV1 A;  1G2N A;  4RFW A;  3SZ1 A;  1R1K A;  3HM1 A;  2HB8 A;  3OMM A;  1NHZ A;  3OMP A;  2G44 A;  1I37 A;  2B1V A;  4OJB A;  3V49 A;  1GWR A;  2YJA B;  4A2J A;  3A2J A;  3SP6 A;  3DZY D;  4ZI1 A;  1PZL A;  5FQT A;  3GWS X;  4OH5 A;  3VTB A;  2QXS A;  1U3R A;  3LBD A;  2NW4 A;  3D6D A;  5KR9 A;  3ADT A;  1VJB A;  1G50 A;  2Q7I A;  2ZNO A;  3NSP A;  4IA3 A;  4L96 A;  4UDD A;  2HAS A;  5AVI A;  5C4O A;  3WT6 A;  3E00 D;  3B67 A;  3DCT A;  5C4U A;  4ZNT A;  4PP3 A;  5E0X A;  5KYJ A;  5I4V A;  3A2I A;  1K4W A;  2ZNQ A;  3K6P A;  3B5R A;  4TUZ B;  3DZU A;  4N73 A;  5GID A;  1OVL A;  1H9U A;  4N1Y A;  4EM9 A;  2ZK5 A;  3DR1 A;  4IU7 A;  5DKS A;  5AAV B;  2ZK3 A;  2XHS A;  1RKH A;  1R6G A;  2V7C A;  2VV1 B;  3WJ5 A;  3VJI A;  3CWD A;  3DT3 A;  3B1M A;  3OGT A;  4Q13 A;  3IA6 A;  2I0J A;  4OIL A;  4O8F A;  4OKB A;  2OVM A;  3GWX A;  3UUA A;  2HAR A;  5DZ0 A;  3G8I A;  2ZMJ A;  2ZK6 A;  4OKX A;  5IAW A;  2Q6J A;  5DU5 A;  2ACL B;  4RUJ A;  2PIN A;  3IXP A;  1T73 A;  4IA1 A;  4KZJ A;  4N5G A;  4P6W A;  5JJM B;  1K74 D;  1PQ6 A;  2I4P A;  4ITF A;  5DIG A;  5JI0 D;  2ZKC A;  3AUQ A;  3V9T A;  3ZRB A;  4OJ4 A;  3PO9 A;  4MG6 A;  1QKU A;  4XI3 A;  4R06 A;  1OVL B;  3VJH A;  5G45 A;  2XYJ A;  4WHG A;  3KMZ A;  4OC7 A;  1T7T A;  4OEY A;  1Z95 A;  2AMB A;  2R6Y A;  2Q7L A;  4RE8 A;  3KDU A;  1ZUC A;  3OS9 A;  4IWF A;  1NQ2 A;  1QKM A;  3GYT A;  2H77 A;  4XHD A;  2G5O A;  3ZQT A;  4K6I A;  3GD2 A;  2FSZ A;  1N46 A;  4G20 A;  5DZ3 A;  4EMA A;  3N00 A;  4NQA B;  3R5N A;  5DUE A;  2HC4 A;  4J5X C;  4XUM A;  3UUD A;  1UPV A;  4ZNU A;  3WT5 A;  4MG9 A;  3P8X A;  1S0Z A;  4RMC A;  3M7R A;  1ILH A;  2H79 A;  4HLW A;  2GTK A;  3ADX A;  4IW8 A;  5E0W A;  5EGV A;  5DV3 A;  2Q6S A;  2AA2 A;  2Q8S A;  2QSE A;  4YPQ A;  1RK3 A;  5K13 A;  2YLQ A;  5AVL A;  1G5Y A;  3AZ1 A;  2Q70 A;  2G0H A;  2YLP A;  4ZO1 X;  1TFC A;  3AZ3 A;  3L0L A;  4A4V A;  4E4K A;  4WHF A;  1Y0X X;  4RMD A;  2R40 A;  3A78 A;  3B0R A;  3OS8 C;  2Q1H A;  5KRF A;  4POJ A;  1PQC A;  5F9B A;  1FBY A;  4QE6 A;  4TV1 A;  2AX8 A;  5EIT A;  2AAX A;  5KYA A;  2QA6 A;  2QNV A;  5E14 A;  3PRG A;  3BEJ A;  1QKN A;  3UUD B;  1G1U A;  5KRK A;  4MG9 B;  3RUT A;  2Q6R A;  2J4A A;  4OEZ A;  5DV6 A;  5DZI A;  4WPF A;  3OSA A;  2QE4 A;  3H0A A;  3K23 A;  3PLZ A;  5DXB A;  1U9E A;  5B41 A;  5LWP A;  5GIE A;  1FD0 A;  2QZO B;  5KD9 A;  5DLR A;  4Y29 A;  5DWE A;  4RAK A;  2VST A;  4ONI A;  4B7W A;  4S0T A;  1ZGY A;  2ZK1 A;  3L3Z A;  2XKW A;  2BJ4 A;  3RY9 A;  3D5F A;  5A86 A;  5DVV A;  2W8Y A;  2PIO A;  3VRW A;  4RUP A;  1KNU A;  2PKL A;  4MGD A;  2ZK2 A;  1FM9 A;  1GS4 A;  3D90 A;  3OLS A;  4JYI A;  4XTA A;  3ZR7 A;  1SR7 A;  3AUN A;  3PBA A;  3ZRA A;  1T7F A;  4YNK A;  5DKE A;  3B0W A;  1X7J A;  2POB A;  3Q95 A;  4IVW A;  5KRI A;  3UUC A;  1N4H A;  1DKF A;  1NQ1 A;  3FUR A;  3WMH A;  2PIU A;  4PP5 A;  4NUF A;  5DV8 A;  2VV2 A;  3L0E A;  5DRM A;  4OZR E;  3VT8 A;  3T03 A;  2ZVT A;  5KCD A;  3OMK A;  2GPO A;  3A2H A;  4S0S A;  5G43 A;  2A3I A;  4ZNW A;  1RDT A;  2AA7 A;  3DCU A;  3TKC A;  4R2U A;  3O1D A;  2QW4 A;  5ACC A;  4RME A;  3ET1 A;  2ZXZ A;  2JFA A;  3CS8 A;  5DKG A;  1ERE A;  5E7V A;  3VTD A;  1N83 A;  5KRH A;  2BJ4 B;  3B3K A;  4OKT A;  5EC9 A;  2ACL A;  4FN9 A;  3WFF A;  1XV9 A;  5HJP B;  1ILG A;  3R29 A;  4MGD B;  5DVS A;  4ZN7 A;  2ZXN A;  3HOD A;  1NUO A;  3NOA A;  3QT0 A;  3WWR A;  5JJM A;  4IS8 A;  4RUO X;  2ZNN A;  3LMP A;  5AYG A;  1YIN A;  4XUH A;  1DB1 A;  3VHV A;  3Q95 B;  3AN4 A;  3OSI A;  3EYB A;  3E7C