5JJMA

Crystal structure of homodimeric androgen receptor ligand-binding domain bound to dht and lxxll peptide
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
252
structure length
252
Chain Sequence
ECQPIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSRMLYFAPDLVFNEYRMHKSRMYSQCVRMRHLSQEFGWLQITPQEFLCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELDRIIACKRKNPTSCSRRFYQLTKLLDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEIISVQVPKILSGKVKPIYFHTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Androgen receptor
publication title Structure of the homodimeric androgen receptor ligand-binding domain.
pubmed doi rcsb
source organism Homo sapiens
total genus 98
structure length 252
sequence length 252
chains with identical sequence C, D
ec nomenclature
pdb deposition date 2016-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 5jjmA00
4A4WA 3A2JA 1L2IA 4ZOMA 3DZYA 1OVLB 1R20D 3CS4A 3OKIA 3IPSA 1PQ6A 1RK3A 3FURA 2AA6A 4ZNWA 4QL8A 3GWXA 3UP0A 3AFRA 2Q70A 1A52A 4WQPA 3W0CA 4IU7A 4POJA 2Q59A 1BSXA 2REWA 5F9BA 3WJ4A 3N00A 4X1FA 1L2JA 4RZFA 5G43A 3VHUA 5DV3A 5DXKA 5KYJA 5JJMA 1YJEA 3VN2A 4FNEA 2QA6A 5DKGA 3R29A 2QPYA 4PF3A 3WT5A 3OZ0A 2Z4BA 3R5MA 2P7ZA 4IA1A 2Q6SA 3KWYA 4IW6A 2F4BA 5EITA 3X1IA 1IE9A 2QH6A 3VHVA 3AUQA 1VJBA 2QA8A 4IWFA 3B0QA 3A9EA 1XDKA 3DT3A 1G50A 2PIWA 5JI0D 4QM0A 3L3XA 3IXPD 5DKEA 4L98A 5KRIA 1U9EA 3D24A 3E00D 3CDSA 4MGAA 3R2AA 4UDCA 2IOGA 4FHIA 2Q61A 3L0JA 5HYKA 1T74A 5HYRA 5AWJA 1R5KA 1ZDTA 1ZKYA 3GBKA 2ZNOA 2Q6JA 2G5OA 1TXIA 1ZGYA 3F5CA 4K7AA 5GIEA 2Q1VA 3W0AA 4E4QA 4MG9A 1ILGA 1G1UA 1NUOA 4K4JA 2AA5A 1UOMA 3ADTA 3FC6B 4L96A 3RVFA 4R2UA 2AXAA 4ZJWA 5KCCA 4LSJA 3OS8C 4FHHA 2HBHA 3X36A 3UUCA 5E19A 3KMZA 3OLFA 3FEJA 3UP3A 4REEA 3HQ5A 4PVUA 2QW4A 2VV3A 2Z4JA 5AAVA 3O1DA 5DRJA 2IOKA 3B1MA 5DMFA 4OFRA 4ZNVA 4POHA 3ADVA 1H9UA 1NRLA 1U3SA 2Q60A 1Z5XE 4ZO1X 1X7JA 2P1UA 5EHJA 4N73A 1XVPB 1OSHA 1QKUA 4IVWA 4ZI1A 3VT7A 1XIUA 1XB7A 2BJ4B 4XLDA 3UVVA 2ZK1A 4IA7A 5E1CA 3WTQA 1T76A 5DXBA 1GWRA 1XZXX 5LWPA 3SP9A 3VT5A 4ITFA 3CDPA 4B7WA 2I4ZA 4ZNSA 3KMRA 3AZ1A 2ZLAA 2I4PA 3ERTA 2LBDA 4YPQA 3P8XA 4J5WA 3KYTA 1RKGA 2Q7KA 2QE4A 2GPVA 2HB7A 2IHQA 2FSZA 2OUZA 3Q95A 3PRGA 4HLWA 4XUHA 2I0GA 5DI7A 3WWRA 4YT1A 5GIDA 2HWQA 2YLQA 2H79A 3MNOA 4WLBA 4IW8A 3V49A 5KRAA 3OZJA 4M8EA 1A28A 1WM0X 2ZK5A 4S14A 5DZ1A 4IWCA 2Q59B 2AA7A 5FQPA 1ZEOA 4N8RA 4X1GA 2PINA 5HJSA 3PCUA 5L7HA 3SZ1A 5DXRA 2P1TA 4RAKA 5FQSA 3VTDA 4S15A 2PIQA 1XP6A 2ZK3A 4ZNHA 5DX3A 2E2RA 1FCZA 1R6GA 2Q1HA 1XVPA 3D6DA 3VTBA 2PIRA 3ZQTA 