A;  4J26 A;  1DKF B;  3HO0 A;  3VHU A;  2XYX A;  3IPU A;  3W5Q A;  2AWH A;  2YFE A;  4UDC A;  3V3E A;  3ERD A;  2P7Z A;  1T65 A;  3E00 A;  5DWI A;  3HLV A;  1XPC A;  5DVC A;  1YIM A;  5DL4 A;  5DXQ A;  3DZU D;  5L7E A;  3H52 A;  4KZM A;  1WM0 X;  1PCG A;  1XOW A;  3X1H A;  1LBD A;  3UU7 A;  5KRA A;  2PIP L;  2I4J A;  1PDU A;  1YOK A;  4YMQ A;  2JFA B;  5KCE A;  3B65 A;  2GPP A;  3GBK A;  5G3J A;  1PRG A;  4PLE A;  2YHD A;  4J5X A;  1XIU A;  4PF3 A;  4ZO1 B;  2HB7 A;  2PIR A;  1XV9 B;  5EHJ A;  2Q7K A;  4PLD A;  3F5C A;  1XP6 A;  3OAP A;  5ICK A;  2P7G A;  1ZKY A;  1LV2 A;  1GWQ A;  1NQ7 A;  4LTW A;  3P88 A;  1M2Z A;  3PCU A;  4IW6 A;  4QL8 A;  2Q7J A;  2GL8 A;  3FS1 A;  3IXP D;  2PIV A;  4DM8 A;  2POG A;  3D24 A;  3FAL A;  3W0H A;  2PNU A;  2VV3 A;  3RLJ A;  1K74 A;  1E3K A;  2AX7 A;  2QXM A;  2F4B A;  5DRJ A;  2AX6 A;  3R8I A;  1YP0 A;  3VT7 A;  4BCR A;  1X7B A;  2Z4J A;  3UU7 B;  1YY4 A;  3OS8 A;  3PEQ A;  2NV7 A;  1XZX X;  2E2R A;  2ZXM A;  2B50 A;  2JJ3 A;  3AUR A;  3CS6 A;  5DYB A;  3FUG A;  4RZG A;  3VTC A;  1ZH7 A;  4OZT U;  2IOK A;  1XP1 A;  3ADW A;  3CLD A;  3F5C B;  4PPP A;  3VRU A;  4YT1 A;  2G0G A;  5C4S A;  3MNE A;  3G8O A;  3AN3 A;  1EXA A;  1T7M A;  1MZN A;  4OKW A;  5DMF A;  2QZO A;  1T76 A;  2Q3Y A;  2HBH A;  3ILZ A;  1ERR A;  4MGA A;  2OM9 A;  2ZMI A;  3FXV A;  3VRV A;  4ZJR A;  5IXK A;  3FAL B;  4WLB A;  4DOR A;  4XAO A;  3CDS A;  5FQS A;  3FC6 A;  3KWY A;  5AAU A;  4MGC A;  5DZ1 A;  3A9E A;  3R8D A;  3OOK A;  2QR9 A;  4OEA A;  5B5B A;  3V4A A;  1U3Q A;  1Z5X U;  2O4J A;  3A40 X;  5DXK A;  3VT3 A;  5G46 A;  5HCV A;  1Z5X E;  4E4Q A;  4APU A;  4UDA A;  3BQD A;  2NPA A;  4IVY A;  3NSQ A;  1XNX A;  5DXM A;  5IZ0 A;  3RVF A;  3KFC A;  5DSH A;  3P0U A;  2Q5P A;  3L3X A;  3UVV A;  3WJ4 A;  1MVC A;  3S9S A;  1YA3 A;  4MGB A;  4NIE A;  5ETH A;  4ZJW A;  1FCX A;  4FHH A;  4OK1 A;  1OSV A;  5APH A;  3W0A A;  1XLS A;  3OZ0 A;  3AFR A;  2AO6 A;  3ERT A;  1TXI A;  3B0T A;  3R5M A;  5DUG A;  1KKQ A;  1M13 A;  4MGA B;  1UHL A;  2FVJ A;  4PWL A;  3JZC A;  2Q60 A;  3CDP A;  2AM9 A;  3GYU A;  5DI7 A;  3FC6 B;  5HYK A;  1XQ3 A;  2PJL A;  3L0J A;  4REF A;  5DXR A;  1T63 A;  3A9E B;  1XDK B;  2YLY A;  4FHI A;  4G1D A;  1FCZ A;  5HJP A;  1T5Z A;  3CS4 A;  3OKI A;  2Q61 A;  1YOW A;  5DXE A;  1SJ0 A;  1A28 A;  2GPV A;  2IHQ A;  4MG5 A;  3CTB A;  3VJS A;  5DK9 A;  4Q0A C;  1XLS E;  3OLF A;  3AX8 A;  3UVV B;  4OFR A;  4RZF A;  1K7L A;  3ADV A;  4OAR A;  4QE8 A;  5DXP A;  1FM9 D;  4MGB B;  5AK2 A;  5APK A;  3SP9 A;  4PP6 A;  3K22 A;  2OZ7 A;  1HG4 A;  2B1Z A;  4OGH A;  3B66 A;  4PXM A;  3X1I A;  3VT4 A;  4DK7 A;  1XVP A;  4RZE A;  4G2H A;  3FEJ A;  1FM6 A;  4G2I A;  4LBD A;  5AZT A;  3DY6 A;  3GN8 A;  4IUI A;  4MG8 B;  4RWV A;  4F9M A;  1UHL B;  1SQN A;  1T74 A;  2AXA A;  3ET2 A;  2GIU A;  4DOS A;  4WVD A;  2ZMH A;  1R20 A;  2PIX A;  5DTV A;  3L1B A;  3R2A A;  5FQV A;  5G44 A;  1R1K D;  2ABI A;  4ZOM A;  3VJT A;  1MV9 A;  3KYT A;  4ITE A;  4IV4 A;  3IPS A;  4J5W C;  4CSJ A;  1YYE A;  3W0G A;  3VSO A;  3ADU A;  5AWK A;  2P54 A;  5AWJ A;  5DYD A;  2PIQ A;  3V9Y A;  3DZY A;  2XYW A;  1T7R A;  1QKT A;  2FAI A;  2HFP A;  2Z4B A;  2GWX A;  4OED A;  2QAB A;  5L7H A;  4FNE A;  4ZN9 A;  4OH6 A;  5FQR A;  4CI5 A;  4ZNV A;  4OIU A;  4JYH A;  2ZL9 A;  5DP0 A;  2QGW A;  4XLD A;  5GT4 A;  5KCU A;  1X7R A;  2J14 A;  1A52 A;  1BSX A;  4MG7 A;  1NAX A;  1XVP B;  3K8S A;  2P1T A;  1NYX A;  4S15 A;  1XJ7 A;  2ZBS A;  1UOM A;  2VV4 A;  3JZB A;  5DX3 A;  2OAX A;  3HQ5 A;  1YUC A;  4ZNS A;  5DIE A;  3V9V A;  3W5P A;  3X36 A;  5DWL A;  2Q59 A;  2ZLA A;  2HAM A;  1PK5 A;  5G42 A;  3VT6 A;  3OZJ A;  1ZDT A;  4OJ9 A;  1XP9 A;  2ZNP A;  4IA2 A;  4Q50 A;  5G5W A;  2YLO A;  1GWX A;  2ZY0 A;  3IMY A;  3OMO A;  4K7A A;  1HJ1 A;  1T79 A;  2QA8 A;  4POH A;  5HYR A;  4LNW A;  3D57 A;  5M96 A;  2ZK0 A;  2AYR A;  4OIV A;  3OOF A;  3W0C A;  5E19 A;  2IOG A;  2P15 A;  3KDT A;  4JYG A;  3TX7 B;  4IA7 A;  4G1Z A;  5E15 A;  3ET3 A;  3WT7 A;  5KCW A;  2AA6 A;  2HVC A;  4J24 A;  1NRL A;  4K4J A;  3CJW A;  2OUZ A;  1XNN A;  4MG7 B;  3U9Q A;  5DX3 B;  2VV4 B;  2ZAS A;  2QPY A;  3G9E A;  3HC6 A;  2HWQ A;  1UPW A;  2P1V A;  3W0J A;  5KRO A;  4WQP A;  2NXX A;  3B68 A;  2ZFX A;  3TKM A;  2Q59 B;  4CI4 A;  4QM0 A;  2ZK4 A;  3VSP A;  3GZ9 A;  1S9Q A;  4DMA A;  2YAT A;  4OZT E;  1IE8 A;  1XAP A;  4LSJ A;  1NAV A;  3KPZ A;  5AZV A;  4DQM A;  1Y9R A;  3AZ2 A;  2J7Y A;  3OLL A;  5DKB A;  1U3S A;  2QA8 B;  5KCF A;  4A4W A;  4X1G A;  4JL4 A;  2LBD A;  4NB6 A;  1OSH A;  4L98 A;  3X31 A; 
#chains in the Genus database with same CATH topology
 3ET0 A;  2AB2 A;  4G21 A;  3CQV A;  1P8D A;  2ATH A;  2REW A;  5LGA A;  2Q5S A;  2J7X A;  3UUA B;  2NXX E;  3KBA A;  1XDK A;  5DMC A;  5H1E A;  2V0V A;  3WTQ A;  4REE A;  4JGV A;  2ZLC A;  4QK4 A;  4X1F A;  4M8H A;  4DK8 A;  1S19 A;  1EXX A;  3VRT A;  5JY3 A;  3UP0 A;  3P89 A;  2P4Y A;  4M8E A;  2R40 D;  4IWC A;  4N8R A;  1RJK A;  3VT5 A;  2BAW A;  2PIW A;  3IPQ A;  5FQP A;  5KRJ A;  4OHA A;  2P1U A;  1Q4X A;  4PRG A;  4PPS A;  3TY0 A;  4IQR A;  3BC5 A;  2QH6 A;  4HEE X;  1I7G A;  1X7E A;  3OMQ A;  4MDD A;  5L11 A;  3R8A A;  2R6W A;  2YJD A;  3A3Z X;  5HZC A;  2HWR A;  3MNO A;  5DWJ A;  1L2I A;  1NDE A;  5DZH A;  3RLL A;  3UP3 A;  2QGT A;  2VSR A;  4MG8 A;  2GPU A;  4PVU A;  2AA5 A;  3FLI A;  3H0A D;  2Q1V A;  3HVL A;  2PIT A;  2GP7 A;  3VI8 A;  3WGP A;  3OKH A;  3VT9 A;  2OVH A;  3G0W A;  5C4T A;  5KRL A;  4FGY A;  3WFG A;  1ZEO A;  4DM6 A;  3HZF A;  1IE9 A;  1RKG A;  5KRM A;  1XQC A;  4NY9 A;  3B0Q A;  4IV2 A;  5L7G A;  1KV6 A;  2OCF A;  5KCT A;  2B23 A;  4J5W A;  3KMR A;  5APJ A;  4LNX A;  5SYZ A;  3W0I A;  1ZDU A;  1XB7 A;  3W0Y A;  2O9I A;  1P93 A;  5E1C A;  5EJV A;  3W5R A;  1PQ9 A;  1R5K A;  4ZNH A;  4JAZ A;  3KMG A;  5DWG A;  5DUH A;  5DID A;  1ZAF A;  1YMT A;  1I38 A;  2QMV A;  4UDB A;  5KCC A;  3MNP A;  1FCY A;  2EWP A;  1M7W A;  2Q5G A;  4OFU A;  5DXG A;  5HJS A;  4R6S A;  2AX9 A;  3VHW A;  3VN2 A;  5KRC A;  5CJ6 A;  5EI1 A;  1S9P A;  3W5T A;  3FEI A;  2HCD A;  2I0G A;  3O1E A;  3HC5 A;  4E2J A;  4QJR A;  4TV1 B;  4P6X A;  4OLM A;  1SKX A;  1FM6 D;  1I7I A;  1Y0S A;  2AMA A;  1RDT D;  3OSW A;  3F7D A;  2VV0 A;  4S14 A;  4TUZ A;  1L2J A;  5GIC A;  3V3Q A;  1NQ0 A;  1YJE A;  2O4R A;  1OT7 A;  4G1Y A;  4OZR U;  3RUU A;  2I4Z A;  5DXB B;  2QTU A;  1S0X A;  1X78 A;  2JF9 A;  1R20 D;  2P7A A;  2PRG A;  1E3G A;  3ADS A;  3E94 A;  1X76 A;  3L03 A;  4KZI A;  4XT9 A;  5DY8 A;  5AAV A;  2VV1 A;  1G2N A;  4RFW A;  3SZ1 A;  1R1K A;  3HM1 A;  2HB8 A;  3OMM A;  1NHZ A;  3OMP A;  2G44 A;  1I37 A;  2B1V A;  4OJB A;  3V49 A;  1GWR A;  2YJA B;  4A2J A;  3A2J A;  3SP6 A;  3DZY D;  4ZI1 A;  1PZL A;  5FQT A;  3GWS X;  4OH5 A;  3VTB A;  2QXS A;  1U3R A;  3LBD A;  2NW4 A;  3D6D A;  5KR9 A;  3ADT A;  1VJB A;  1G50 A;  2Q7I A;  2ZNO A;  3NSP A;  4IA3 A;  4L96 A;  4UDD A;  2HAS A;  5AVI A;  5C4O A;  3WT6 A;  3E00 D;  3B67 A;  3DCT A;  5C4U A;  4ZNT A;  4PP3 A;  5E0X A;  5KYJ A;  5I4V A;  3A2I A;  1K4W A;  2ZNQ A;  3K6P