2P15A 4PP5A 3QT0A 3OMPA 4R06A 4PRGA 1RJKA 2Q5GA 3AUNA 2BJ4A 5DV8A 4QE8A 2OZ7A 3UUDA 2QZOA 3V3QA 1Z95A 3A9EB 1XDKB 3HM1A 3P88A 5DVCA 2NV7A 1FM6A 5DKSA 4OH6A 5IZ0A 5C4SA 3ILZA 4OFUA 4TV1B 5G5WA 5KD9A 2B1VA 3WFGA 1XNNA 4MGAB 4ZO1B 1G5YA 2PIOA 2QABA 2YLPA 2Q5SA 1K74D 3NSQA 2GTKA 5B5BA 2HASA 1XV9A 4MG8A 4NUFA 2B50A 3ADWA 4RMDA 1T7MA 1T73A 5DYBA 4DOSA 5KCFA 2P54A 1P8DA 1PK5A 3F5CB 1YOKA 3B5RA 1XJ7A 1XPCA 3OLLA 1M13A 4MG6A 2NXXE 5KRLA 5DZ0A 3LBDA 4MG9B 4OHAA 4E4KA 3P89A 2J4AA 3FLIA 2HWRA 3HC6A 3K23A 2ZXNA 3DCTA 3W5PA 3TKCA 3ZR7A 1XQ3A 3VT6A 4P6WA 4ZJRA 2R40D 3V3EA 4RUJA 4PPSA 4OIVA 5AAVB 2ACLA 3RLJA 3T03A 1ZAFA 1QKNA 1FD0A 5G46A 2Q5PA 1OT7A 5KCTA 3KDTA 1ERRA 2QNVA 2HC4A 4OILA 1N4HA 4OZTE 1KV6A 3JZBA 2ZNQA 1Y0XX 3EYBA 3IPQA 5DRMA 3O1EA 4HEEX 3AN3A 2PNUA 2OVHA 1NAVA 5GICA 2Q6RA 3OS8A 2AO6A 4OGHA 3P0UA 2JFAB 4MGDA 4OZRU 2XKWA 5FQTA 1T7FA 3SP6A 1I37A 5C4UA 3OS9A 2I0JA 3G8IA 3UVVB 2EWPA 4IS8A 3DZUD 4RMCA 2QGWA 5DXBB 3DR1A 3NOAA 2G0GA 4OJ4A 4J5XC 3VSPA 4QE6A 4TV1A 5DXQA 1FBYA 4G1YA 1XQCA 4DM6A 5KRKA 1U3QA 1RKHA 1QKTA 3IMYA 4TUZB 5DVVA 3H0AA 4OEYA 4XI3A 2JJ3A 1NYXA 1GWQA 1Q4XA 4YNKA 5ETHA 3VTCA 2Q7JA 1I38A 2OAXA 3Q95B 5AK2A 4OEDA 3DZYD 4MDDA 5EJVA 1T7RA 1XOWA 4LBDA 1K7LA 5DIDA 3WGPA 3VT4A 4OIUA 5SYZA 1M7WA 3OOKA 4G1DA 5L7EA 4CI5A 2YLOA 1T63A 2Q7LA 3ADSA 3CS6A 3BC5A 3G0WA 2NPAA 3OSWA 4FGYA 5DWLA 3ET1A 1FCYA 1ZUCA 2P7AA 1GWXA 5E14A 2AYRA 4IUIA 5DX3B 4IA3A 2VV4B 3K22A 3L03A 4EM9A 1RDTA 5KRCA 1XNXA 2JFAA 1XLSA 3TY0A 3CWDA 5DVSA 3VRWA 1NQ7A 5ACCA 5L7GA 4XT9A 1YOWA 4OKBA 3UUDB 1FM9A 2QZOB 2ZASA 5DLRA 3WT7A 1LBDA 5HJPA 5DZ3A 2HVCA 3CQVA 2XHSA 4P6XA 5KCEA 2ATHA 4JAZA 2V0VA 3OGTA 2ABIA 2G0HA 4TUZA 1NHZA 2Q8SA 1X7BA 1NQ2A 1UPVA 2Q3YA 3JZCA 4MG5A 1XV9B 4MG8B 1KNUA 3KDUA 5AYGA 3U9QA 3VSOA 3VRVA 2ZK2A 2PITA 4A2JA 4OZRE 4IV2A 3UU7B 5E0WA 3VT9A 3VRTA 5DU5A 2V7CA 5DXMA 4G20A 2HFPA 2ZMHA 4RE8A 5AZTA 1DB1A 2ZMIA 4ZN9A 2ZVTA 1HJ1A 3VHWA 3B66A 3CJWA 5H1EA 3HVLA 4RUPA 2ZNPA 2ACLB 2HCDA 3AX8A 4RUOX 4MG7A 5DMCA 2B23A 5GT4A 4S0TA 3G8OA 4DK7A 4G21A 3DCUA 1Y0SA 3OMMA 3PLZA 4NB6A 3A2IA 4Q13A 3TKMA 3B0WA 5DIGA 5C4OA 4MGBB 5EC9A 5FQVA 5DV6A 3DY6A 2VV4A 1T65A 5KROA 2VV1A 3MNPA 3D90A 4ZNUA 1UHLA 4IA2A 5DZHA 5APKA 3X1HA 4REFA 1GS4A 1R20A 2HARA 4MGDB 3ZRBA 3ET0A 4LTWA 4Q50A 4IV4A 5DTVA 5JY3A 3L0LA 1PQCA 3KMGA 3PEQA 1ILHA 4G2HA 1PCGA 3D5FA 3GD2A 2PIVA 4M8HA 5DXEA 5IXKA 4RWVA 1S0ZA 5KRHA 4NQAB 5K13A 2Q7IA 5KCWA 4UDBA 4JYGA 2XYJA 3WMHA 3ET2A 3RLLA 1S9PA 3B65A 4PXMA 1EXAA 2ZBSA 3HLVA 5KRFA 4DQMA 5AVIA 3B0RA 1E3KA 5AWKA 4QJRA 1TFCA 1X78A 4MGCA 3GN8A 