A;  3B5R A;  4TUZ B;  3DZU A;  4N73 A;  5GID A;  1OVL A;  1H9U A;  4N1Y A;  4EM9 A;  2ZK5 A;  3DR1 A;  4IU7 A;  5DKS A;  5AAV B;  2ZK3 A;  2XHS A;  1RKH A;  1R6G A;  2V7C A;  2VV1 B;  3WJ5 A;  3VJI A;  3CWD A;  3DT3 A;  3B1M A;  3OGT A;  4Q13 A;  3IA6 A;  2I0J A;  4OIL A;  4O8F A;  4OKB A;  2OVM A;  3GWX A;  3UUA A;  2HAR A;  5DZ0 A;  3G8I A;  2ZMJ A;  2ZK6 A;  4OKX A;  5IAW A;  2Q6J A;  5DU5 A;  2ACL B;  4RUJ A;  2PIN A;  3IXP A;  1T73 A;  4IA1 A;  4KZJ A;  4N5G A;  4P6W A;  5JJM B;  1K74 D;  1PQ6 A;  2I4P A;  4ITF A;  5DIG A;  5JI0 D;  2ZKC A;  3AUQ A;  3V9T A;  3ZRB A;  4OJ4 A;  3PO9 A;  4MG6 A;  1QKU A;  4XI3 A;  4R06 A;  1OVL B;  3VJH A;  5G45 A;  2XYJ A;  4WHG A;  3KMZ A;  4OC7 A;  1T7T A;  4OEY A;  1Z95 A;  2AMB A;  2R6Y A;  2Q7L A;  4RE8 A;  3KDU A;  1ZUC A;  3OS9 A;  4IWF A;  1NQ2 A;  1QKM A;  3GYT A;  2H77 A;  4XHD A;  2G5O A;  3ZQT A;  4K6I A;  3GD2 A;  2FSZ A;  1N46 A;  4G20 A;  5DZ3 A;  4EMA A;  3N00 A;  4NQA B;  3R5N A;  5DUE A;  2HC4 A;  4J5X C;  4XUM A;  3UUD A;  1UPV A;  4ZNU A;  3WT5 A;  4MG9 A;  3P8X A;  1S0Z A;  4RMC A;  3M7R A;  1ILH A;  2H79 A;  4HLW A;  2GTK A;  3ADX A;  4IW8 A;  5E0W A;  5EGV A;  5DV3 A;  2Q6S A;  2AA2 A;  2Q8S A;  2QSE A;  4YPQ A;  1RK3 A;  5K13 A;  2YLQ A;  5AVL A;  1G5Y A;  3AZ1 A;  2Q70 A;  2G0H A;  2YLP A;  4ZO1 X;  1TFC A;  3AZ3 A;  3L0L A;  4A4V A;  4E4K A;  4WHF A;  1Y0X X;  4RMD A;  2R40 A;  3A78 A;  3B0R A;  3OS8 C;  2Q1H A;  5KRF A;  4POJ A;  1PQC A;  5F9B A;  1FBY A;  4QE6 A;  4TV1 A;  2AX8 A;  5EIT A;  2AAX A;  5KYA A;  2QA6 A;  2QNV A;  5E14 A;  3PRG A;  3BEJ A;  1QKN A;  3UUD B;  1G1U A;  5KRK A;  4MG9 B;  3RUT A;  2Q6R A;  2J4A A;  4OEZ A;  5DV6 A;  5DZI A;  4WPF A;  3OSA A;  2QE4 A;  3H0A A;  3K23 A;  3PLZ A;  5DXB A;  1U9E A;  5B41 A;  5LWP A;  5GIE A;  1FD0 A;  2QZO B;  5KD9 A;  5DLR A;  4Y29 A;  5DWE A;  4RAK A;  2VST A;  4ONI A;  4B7W A;  4S0T A;  1ZGY A;  2ZK1 A;  3L3Z A;  2XKW A;  2BJ4 A;  3RY9 A;  3D5F A;  5A86 A;  5DVV A;  2W8Y A;  2PIO A;  3VRW A;  4RUP A;  1KNU A;  2PKL A;  4MGD A;  2ZK2 A;  1FM9 A;  1GS4 A;  3D90 A;  3OLS A;  4JYI A;  4XTA A;  3ZR7 A;  1SR7 A;  3AUN A;  3PBA A;  3ZRA A;  1T7F A;  4YNK A;  5DKE A;  3B0W A;  1X7J A;  2POB A;  3Q95 A;  4IVW A;  5KRI A;  3UUC A;  1N4H A;  1DKF A;  1NQ1 A;  3FUR A;  3WMH A;  2PIU A;  4PP5 A;  4NUF A;  5DV8 A;  2VV2 A;  3L0E A;  5DRM A;  4OZR E;  3VT8 A;  3T03 A;  2ZVT A;  5KCD A;  3OMK A;  2GPO A;  3A2H A;  4S0S A;  5G43 A;  2A3I A;  4ZNW A;  1RDT A;  2AA7 A;  3DCU A;  3TKC A;  4R2U A;  3O1D A;  2QW4 A;  5ACC A;  4RME A;  3ET1 A;  2ZXZ A;  2JFA A;  3CS8 A;  5DKG A;  1ERE A;  5E7V A;  3VTD A;  1N83 A;  5KRH A;  2BJ4 B;  3B3K A;  4OKT A;  5EC9 A;  2ACL A;  4FN9 A;  3WFF A;  1XV9 A;  5HJP B;  1ILG A;  3R29 A;  4MGD B;  5DVS A;  4ZN7 A;  2ZXN A;  3HOD A;  1NUO A;  3NOA A;  3QT0 A;  3WWR A;  5JJM A;  4IS8 A;  4RUO X;  2ZNN A;  3LMP A;  5AYG A;  1YIN A;  4XUH A;  1DB1 A;  3VHV A;  3Q95 B;  3AN4 A;  3OSI A;  3EYB A;  3E7C A;  4J26 A;  1DKF B;  3HO0 A;  3VHU A;  2XYX A;  3IPU A;  3W5Q A;  2AWH A;  2YFE A;  4UDC A;  3V3E A;  3ERD A;  2P7Z A;  1T65 A;  3E00 A;  5DWI A;  3HLV A;  1XPC A;  5DVC A;  1YIM A;  5DL4 A;  5DXQ A;  3DZU D;  5L7E A;  3H52 A;  4KZM A;  1WM0 X;  1PCG A;  1XOW A;  3X1H A;  1LBD A;  3UU7 A;  5KRA A;  2PIP L;  2I4J A;  1PDU A;  1YOK A;  4YMQ A;  2JFA B;  5KCE A;  3B65 A;  2GPP A;  3GBK A;  5G3J A;  1PRG A;  4PLE A;  2YHD A;  4J5X A;  1XIU A;  4PF3 A;  4ZO1 B;  2HB7 A;  2PIR A;  1XV9 B;  5EHJ A;  2Q7K A;  4PLD A;  3F5C A;  