3HZFA 5AAUA 3FALA 1U3RA 1HG4A 3FXVA 4J5XA 4N1YA 2NXXA 3K6PA 2PRGA 1UPWA 5E15A 5KRJA 1PDUA 1PQ9A 3L0EA 1NQ0A 3DZUA 4CI4A 5DUEA 1NAXA 5DYDA 1YUCA 4K6IA 5B41A 3IXPA 4PLEA 3W5QA 1X7EA 3UUAB 4WHGA 3E00A 2VV2A 5DXPA 3HODA 2PKLA 5DUGA 3H52A 2YATA 4XHDA 1NDEA 2A3IA 1KKQA 1DKFA 4XUMA 4MGBA 4OLMA 3W0JA 1LV2A 4JYHA 3VJTA 4O8FA 3TX7B 2PIUA 3GZ9A 4ZN7A 1K4WA 3VI8A 4IQRA 1Z5XU 2AWHA 4E2JA 4OC7A 3WT6A 3OKHA 4J24A 2P1VA 2ZK6A 4KZJA 3V9TA 1Y9RA 3X31A 4JGVA 2W8YA 1FM6D 4PPPA 1R1KD 2QXMA 4APUA 1YIMA 2P7GA 4CSJA 3V9VA 5HJPB 4OK1A 3F7DA 3OLSA 4F9MA 4IVYA 3CS8A 5DIEA 4JYIA 3W5RA 2AMBA 4DM8A 4N5GA 4UDAA 5CJ6A 3FS1A 5DKBA 5DY8A 3AZ3A 5EGVA 3R8IA 2FVJA 5AZVA 5HZCA 4XAOA 3E94A 2AA2A 5C4TA 4OARA 1MZNA 1MV9A 2POBA 3RUTA 2ZFXA 5DWGA 3AN4A 5KYAA 1QKMA 4KZMA 3B3KA 3IA6A 2H77A 5DL4A 1SKXA 2QMVA 1EXXA 3B67A 2QXSA 4WPFA 3W5TA 5A86A 5DWIA 2ZK4A 3AZ2A 2GL8A 2QGTA 3W0IA 3WJ5A 2HB8A 1I7IA 5I4VA 1IE8A 3UUAA 4MG7B 5ICKA 4G1ZA 3OAPA 3OMQA 5KRMA 3BEJA 4LNWA 4OJBA 4DMAA 2VSRA 3VT8A 5DP0A 3GYTA 1YA3A 1M2ZA 2GPPA 2BAWA 2HAMA 3D57A 2FAIA 2VV1B 4UDDA 1OVLA 2GWXA 2XYWA 1UHLB 3CLDA 3VJIA 2ZXZA 2YLYA 3L1BA 1SQNA 4PLDA 4RMEA 3R8DA 1T5ZA 3V9YA 3UU7A 1PRGA 3ET3A 4LNXA 3ZRAA 5EI1A 2PIPL 1NQ1A 2YHDA 4J26A 4OKTA 2O4JA 3V4AA 3VJHA 3H0AD 5DUHA 3KBAA 1OSVA 1MVCA 1YP0A 3PBAA 4PWLA 1N46A 2OM9A 4NIEA 5G3JA 3RUUA 3ERDA 5APJA 3VT3A 4NY9A 2GIUA 3PO9A 2R6WA 1ZDUA 3E7CA 3OOFA 5G45A 4OJ9A 2G44A 1XLSE 2ZK0A 3GYUA 3HC5A 3WFFA 3B68A 2O9IA 4DORA 3FALB 5DWEA 5HCVA 2P4YA 5L11A 4OH5A 3KFCA 3KPZA 5DXGA 4QK4A 4ITEA 2I4JA 3G9EA 2J7YA 4OKWA 1SR7A 3CTBA 2AMAA 2POGA 2ZNNA 3OMOA 2QTUA 3A78A 4OEZA 4Y29A 2R6YA 5KCDA 2GPOA 2YJAB 4RZEA 5APHA 5LGAA 3IPUA 2AX9A 5E7VA 5KR9A 4PP6A 2OVMA 3GWSX 4PP3A 4RFWA 4S0SA 3RY9A 2AX6A 2YJDA 5KCUA 2XYXA 1K74A 2ZY0A 1DKFB 3OSIA 4OKXA 3ADUA 3W0GA 1ZH7A 2GPUA 2ZXMA 2AB2A 1RDTD 4OZTU 1P93A 3A40X 3VJSA 3FEIA 3FUGA 3A2HA 5DZIA 3HO0A 3R5NA 2QR9A 1FM9D 3FC6A 1XAPA 1X7RA 4Q0AC 2AM9A 2ZMJA 2PIXA 2YFEA 3ADXA 3NSPA 4WHFA 5FQRA 4JL4A 2PJLA 1YY4A 1G2NA 1YYEA 1E3GA 3AURA 4ZNTA 1XP9A 4WVDA 4DK8A 5G42A 1T79A 3A3ZX 2R40A 4BCRA 4A4VA 4OEAA 3W0HA 5IAWA 1S19A 4FN9A 3VRUA 2OCFA 5DK9A 1YMTA 1PZLA 2JF9A 5JJMB 2ZL9A 5DWJA 1YINA 5G44A 2GP7A 3L3ZA 1S0XA 3OSAA 4J5WC 4EMAA 1T7TA 3OMKA 2J14A 2VV0A 2ZKCA 1I7GA 2AX8A 3LMPA 1XP1A 2QSEA 3MNEA 2QA8B 4RZGA 3B0TA 5AVLA 1FCXA 1N83A 3K8SA 3R8AA 1R1KA 4ONIA 2O4RA 1SJ0A 1X76A 4KZIA 2AX7A 2AAXA 2VSTA 2ZLCA 2B1ZA 3M7RA 5E0XA 5DSHA 1S9QA 2J7XA 4XTAA 1EREA 3W0YA 3BQDA 3S9SA 4R6SA 4YMQA 5M96A 2NW4A 4G2IA
chains in the Genus database with same CATH superfamily
4A4WA 3A2JA 1L2IA 4ZOMA 3DZYA 1OVLB 1R20D 3CS4A 3OKIA 3IPSA 1PQ6A 1RK3A 3FURA 2AA6A 4ZNWA 4QL8A 3GWXA 3UP0A 3AFRA 2Q70A 1A52A 4WQPA 3W0CA 4IU7A 4POJA 2Q59A 1BSXA 2REWA 5F9BA 3WJ4A 3N00A 4X1FA 1L2JA 4RZFA 5G43A 3VHUA 5DV3A 5DXKA 5KYJA 5JJMA 1YJEA 3VN2A 4FNEA 2QA6A 5DKGA 3R29A 2QPYA 4PF3A 3WT5A 3OZ0A 2Z4BA 3R5MA 2P7ZA 4IA1A 2Q6SA 3KWYA 4IW6A 2F4BA 5EITA 3X1IA 1IE9A 2QH6A 3VHVA 3AUQA 1VJBA 2QA8A 4IWFA 3B0QA 3A9EA 1XDKA 3DT3A 1G50A 2PIWA 5JI0D 4QM0A 3L3XA 3IXPD 5DKEA 4L98A 5KRIA 1U9EA 3D24A 3E00D 3CDSA 4MGAA 3R2AA 4UDCA 2IOGA 4FHIA 2Q61A 3L0JA 5HYKA 1T74A 5HYRA 5AWJA 1R5KA 1ZDTA 1ZKYA 3GBKA 2ZNOA 2Q6JA 2G5OA 1TXIA 1ZGYA 3F5CA 4K7AA 5GIEA 2Q1VA 3W0AA 4E4QA 4MG9A 1ILGA 1G1UA 1NUOA 4K4JA 2AA5A 1UOMA 3ADTA 3FC6B 4L96A 3RVFA 4R2UA 2AXAA 4ZJWA 5KCCA 4LSJA 3OS8C 4FHHA 2HBHA 3X36A 3UUCA 5E19A 3KMZA 3OLFA 3FEJA 3UP3A 4REEA 3HQ5A 4PVUA 2QW4A 2VV3A 2Z4JA 5AAVA 3O1DA 5DRJA 2IOKA 3B1MA 5DMFA 4OFRA 4ZNVA 4POHA 3ADVA 1H9UA 1NRLA 1U3SA 2Q60A 1Z5XE 4ZO1X 1X7JA 2P1UA 5EHJA 4N73A 1XVPB 1OSHA 1QKUA 4IVWA 4ZI1A 3VT7A 1XIUA 1XB7A 2BJ4B 4XLDA 3UVVA 2ZK1A 4IA7A 5E1CA 3WTQA 1T76A 5DXBA 1GWRA 1XZXX 5LWPA 3SP9A 3VT5A 4ITFA 3CDPA 4B7WA 2I4ZA 4ZNSA 3KMRA 3AZ1A 2ZLAA 2I4PA 3ERTA 2LBDA 4YPQA 3P8XA 4J5WA 3KYTA 1RKGA 2Q7KA 2QE4A 2GPVA 2HB7A 2IHQA 2FSZA 2OUZA 3Q95A 3PRGA 4HLWA 4XUHA 2I0GA 5DI7A 3WWRA 4YT1A 5GIDA 2HWQA 2YLQA 2H79A 3MNOA 4WLBA 4IW8A 3V49A 5KRAA 3OZJA 4M8EA 1A28A 1WM0X 2ZK5A 4S14A 5DZ1A 4IWCA 2Q59B 2AA7A 5FQPA 1ZEOA 4N8RA 4X1GA 2PINA 5HJSA 3PCUA 5L7HA 3SZ1A 5DXRA 2P1TA 4RAKA 5FQSA 3VTDA 4S15A 2PIQA 1XP6A 2ZK3A 4ZNHA 5DX3A 2E2RA 1FCZA 1R6GA 2Q1HA 1XVPA 3D6DA 3VTBA 2PIRA 3ZQTA 2P15A 4PP5A 3QT0A 3OMPA 4R06A 4PRGA 1RJKA 2Q5GA 3AUNA 2BJ4A 5DV8A 4QE8A 2OZ7A 3UUDA 2QZOA 3V3QA 1Z95A 3A9EB 1XDKB 3HM1A 3P88A 5DVCA 2NV7A 1FM6A 5DKSA 4OH6A 5IZ0A 5C4SA 3ILZA 4OFUA 4TV1B 5G5WA 5KD9A 2B1VA 3WFGA 1XNNA 4MGAB 4ZO1B 1G5YA 2PIOA 2QABA 2YLPA 2Q5SA 1K74D 3NSQA 2GTKA 5B5BA 2HASA 1XV9A 4MG8A 4NUFA 2B50A 3ADWA 4RMDA 1T7MA 1T73A 5DYBA 4DOSA 5KCFA 2P54A 1P8DA 1PK5A 3F5CB 1YOKA 3B5RA 1XJ7A 1XPCA 3OLLA 1M13A 4MG6A 2NXXE 5KRLA 5DZ0A 3LBDA 4MG9B 4OHAA 4E4KA 3P89A 2J4AA 3FLIA 2HWRA 3HC6A 3K23A 2ZXNA 3DCTA 3W5PA 3TKCA 3ZR7A 1XQ3A 3VT6A 4P6WA 4ZJRA 2R40D 3V3EA 4RUJA 4PPSA 4OIVA 5AAVB 2ACLA 3RLJA 3T03A 1ZAFA 1QKNA 1FD0A 5G46A 2Q5PA 1OT7A 5KCTA 3KDTA 1ERRA 2QNVA 2HC4A 4OILA 1N4HA 4OZTE 1KV6A 3JZBA 2ZNQA 1Y0XX 3EYBA 3IPQA 5DRMA 3O1EA 4HEEX 3AN3A 2PNUA 2OVHA 1NAVA 5GICA 2Q6RA 3OS8A 2AO6A 4OGHA 3P0UA 2JFAB 4MGDA 4OZRU 2XKWA 5FQTA 1T7FA 3SP6A 