1XP6 A;  3OAP A;  5ICK A;  2P7G A;  1ZKY A;  1LV2 A;  1GWQ A;  1NQ7 A;  4LTW A;  3P88 A;  1M2Z A;  3PCU A;  4IW6 A;  4QL8 A;  2Q7J A;  2GL8 A;  3FS1 A;  3IXP D;  2PIV A;  4DM8 A;  2POG A;  3D24 A;  3FAL A;  3W0H A;  2PNU A;  2VV3 A;  3RLJ A;  1K74 A;  1E3K A;  2AX7 A;  2QXM A;  2F4B A;  5DRJ A;  2AX6 A;  3R8I A;  1YP0 A;  3VT7 A;  4BCR A;  1X7B A;  2Z4J A;  3UU7 B;  1YY4 A;  3OS8 A;  3PEQ A;  2NV7 A;  1XZX X;  2E2R A;  2ZXM A;  2B50 A;  2JJ3 A;  3AUR A;  3CS6 A;  5DYB A;  3FUG A;  4RZG A;  3VTC A;  1ZH7 A;  4OZT U;  2IOK A;  1XP1 A;  3ADW A;  3CLD A;  3F5C B;  4PPP A;  3VRU A;  4YT1 A;  2G0G A;  5C4S A;  3MNE A;  3G8O A;  3AN3 A;  1EXA A;  1T7M A;  1MZN A;  4OKW A;  5DMF A;  2QZO A;  1T76 A;  2Q3Y A;  2HBH A;  3ILZ A;  1ERR A;  4MGA A;  2OM9 A;  2ZMI A;  3FXV A;  3VRV A;  4ZJR A;  5IXK A;  3FAL B;  4WLB A;  4DOR A;  4XAO A;  3CDS A;  5FQS A;  3FC6 A;  3KWY A;  5AAU A;  4MGC A;  5DZ1 A;  3A9E A;  3R8D A;  3OOK A;  2QR9 A;  4OEA A;  5B5B A;  3V4A A;  1U3Q A;  1Z5X U;  2O4J A;  3A40 X;  5DXK A;  3VT3 A;  5G46 A;  5HCV A;  1Z5X E;  4E4Q A;  4APU A;  4UDA A;  3BQD A;  2NPA A;  4IVY A;  3NSQ A;  1XNX A;  5DXM A;  5IZ0 A;  3RVF A;  3KFC A;  5DSH A;  3P0U A;  2Q5P A;  3L3X A;  3UVV A;  3WJ4 A;  1MVC A;  3S9S A;  1YA3 A;  4MGB A;  4NIE A;  5ETH A;  4ZJW A;  1FCX A;  4FHH A;  4OK1 A;  1OSV A;  5APH A;  3W0A A;  1XLS A;  3OZ0 A;  3AFR A;  2AO6 A;  3ERT A;  1TXI A;  3B0T A;  3R5M A;  5DUG A;  1KKQ A;  1M13 A;  4MGA B;  1UHL A;  2FVJ A;  4PWL A;  3JZC A;  2Q60 A;  3CDP A;  2AM9 A;  3GYU A;  5DI7 A;  3FC6 B;  5HYK A;  1XQ3 A;  2PJL A;  3L0J A;  4REF A;  5DXR A;  1T63 A;  3A9E B;  1XDK B;  2YLY A;  4FHI A;  4G1D A;  1FCZ A;  5HJP A;  1T5Z A;  3CS4 A;  3OKI A;  2Q61 A;  1YOW A;  5DXE A;  1SJ0 A;  1A28 A;  2GPV A;  2IHQ A;  4MG5 A;  3CTB A;  3VJS A;  5DK9 A;  4Q0A C;  1XLS E;  3OLF A;  3AX8 A;  3UVV B;  4OFR A;  4RZF A;  1K7L A;  3ADV A;  4OAR A;  4QE8 A;  5DXP A;  1FM9 D;  4MGB B;  5AK2 A;  5APK A;  3SP9 A;  4PP6 A;  3K22 A;  2OZ7 A;  1HG4 A;  2B1Z A;  4OGH A;  3B66 A;  4PXM A;  3X1I A;  3VT4 A;  4DK7 A;  1XVP A;  4RZE A;  4G2H A;  3FEJ A;  1FM6 A;  4G2I A;  4LBD A;  5AZT A;  3DY6 A;  3GN8 A;  4IUI A;  4MG8 B;  4RWV A;  4F9M A;  1UHL B;  1SQN A;  1T74 A;  2AXA A;  3ET2 A;  2GIU A;  4DOS A;  4WVD A;  2ZMH A;  1R20 A;  2PIX A;  5DTV A;  3L1B A;  3R2A A;  5FQV A;  5G44 A;  1R1K D;  2ABI A;  4ZOM A;  3VJT A;  1MV9 A;  3KYT A;  4ITE A;  4IV4 A;  3IPS A;  4J5W C;  4CSJ A;  1YYE A;  3W0G A;  3VSO A;  3ADU A;  5AWK A;  2P54 A;  5AWJ A;  5DYD A;  2PIQ A;  3V9Y A;  3DZY A;  2XYW A;  1T7R A;  1QKT A;  2FAI A;  2HFP A;  2Z4B A;  2GWX A;  4OED A;  2QAB A;  5L7H A;  4FNE A;  4ZN9 A;  4OH6 A;  5FQR A;  4CI5 A;  4ZNV A;  4OIU A;  4JYH A;  2ZL9 A;  5DP0 A;  2QGW A;  4XLD A;  5GT4 A;  5KCU A;  1X7R A;  2J14 A;  1A52 A;  1BSX A;  4MG7 A;  1NAX A;  1XVP B;  3K8S A;  2P1T A;  1NYX A;  4S15 A;  1XJ7 A;  2ZBS A;  1UOM A;  2VV4 A;  3JZB A;  5DX3 A;  2OAX A;  3HQ5 A;  1YUC A;  4ZNS A;  5DIE A;  3V9V A;  3W5P A;  3X36 A;  5DWL A;  2Q59 A;  2ZLA A;  2HAM A;  1PK5 A;  5G42 A;  3VT6 A;  3OZJ A;  1ZDT A;  4OJ9 A;  1XP9 A;  2ZNP A;  4IA2 A;  4Q50 A;  5G5W A;  2YLO A;  1GWX A;  2ZY0 A;  3IMY A;  3OMO A;  4K7A A;  1HJ1 A;  1T79 A;  2QA8 A;  4POH A;  5HYR A;  4LNW A;  3D57 A;  5M96 A;  2ZK0 A;  2AYR A;  4OIV A;  3OOF A;  3W0C A;  5E19 A;  2IOG A;  2P15 A;  3KDT A;  4JYG A;  3TX7 B;  4IA7 A;  4G1Z A;  5E15 A;  3ET3 A;  3WT7 A;  5KCW A;  2AA6 A;  2HVC A;  4J24 A;  1NRL A;  4K4J A;  3CJW A;  2OUZ A;  1XNN A;  4MG7 B;  3U9Q A;  5DX3 B;  2VV4 B;  2ZAS A;  2QPY A;  3G9E A;  3HC6 A;  2HWQ A;  1UPW A;  2P1V A;  3W0J A;  5KRO A;  4WQP A;  2NXX A;  3B68 A;  2ZFX A;  3TKM A;  2Q59 B;  4CI4 A;  4QM0 A;  2ZK4 A;  3VSP A;  3GZ9 A;  1S9Q A;  4DMA A;  2YAT A;  4OZT E;  1IE8 A;  1XAP A;  4LSJ A;  1NAV A;  3KPZ A;  5AZV A;  4DQM A;  1Y9R A;  3AZ2 A;  2J7Y A;  3OLL A;  5DKB A;  1U3S A;  2QA8 B;  5KCF A;  4A4W A;  4X1G A;  4JL4 A;  2LBD A;  4NB6 A;  1OSH A;  4L98 A;  3X31 A; 
#chains in the Genus database with same CATH homology
 3ET0 A;  2AB2 A;  4G21 A;  3CQV A;  1P8D A;  2ATH A;  2REW A;  5LGA A;  2Q5S A;  2J7X A;  3UUA B;  2NXX E;  3KBA A;  1XDK A;  5DMC A;  5H1E A;  2V0V A;  3WTQ A;  4REE A;  4JGV A;  2ZLC A;  4QK4 A;  4X1F A;  4M8H A;  4DK8 A;  1S19 A;  1EXX A;  3VRT A;  5JY3 A;  3UP0 A;  3P89 A;  2P4Y A;  4M8E A;  2R40 D;  4IWC A;  4N8R A;  1RJK A;  3VT5 A;  2BAW A;  2PIW A;  3IPQ A;  5FQP A;  5KRJ A;  4OHA A;  2P1U A;  1Q4X A;  4PRG A;  4PPS A;  3TY0 A;  4IQR A;  3BC5 A;  2QH6 A;  4HEE X;  1I7G A;  1X7E A;  3OMQ A;  4MDD A;  5L11 A;  3R8A A;  2R6W A;  2YJD A;  3A3Z X;  5HZC A;  2HWR A;  3MNO A;  5DWJ A;  1L2I A;  1NDE A;  5DZH A;  3RLL A;  3UP3 A;  2QGT A;  2VSR A;  4MG8 A;  2GPU A;  4PVU A;  2AA5 A;  3FLI A;  3H0A D;  2Q1V A;  3HVL A;  2PIT A;  2GP7 A;  3VI8 A;  3WGP A;  3OKH A;  3VT9 A;  2OVH A;  3G0W A;  5C4T A;  5KRL A;  4FGY A;  3WFG A;  1ZEO A;  4DM6 A;  3HZF A;  1IE9 A;  1RKG A;  5KRM A;  1XQC A;  4NY9 A;  3B0Q A;  4IV2 A;  5L7G A;  1KV6 A;  2OCF A;  5KCT A;  2B23 A;  4J5W A;  3KMR A;  5APJ A;  4LNX A;  5SYZ A;  3W0I A;  1ZDU A;  1XB7 A;  3W0Y A;  2O9I A;  1P93 A;  5E1C A;  5EJV A;  3W5R A;  1PQ9 A;  1R5K A;  4ZNH A;  4JAZ A;  3KMG A;  5DWG A;  5DUH A;  5DID A;  1ZAF A;  1YMT A;  1I38 A;  2QMV A;  4UDB A;  5KCC A;  3MNP A;  1FCY A;  2EWP A;  1M7W A;  2Q5G A;  4OFU A;  5DXG A;  5HJS A;  4R6S A;  2AX9 A;  3VHW A;  3VN2 A;  5KRC A;  5CJ6 A;  5EI1 A;  1S9P A;  3W5T A;  3FEI A;  2HCD A;  2I0G A;  3O1E A;  3HC5 A;  4E2J A;  4QJR A;  4TV1 B;  4P6X A;  4OLM A;  1SKX A;  1FM6 D;  1I7I A;  1Y0S A;  2AMA A;  1RDT D;  3OSW A;  3F7D A;  2VV0 A;  4S14 A;  4TUZ A;  1L2J A;  5GIC A;  3V3Q A;  1NQ0 A;  1YJE A;  2O4R A;  1OT7 A;  4G1Y A;  4OZR U;  3RUU A;  2I4Z A;  5DXB B;  2QTU A;  1S0X A;  1X78 A;  2JF9 A;  1R20 D;  2P7A A;  2PRG A;  1E3G A;  3ADS A;  3E94 A;  1X76 A;  3L03 A;  4KZI A;  4XT9 A;  5DY8 A;  5AAV A;  2VV1 A;  1G2N A;  4RFW A;  3SZ1 A;  1R1K A;  3HM1 A;  2HB8 A;  3OMM A;  1NHZ A;  3OMP A;  2G44 A;  1I37 A;  2B1V A;  4OJB A;  3V49 A;  1GWR A;  2YJA B;  4A2J A;  3A2J A;  3SP6 A;  3DZY D;  4ZI1 A;  1PZL A;  5FQT A;  3GWS X;  4OH5 A;  3VTB A;  2QXS A;  1U3R A;  3LBD A;  2NW4 A;  3D6D A;  5KR9 A;  3ADT A;  1VJB A;  1G50 A;  2Q7I A;  2ZNO A;  3NSP A;  4IA3 A;  4L96 A;  4UDD A;  2HAS A;  5AVI A;  5C4O A;  3WT6 A;  3E00 D;  3B67 A;  3DCT A;  5C4U A;  4ZNT A;  4PP3 A;  5E0X A;  5KYJ A;  5I4V A;  3A2I A;  1K4W A;  2ZNQ A;  3K6P A;  3B5R A;  4TUZ B;  3DZU A;  4N73 A;  5GID A;  1OVL A;  1H9U A;  4N1Y A;  4EM9 A;  2ZK5 A;  3DR1 A;  4IU7 A;  5DKS A;  5AAV B;  2ZK3 A;  2XHS A;  1RKH A;  1R6G A;  2V7C A;  2VV1 B;  3WJ5 A;  3VJI A;  3CWD A;  3DT3 A;  3B1M A;  3OGT A;  4Q13 A;  3IA6 A;  2I0J A;  4OIL A;  4O8F A;  4OKB A;  2OVM A;  3GWX A;  3UUA A;  2HAR A;  5DZ0 A;  3G8I A;  2ZMJ A;  2ZK6 A;  4OKX A;  5IAW A;  2Q6J A;  5DU5 A;  2ACL B;  4RUJ A;  2PIN A;  3IXP A;  1T73 A;  4IA1 A;  4KZJ A;  4N5G A;  4P6W A;  5JJM B;  1K74 D;  1PQ6 A;  2I4P A;  4ITF A;  5DIG