1I37A 5C4UA 3OS9A 2I0JA 3G8IA 3UVVB 2EWPA 4IS8A 3DZUD 4RMCA 2QGWA 5DXBB 3DR1A 3NOAA 2G0GA 4OJ4A 4J5XC 3VSPA 4QE6A 4TV1A 5DXQA 1FBYA 4G1YA 1XQCA 4DM6A 5KRKA 1U3QA 1RKHA 1QKTA 3IMYA 4TUZB 5DVVA 3H0AA 4OEYA 4XI3A 2JJ3A 1NYXA 1GWQA 1Q4XA 4YNKA 5ETHA 3VTCA 2Q7JA 1I38A 2OAXA 3Q95B 5AK2A 4OEDA 3DZYD 4MDDA 5EJVA 1T7RA 1XOWA 4LBDA 1K7LA 5DIDA 3WGPA 3VT4A 4OIUA 5SYZA 1M7WA 3OOKA 4G1DA 5L7EA 4CI5A 2YLOA 1T63A 2Q7LA 3ADSA 3CS6A 3BC5A 3G0WA 2NPAA 3OSWA 4FGYA 5DWLA 3ET1A 1FCYA 1ZUCA 2P7AA 1GWXA 5E14A 2AYRA 4IUIA 5DX3B 4IA3A 2VV4B 3K22A 3L03A 4EM9A 1RDTA 5KRCA 1XNXA 2JFAA 1XLSA 3TY0A 3CWDA 5DVSA 3VRWA 1NQ7A 5ACCA 5L7GA 4XT9A 1YOWA 4OKBA 3UUDB 1FM9A 2QZOB 2ZASA 5DLRA 3WT7A 1LBDA 5HJPA 5DZ3A 2HVCA 3CQVA 2XHSA 4P6XA 5KCEA 2ATHA 4JAZA 2V0VA 3OGTA 2ABIA 2G0HA 4TUZA 1NHZA 2Q8SA 1X7BA 1NQ2A 1UPVA 2Q3YA 3JZCA 4MG5A 1XV9B 4MG8B 1KNUA 3KDUA 5AYGA 3U9QA 3VSOA 3VRVA 2ZK2A 2PITA 4A2JA 4OZRE 4IV2A 3UU7B 5E0WA 3VT9A 3VRTA 5DU5A 2V7CA 5DXMA 4G20A 2HFPA 2ZMHA 4RE8A 5AZTA 1DB1A 2ZMIA 4ZN9A 2ZVTA 1HJ1A 3VHWA 3B66A 3CJWA 5H1EA 3HVLA 4RUPA 2ZNPA 2ACLB 2HCDA 3AX8A 4RUOX 4MG7A 5DMCA 2B23A 5GT4A 4S0TA 3G8OA 4DK7A 4G21A 3DCUA 1Y0SA 3OMMA 3PLZA 4NB6A 3A2IA 4Q13A 3TKMA 3B0WA 5DIGA 5C4OA 4MGBB 5EC9A 5FQVA 5DV6A 3DY6A 2VV4A 1T65A 5KROA 2VV1A 3MNPA 3D90A 4ZNUA 1UHLA 4IA2A 5DZHA 5APKA 3X1HA 4REFA 1GS4A 1R20A 2HARA 4MGDB 3ZRBA 3ET0A 4LTWA 4Q50A 4IV4A 5DTVA 5JY3A 3L0LA 1PQCA 3KMGA 3PEQA 1ILHA 4G2HA 1PCGA 3D5FA 3GD2A 2PIVA 4M8HA 5DXEA 5IXKA 4RWVA 1S0ZA 5KRHA 4NQAB 5K13A 2Q7IA 5KCWA 4UDBA 4JYGA 2XYJA 3WMHA 3ET2A 3RLLA 1S9PA 3B65A 4PXMA 1EXAA 2ZBSA 3HLVA 5KRFA 4DQMA 5AVIA 3B0RA 1E3KA 5AWKA 4QJRA 1TFCA 1X78A 4MGCA 3GN8A 3HZFA 5AAUA 3FALA 1U3RA 1HG4A 3FXVA 4J5XA 4N1YA 2NXXA 3K6PA 2PRGA 1UPWA 5E15A 5KRJA 1PDUA 1PQ9A 3L0EA 1NQ0A 3DZUA 4CI4A 5DUEA 1NAXA 5DYDA 1YUCA 4K6IA 5B41A 3IXPA 4PLEA 3W5QA 1X7EA 3UUAB 4WHGA 3E00A 2VV2A 5DXPA 3HODA 2PKLA 5DUGA 3H52A 2YATA 4XHDA 1NDEA 2A3IA 1KKQA 1DKFA 4XUMA 4MGBA 4OLMA 3W0JA 1LV2A 4JYHA 3VJTA 4O8FA 3TX7B 2PIUA 3GZ9A 4ZN7A 1K4WA 3VI8A 4IQRA 1Z5XU 2AWHA 4E2JA 4OC7A 3WT6A 3OKHA 4J24A 2P1VA 2ZK6A 4KZJA 3V9TA 1Y9RA 3X31A 4JGVA 2W8YA 1FM6D 4PPPA 1R1KD 2QXMA 4APUA 1YIMA 2P7GA 4CSJA 3V9VA 5HJPB 4OK1A 3F7DA 3OLSA 4F9MA 4IVYA 3CS8A 5DIEA 4JYIA 3W5RA 2AMBA 4DM8A 4N5GA 4UDAA 5CJ6A 3FS1A 5DKBA 5DY8A 3AZ3A 5EGVA 3R8IA 2FVJA 5AZVA 5HZCA 4XAOA 3E94A 2AA2A 5C4TA 4OARA 1MZNA 1MV9A 2POBA 3RUTA 2ZFXA 5DWGA 3AN4A 5KYAA 1QKMA 4KZMA 3B3KA 3IA6A 2H77A 5DL4A 1SKXA 2QMVA 1EXXA 3B67A 2QXSA 4WPFA 3W5TA 5A86A 5DWIA 2ZK4A 3AZ2A 2GL8A 2QGTA 3W0IA 3WJ5A 2HB8A 1I7IA 5I4VA 1IE8A 3UUAA 4MG7B 5ICKA 4G1ZA 3OAPA 3OMQA 5KRMA 3BEJA 4LNWA 4OJBA 4DMAA 2VSRA 3VT8A 5DP0A 3GYTA 1YA3A 1M2ZA 2GPPA 2BAWA 2HAMA 3D57A 2FAIA 2VV1B 4UDDA 1OVLA 2GWXA 2XYWA 1UHLB 3CLDA 3VJIA 2ZXZA 2YLYA 3L1BA 1SQNA 4PLDA 4RMEA 3R8DA 1T5ZA 3V9YA 3UU7A 1PRGA 3ET3A 4LNXA 3ZRAA 5EI1A 2PIPL 1NQ1A 2YHDA 4J26A 4OKTA 2O4JA 3V4AA 3VJHA 3H0AD 5DUHA 3KBAA 1OSVA 1MVCA 1YP0A 3PBAA 4PWLA 1N46A 2OM9A 4NIEA 5G3JA 3RUUA 3ERDA 5APJA 3VT3A 4NY9A 2GIUA 3PO9A 2R6WA 1ZDUA 3E7CA 3OOFA 5G45A 4OJ9A 2G44A 1XLSE 2ZK0A 3GYUA 3HC5A 3WFFA 3B68A 2O9IA 4DORA 3FALB 5DWEA 5HCVA 2P4YA 5L11A 4OH5A 3KFCA 3KPZA 5DXGA 4QK4A 4ITEA 2I4JA 3G9EA 2J7YA 4OKWA 1SR7A 3CTBA 2AMAA 2POGA 2ZNNA 3OMOA 2QTUA 3A78A 4OEZA 4Y29A 2R6YA 5KCDA 2GPOA 2YJAB 4RZEA 5APHA 5LGAA 3IPUA 2AX9A 5E7VA 5KR9A 4PP6A 2OVMA 3GWSX 4PP3A 4RFWA 4S0SA 3RY9A 2AX6A 2YJDA 5KCUA 2XYXA 1K74A 2ZY0A 1DKFB 3OSIA 4OKXA 3ADUA 3W0GA 1ZH7A 2GPUA 2ZXMA 2AB2A 1RDTD 4OZTU 1P93A 3A40X 3VJSA 3FEIA 3FUGA 3A2HA 5DZIA 3HO0A 3R5NA 2QR9A 1FM9D 3FC6A 1XAPA 1X7RA 4Q0AC 2AM9A 2ZMJA 2PIXA 2YFEA 3ADXA 3NSPA 4WHFA 5FQRA 4JL4A 2PJLA 1YY4A 1G2NA 1YYEA 1E3GA 3AURA 4ZNTA 1XP9A 4WVDA 4DK8A 5G42A 1T79A 3A3ZX 2R40A 4BCRA 4A4VA 4OEAA 3W0HA 5IAWA 1S19A 4FN9A 3VRUA 2OCFA 5DK9A 1YMTA 1PZLA 2JF9A 5JJMB 2ZL9A 5DWJA 1YINA 5G44A 2GP7A 3L3ZA 1S0XA 3OSAA 4J5WC 4EMAA 1T7TA 3OMKA 2J14A 2VV0A 2ZKCA 1I7GA 2AX8A 3LMPA 1XP1A 2QSEA 3MNEA 2QA8B 4RZGA 3B0TA 5AVLA 1FCXA 1N83A 3K8SA 3R8AA 1R1KA 4ONIA 2O4RA 1SJ0A 1X76A 4KZIA 2AX7A 2AAXA 2VSTA 2ZLCA 2B1ZA 3M7RA 5E0XA 5DSHA 1S9QA 2J7XA 4XTAA 1EREA 3W0YA 3BQDA 3S9SA 4R6SA 4YMQA 5M96A 2NW4A 4G2IA
chains in the Genus database with same CATH topology
4A4WA 3A2JA 1L2IA 4ZOMA 3DZYA 1OVLB 1R20D 3CS4A 3OKIA 3IPSA 1PQ6A 1RK3A 3FURA 2AA6A 4ZNWA 4QL8A 3GWXA 3UP0A 3AFRA 2Q70A 1A52A 4WQPA 3W0CA 4IU7A 4POJA 2Q59A 1BSXA 2REWA 5F9BA 3WJ4A 3N00A 4X1FA 1L2JA 4RZFA 5G43A 3VHUA 5DV3A 5DXKA 5KYJA 5JJMA 1YJEA 3VN2A 4FNEA 2QA6A 5DKGA 3R29A 2QPYA 4PF3A 3WT5A 3OZ0A 2Z4BA 3R5MA 2P7ZA 4IA1A 2Q6SA 3KWYA 4IW6A 2F4BA 5EITA 3X1IA 1IE9A 2QH6A 3VHVA 3AUQA 1VJBA 2QA8A 4IWFA 3B0QA 3A9EA 1XDKA 3DT3A 1G50A 2PIWA 5JI0D 4QM0A 3L3XA 3IXPD 5DKEA 4L98A 5KRIA 1U9EA 3D24A 3E00D 3CDSA 4MGAA 3R2AA 4UDCA 2IOGA 4FHIA 2Q61A 3L0JA 5HYKA 1T74A 5HYRA 5AWJA 1R5KA 1ZDTA 1ZKYA 3GBKA 2ZNOA 2Q6JA 2G5OA 1TXIA 1ZGYA 3F5CA 4K7AA 5GIEA 2Q1VA 3W0AA 4E4QA 4MG9A 1ILGA 1G1UA 1NUOA 4K4JA 2AA5A 1UOMA 3ADTA 3FC6B 4L96A 3RVFA 4R2UA 2AXAA 4ZJWA 5KCCA 4LSJA 3OS8C 4FHHA 2HBHA 3X36A 3UUCA 5E19A 3KMZA 3OLFA 3FEJA 3UP3A 4REEA 3HQ5A 4PVUA 