A;  5JI0 D;  2ZKC A;  3AUQ A;  3V9T A;  3ZRB A;  4OJ4 A;  3PO9 A;  4MG6 A;  1QKU A;  4XI3 A;  4R06 A;  1OVL B;  3VJH A;  5G45 A;  2XYJ A;  4WHG A;  3KMZ A;  4OC7 A;  1T7T A;  4OEY A;  1Z95 A;  2AMB A;  2R6Y A;  2Q7L A;  4RE8 A;  3KDU A;  1ZUC A;  3OS9 A;  4IWF A;  1NQ2 A;  1QKM A;  3GYT A;  2H77 A;  4XHD A;  2G5O A;  3ZQT A;  4K6I A;  3GD2 A;  2FSZ A;  1N46 A;  4G20 A;  5DZ3 A;  4EMA A;  3N00 A;  4NQA B;  3R5N A;  5DUE A;  2HC4 A;  4J5X C;  4XUM A;  3UUD A;  1UPV A;  4ZNU A;  3WT5 A;  4MG9 A;  3P8X A;  1S0Z A;  4RMC A;  3M7R A;  1ILH A;  2H79 A;  4HLW A;  2GTK A;  3ADX A;  4IW8 A;  5E0W A;  5EGV A;  5DV3 A;  2Q6S A;  2AA2 A;  2Q8S A;  2QSE A;  4YPQ A;  1RK3 A;  5K13 A;  2YLQ A;  5AVL A;  1G5Y A;  3AZ1 A;  2Q70 A;  2G0H A;  2YLP A;  4ZO1 X;  1TFC A;  3AZ3 A;  3L0L A;  4A4V A;  4E4K A;  4WHF A;  1Y0X X;  4RMD A;  2R40 A;  3A78 A;  3B0R A;  3OS8 C;  2Q1H A;  5KRF A;  4POJ A;  1PQC A;  5F9B A;  1FBY A;  4QE6 A;  4TV1 A;  2AX8 A;  5EIT A;  2AAX A;  5KYA A;  2QA6 A;  2QNV A;  5E14 A;  3PRG A;  3BEJ A;  1QKN A;  3UUD B;  1G1U A;  5KRK A;  4MG9 B;  3RUT A;  2Q6R A;  2J4A A;  4OEZ A;  5DV6 A;  5DZI A;  4WPF A;  3OSA A;  2QE4 A;  3H0A A;  3K23 A;  3PLZ A;  5DXB A;  1U9E A;  5B41 A;  5LWP A;  5GIE A;  1FD0 A;  2QZO B;  5KD9 A;  5DLR A;  4Y29 A;  5DWE A;  4RAK A;  2VST A;  4ONI A;  4B7W A;  4S0T A;  1ZGY A;  2ZK1 A;  3L3Z A;  2XKW A;  2BJ4 A;  3RY9 A;  3D5F A;  5A86 A;  5DVV A;  2W8Y A;  2PIO A;  3VRW A;  4RUP A;  1KNU A;  2PKL A;  4MGD A;  2ZK2 A;  1FM9 A;  1GS4 A;  3D90 A;  3OLS A;  4JYI A;  4XTA A;  3ZR7 A;  1SR7 A;  3AUN A;  3PBA A;  3ZRA A;  1T7F A;  4YNK A;  5DKE A;  3B0W A;  1X7J A;  2POB A;  3Q95 A;  4IVW A;  5KRI A;  3UUC A;  1N4H A;  1DKF A;  1NQ1 A;  3FUR A;  3WMH A;  2PIU A;  4PP5 A;  4NUF A;  5DV8 A;  2VV2 A;  3L0E A;  5DRM A;  4OZR E;  3VT8 A;  3T03 A;  2ZVT A;  5KCD A;  3OMK A;  2GPO A;  3A2H A;  4S0S A;  5G43 A;  2A3I A;  4ZNW A;  1RDT A;  2AA7 A;  3DCU A;  3TKC A;  4R2U A;  3O1D A;  2QW4 A;  5ACC A;  4RME A;  3ET1 A;  2ZXZ A;  2JFA A;  3CS8 A;  5DKG A;  1ERE A;  5E7V A;  3VTD A;  1N83 A;  5KRH A;  2BJ4 B;  3B3K A;  4OKT A;  5EC9 A;  2ACL A;  4FN9 A;  3WFF A;  1XV9 A;  5HJP B;  1ILG A;  3R29 A;  4MGD B;  5DVS A;  4ZN7 A;  2ZXN A;  3HOD A;  1NUO A;  3NOA A;  3QT0 A;  3WWR A;  5JJM A;  4IS8 A;  4RUO X;  2ZNN A;  3LMP A;  5AYG A;  1YIN A;  4XUH A;  1DB1 A;  3VHV A;  3Q95 B;  3AN4 A;  3OSI A;  3EYB A;  3E7C A;  4J26 A;  1DKF B;  3HO0 A;  3VHU A;  2XYX A;  3IPU A;  3W5Q A;  2AWH A;  2YFE A;  4UDC A;  3V3E A;  3ERD A;  2P7Z A;  1T65 A;  3E00 A;  5DWI A;  3HLV A;  1XPC A;  5DVC A;  1YIM A;  5DL4 A;  5DXQ A;  3DZU D;  5L7E A;  3H52 A;  4KZM A;  1WM0 X;  1PCG A;  1XOW A;  3X1H A;  1LBD A;  3UU7 A;  5KRA A;  2PIP L;  2I4J A;  1PDU A;  1YOK A;  4YMQ A;  2JFA B;  5KCE A;  3B65 A;  2GPP A;  3GBK A;  5G3J A;  1PRG A;  4PLE A;  2YHD A;  4J5X A;  1XIU A;  4PF3 A;  4ZO1 B;  2HB7 A;  2PIR A;  1XV9 B;  5EHJ A;  2Q7K A;  4PLD A;  3F5C A;  1XP6 A;  3OAP A;  5ICK A;  2P7G A;  1ZKY A;  1LV2 A;  1GWQ A;  1NQ7 A;  4LTW A;  3P88 A;  1M2Z A;  3PCU A;  4IW6 A;  4QL8 A;  2Q7J A;  2GL8 A;  3FS1 A;  3IXP D;  2PIV A;  4DM8 A;  2POG A;  3D24 A;  3FAL A;  3W0H A;  2PNU A;  2VV3 A;  3RLJ A;  1K74 A;  1E3K A;  2AX7 A;  2QXM A;  2F4B A;  5DRJ A;  2AX6 A;  3R8I A;  1YP0 A;  3VT7 A;  4BCR A;  1X7B A;  2Z4J A;  3UU7 B;  1YY4 A;  3OS8 A;  3PEQ A;  2NV7 A;  1XZX X;  2E2R A;  2ZXM A;  2B50 A;  2JJ3 A;  3AUR A;  3CS6 A;  5DYB A;  3FUG A;  4RZG A;  3VTC A;  1ZH7 A;  4OZT U;  2IOK