2QW4A 2VV3A 2Z4JA 5AAVA 3O1DA 5DRJA 2IOKA 3B1MA 5DMFA 4OFRA 4ZNVA 4POHA 3ADVA 1H9UA 1NRLA 1U3SA 2Q60A 1Z5XE 4ZO1X 1X7JA 2P1UA 5EHJA 4N73A 1XVPB 1OSHA 1QKUA 4IVWA 4ZI1A 3VT7A 1XIUA 1XB7A 2BJ4B 4XLDA 3UVVA 2ZK1A 4IA7A 5E1CA 3WTQA 1T76A 5DXBA 1GWRA 1XZXX 5LWPA 3SP9A 3VT5A 4ITFA 3CDPA 4B7WA 2I4ZA 4ZNSA 3KMRA 3AZ1A 2ZLAA 2I4PA 3ERTA 2LBDA 4YPQA 3P8XA 4J5WA 3KYTA 1RKGA 2Q7KA 2QE4A 2GPVA 2HB7A 2IHQA 2FSZA 2OUZA 3Q95A 3PRGA 4HLWA 4XUHA 2I0GA 5DI7A 3WWRA 4YT1A 5GIDA 2HWQA 2YLQA 2H79A 3MNOA 4WLBA 4IW8A 3V49A 5KRAA 3OZJA 4M8EA 1A28A 1WM0X 2ZK5A 4S14A 5DZ1A 4IWCA 2Q59B 2AA7A 5FQPA 1ZEOA 4N8RA 4X1GA 2PINA 5HJSA 3PCUA 5L7HA 3SZ1A 5DXRA 2P1TA 4RAKA 5FQSA 3VTDA 4S15A 2PIQA 1XP6A 2ZK3A 4ZNHA 5DX3A 2E2RA 1FCZA 1R6GA 2Q1HA 1XVPA 3D6DA 3VTBA 2PIRA 3ZQTA 2P15A 4PP5A 3QT0A 3OMPA 4R06A 4PRGA 1RJKA 2Q5GA 3AUNA 2BJ4A 5DV8A 4QE8A 2OZ7A 3UUDA 2QZOA 3V3QA 1Z95A 3A9EB 1XDKB 3HM1A 3P88A 5DVCA 2NV7A 1FM6A 5DKSA 4OH6A 5IZ0A 5C4SA 3ILZA 4OFUA 4TV1B 5G5WA 5KD9A 2B1VA 3WFGA 1XNNA 4MGAB 4ZO1B 1G5YA 2PIOA 2QABA 2YLPA 2Q5SA 1K74D 3NSQA 2GTKA 5B5BA 2HASA 1XV9A 4MG8A 4NUFA 2B50A 3ADWA 4RMDA 1T7MA 1T73A 5DYBA 4DOSA 5KCFA 2P54A 1P8DA 1PK5A 3F5CB 1YOKA 3B5RA 1XJ7A 1XPCA 3OLLA 1M13A 4MG6A 2NXXE 5KRLA 5DZ0A 3LBDA 4MG9B 4OHAA 4E4KA 3P89A 2J4AA 3FLIA 2HWRA 3HC6A 3K23A 2ZXNA 3DCTA 3W5PA 3TKCA 3ZR7A 1XQ3A 3VT6A 4P6WA 4ZJRA 2R40D 3V3EA 4RUJA 4PPSA 4OIVA 5AAVB 2ACLA 3RLJA 3T03A 1ZAFA 1QKNA 1FD0A 5G46A 2Q5PA 1OT7A 5KCTA 3KDTA 1ERRA 2QNVA 2HC4A 4OILA 1N4HA 4OZTE 1KV6A 3JZBA 2ZNQA 1Y0XX 3EYBA 3IPQA 5DRMA 3O1EA 4HEEX 3AN3A 2PNUA 2OVHA 1NAVA 5GICA 2Q6RA 3OS8A 2AO6A 4OGHA 3P0UA 2JFAB 4MGDA 4OZRU 2XKWA 5FQTA 1T7FA 3SP6A 1I37A 5C4UA 3OS9A 2I0JA 3G8IA 3UVVB 2EWPA 4IS8A 3DZUD 4RMCA 2QGWA 5DXBB 3DR1A 3NOAA 2G0GA 4OJ4A 4J5XC 3VSPA 4QE6A 4TV1A 5DXQA 1FBYA 4G1YA 1XQCA 4DM6A 5KRKA 1U3QA 1RKHA 1QKTA 3IMYA 4TUZB 5DVVA 3H0AA 4OEYA 4XI3A 2JJ3A 1NYXA 1GWQA 1Q4XA 4YNKA 5ETHA 3VTCA 2Q7JA 1I38A 2OAXA 3Q95B 5AK2A 4OEDA 3DZYD 4MDDA 5EJVA 1T7RA 1XOWA 4LBDA 1K7LA 5DIDA 3WGPA 3VT4A 4OIUA 5SYZA 1M7WA 3OOKA 4G1DA 5L7EA 4CI5A 2YLOA 1T63A 2Q7LA 3ADSA 3CS6A 3BC5A 3G0WA 2NPAA 3OSWA 4FGYA 5DWLA 3ET1A 1FCYA 1ZUCA 2P7AA 1GWXA 5E14A 2AYRA 4IUIA 5DX3B 4IA3A 2VV4B 3K22A 3L03A 4EM9A 1RDTA 5KRCA 1XNXA 2JFAA 1XLSA 3TY0A 3CWDA 5DVSA 3VRWA 1NQ7A 5ACCA 5L7GA 4XT9A 1YOWA 4OKBA 3UUDB 1FM9A 2QZOB 2ZASA 5DLRA 3WT7A 1LBDA 5HJPA 5DZ3A 2HVCA 3CQVA 2XHSA 4P6XA 5KCEA 2ATHA 4JAZA 2V0VA 3OGTA 2ABIA 2G0HA 4TUZA 1NHZA 2Q8SA 1X7BA 1NQ2A 1UPVA 2Q3YA 3JZCA 4MG5A 1XV9B 4MG8B 1KNUA 3KDUA 5AYGA 3U9QA 3VSOA 3VRVA 