A;  1XP1 A;  3ADW A;  3CLD A;  3F5C B;  4PPP A;  3VRU A;  4YT1 A;  2G0G A;  5C4S A;  3MNE A;  3G8O A;  3AN3 A;  1EXA A;  1T7M A;  1MZN A;  4OKW A;  5DMF A;  2QZO A;  1T76 A;  2Q3Y A;  2HBH A;  3ILZ A;  1ERR A;  4MGA A;  2OM9 A;  2ZMI A;  3FXV A;  3VRV A;  4ZJR A;  5IXK A;  3FAL B;  4WLB A;  4DOR A;  4XAO A;  3CDS A;  5FQS A;  3FC6 A;  3KWY A;  5AAU A;  4MGC A;  5DZ1 A;  3A9E A;  3R8D A;  3OOK A;  2QR9 A;  4OEA A;  5B5B A;  3V4A A;  1U3Q A;  1Z5X U;  2O4J A;  3A40 X;  5DXK A;  3VT3 A;  5G46 A;  5HCV A;  1Z5X E;  4E4Q A;  4APU A;  4UDA A;  3BQD A;  2NPA A;  4IVY A;  3NSQ A;  1XNX A;  5DXM A;  5IZ0 A;  3RVF A;  3KFC A;  5DSH A;  3P0U A;  2Q5P A;  3L3X A;  3UVV A;  3WJ4 A;  1MVC A;  3S9S A;  1YA3 A;  4MGB A;  4NIE A;  5ETH A;  4ZJW A;  1FCX A;  4FHH A;  4OK1 A;  1OSV A;  5APH A;  3W0A A;  1XLS A;  3OZ0 A;  3AFR A;  2AO6 A;  3ERT A;  1TXI A;  3B0T A;  3R5M A;  5DUG A;  1KKQ A;  1M13 A;  4MGA B;  1UHL A;  2FVJ A;  4PWL A;  3JZC A;  2Q60 A;  3CDP A;  2AM9 A;  3GYU A;  5DI7 A;  3FC6 B;  5HYK A;  1XQ3 A;  2PJL A;  3L0J A;  4REF A;  5DXR A;  1T63 A;  3A9E B;  1XDK B;  2YLY A;  4FHI A;  4G1D A;  1FCZ A;  5HJP A;  1T5Z A;  3CS4 A;  3OKI A;  2Q61 A;  1YOW A;  5DXE A;  1SJ0 A;  1A28 A;  2GPV A;  2IHQ A;  4MG5 A;  3CTB A;  3VJS A;  5DK9 A;  4Q0A C;  1XLS E;  3OLF A;  3AX8 A;  3UVV B;  4OFR A;  4RZF A;  1K7L A;  3ADV A;  4OAR A;  4QE8 A;  5DXP A;  1FM9 D;  4MGB B;  5AK2 A;  5APK A;  3SP9 A;  4PP6 A;  3K22 A;  2OZ7 A;  1HG4 A;  2B1Z A;  4OGH A;  3B66 A;  4PXM A;  3X1I A;  3VT4 A;  4DK7 A;  1XVP A;  4RZE A;  4G2H A;  3FEJ A;  1FM6 A;  4G2I A;  4LBD A;  5AZT A;  3DY6 A;  3GN8 A;  4IUI A;  4MG8 B;  4RWV A;  4F9M A;  1UHL B;  1SQN A;  1T74 A;  2AXA A;  3ET2 A;  2GIU A;  4DOS A;  4WVD A;  2ZMH A;  1R20 A;  2PIX A;  5DTV A;  3L1B A;  3R2A A;  5FQV A;  5G44 A;  1R1K D;  2ABI A;  4ZOM A;  3VJT A;  1MV9 A;  3KYT A;  4ITE A;  4IV4 A;  3IPS A;  4J5W C;  4CSJ A;  1YYE A;  3W0G A;  3VSO A;  3ADU A;  5AWK A;  2P54 A;  5AWJ A;  5DYD A;  2PIQ A;  3V9Y A;  3DZY A;  2XYW A;  1T7R A;  1QKT A;  2FAI A;  2HFP A;  2Z4B A;  2GWX A;  4OED A;  2QAB A;  5L7H A;  4FNE A;  4ZN9 A;  4OH6 A;  5FQR A;  4CI5 A;  4ZNV A;  4OIU A;  4JYH A;  2ZL9 A;  5DP0 A;  2QGW A;  4XLD A;  5GT4 A;  5KCU A;  1X7R A;  2J14 A;  1A52 A;  1BSX A;  4MG7 A;  1NAX A;  1XVP B;  3K8S A;  2P1T A;  1NYX A;  4S15 A;  1XJ7 A;  2ZBS A;  1UOM A;  2VV4 A;  3JZB A;  5DX3 A;  2OAX A;  3HQ5 A;  1YUC A;  4ZNS A;  5DIE A;  3V9V A;  3W5P A;  3X36 A;  5DWL A;  2Q59 A;  2ZLA A;  2HAM A;  1PK5 A;  5G42 A;  3VT6 A;  3OZJ A;  1ZDT A;  4OJ9 A;  1XP9 A;  2ZNP A;  4IA2 A;  4Q50 A;  5G5W A;  2YLO A;  1GWX A;  2ZY0 A;  3IMY A;  3OMO A;  4K7A A;  1HJ1 A;  1T79 A;  2QA8 A;  4POH A;  5HYR A;  4LNW A;  3D57 A;  5M96 A;  2ZK0 A;  2AYR A;  4OIV A;  3OOF A;  3W0C A;  5E19 A;  2IOG A;  2P15 A;  3KDT A;  4JYG A;  3TX7 B;  4IA7 A;  4G1Z A;  5E15 A;  3ET3 A;  3WT7 A;  5KCW A;  2AA6 A;  2HVC A;  4J24 A;  1NRL A;  4K4J A;  3CJW A;  2OUZ A;  1XNN A;  4MG7 B;  3U9Q A;  5DX3 B;  2VV4 B;  2ZAS A;  2QPY A;  3G9E A;  3HC6 A;  2HWQ A;  1UPW A;  2P1V A;  3W0J A;  5KRO A;  4WQP A;  2NXX A;  3B68 A;  2ZFX A;  3TKM A;  2Q59 B;  4CI4 A;  4QM0 A;  2ZK4 A;  3VSP A;  3GZ9 A;  1S9Q A;  4DMA A;  2YAT A;  4OZT E;  1IE8 A;  1XAP A;  4LSJ A;  1NAV A;  3KPZ A;  5AZV A;  4DQM A;  1Y9R A;  3AZ2 A;  2J7Y A;  3OLL A;  5DKB A;  1U3S A;  2QA8 B;  5KCF A;  4A4W A;  4X1G A;  4JL4 A;  2LBD A;  4NB6 A;  1OSH A;  4L98 A;  3X31 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...