2ZK2A 2PITA 4A2JA 4OZRE 4IV2A 3UU7B 5E0WA 3VT9A 3VRTA 5DU5A 2V7CA 5DXMA 4G20A 2HFPA 2ZMHA 4RE8A 5AZTA 1DB1A 2ZMIA 4ZN9A 2ZVTA 1HJ1A 3VHWA 3B66A 3CJWA 5H1EA 3HVLA 4RUPA 2ZNPA 2ACLB 2HCDA 3AX8A 4RUOX 4MG7A 5DMCA 2B23A 5GT4A 4S0TA 3G8OA 4DK7A 4G21A 3DCUA 1Y0SA 3OMMA 3PLZA 4NB6A 3A2IA 4Q13A 3TKMA 3B0WA 5DIGA 5C4OA 4MGBB 5EC9A 5FQVA 5DV6A 3DY6A 2VV4A 1T65A 5KROA 2VV1A 3MNPA 3D90A 4ZNUA 1UHLA 4IA2A 5DZHA 5APKA 3X1HA 4REFA 1GS4A 1R20A 2HARA 4MGDB 3ZRBA 3ET0A 4LTWA 4Q50A 4IV4A 5DTVA 5JY3A 3L0LA 1PQCA 3KMGA 3PEQA 1ILHA 4G2HA 1PCGA 3D5FA 3GD2A 2PIVA 4M8HA 5DXEA 5IXKA 4RWVA 1S0ZA 5KRHA 4NQAB 5K13A 2Q7IA 5KCWA 4UDBA 4JYGA 2XYJA 3WMHA 3ET2A 3RLLA 1S9PA 3B65A 4PXMA 1EXAA 2ZBSA 3HLVA 5KRFA 4DQMA 5AVIA 3B0RA 1E3KA 5AWKA 4QJRA 1TFCA 1X78A 4MGCA 3GN8A 3HZFA 5AAUA 3FALA 1U3RA 1HG4A 3FXVA 4J5XA 4N1YA 2NXXA 3K6PA 2PRGA 1UPWA 5E15A 5KRJA 1PDUA 1PQ9A 3L0EA 1NQ0A 3DZUA 4CI4A 5DUEA 1NAXA 5DYDA 1YUCA 4K6IA 5B41A 3IXPA 4PLEA 3W5QA 1X7EA 3UUAB 4WHGA 3E00A 2VV2A 5DXPA 3HODA 2PKLA 5DUGA 3H52A 2YATA 4XHDA 1NDEA 2A3IA 1KKQA 1DKFA 4XUMA 4MGBA 4OLMA 3W0JA 1LV2A 4JYHA 3VJTA 4O8FA 3TX7B 2PIUA 3GZ9A 4ZN7A 1K4WA 3VI8A 4IQRA 1Z5XU 2AWHA 4E2JA 4OC7A 3WT6A 3OKHA 4J24A 2P1VA 2ZK6A 4KZJA 3V9TA 1Y9RA 3X31A 4JGVA 2W8YA 1FM6D 4PPPA 1R1KD 2QXMA 4APUA 1YIMA 2P7GA 4CSJA 3V9VA 5HJPB 4OK1A 3F7DA 3OLSA 4F9MA 4IVYA 3CS8A 5DIEA 4JYIA 3W5RA 2AMBA 4DM8A 4N5GA 4UDAA 5CJ6A 3FS1A 5DKBA 5DY8A 3AZ3A 5EGVA 3R8IA 2FVJA 5AZVA 5HZCA 4XAOA 3E94A 2AA2A 5C4TA 4OARA 1MZNA 1MV9A 2POBA 3RUTA 2ZFXA 5DWGA 3AN4A 5KYAA 1QKMA 4KZMA 3B3KA 3IA6A 2H77A 5DL4A 1SKXA 2QMVA 1EXXA 3B67A 2QXSA 4WPFA 3W5TA 5A86A 5DWIA 2ZK4A 3AZ2A 2GL8A 2QGTA 3W0IA 3WJ5A 2HB8A 1I7IA 5I4VA 1IE8A 3UUAA 4MG7B 5ICKA 4G1ZA 3OAPA 3OMQA 5KRMA 3BEJA 4LNWA 4OJBA 4DMAA 2VSRA 3VT8A 5DP0A 3GYTA 1YA3A 1M2ZA 2GPPA 2BAWA 2HAMA 3D57A 2FAIA 2VV1B 4UDDA 1OVLA 2GWXA 2XYWA 1UHLB 3CLDA 3VJIA 2ZXZA 2YLYA 3L1BA 1SQNA 4PLDA 4RMEA 3R8DA 1T5ZA 3V9YA 3UU7A 1PRGA 3ET3A 4LNXA 3ZRAA 5EI1A 2PIPL 1NQ1A 2YHDA 4J26A 4OKTA 2O4JA 3V4AA 3VJHA 3H0AD 5DUHA 3KBAA 1OSVA 1MVCA 1YP0A 3PBAA 4PWLA 1N46A 2OM9A 4NIEA 5G3JA 3RUUA 3ERDA 5APJA 3VT3A 4NY9A 2GIUA 3PO9A 2R6WA 1ZDUA 3E7CA 3OOFA 5G45A 4OJ9A 2G44A 1XLSE 2ZK0A 3GYUA 3HC5A 3WFFA 3B68A 2O9IA 4DORA 3FALB 5DWEA 5HCVA 2P4YA 5L11A 4OH5A 3KFCA 3KPZA 5DXGA 4QK4A 4ITEA 2I4JA 3G9EA 2J7YA 4OKWA 1SR7A 3CTBA 2AMAA 2POGA 2ZNNA 3OMOA 2QTUA 3A78A 4OEZA 4Y29A 2R6YA 5KCDA 2GPOA 2YJAB 4RZEA 5APHA 5LGAA 3IPUA 2AX9A 5E7VA 5KR9A 4PP6A 2OVMA 3GWSX 4PP3A 4RFWA 4S0SA 3RY9A 2AX6A 2YJDA 5KCUA 2XYXA 1K74A 2ZY0A 1DKFB 3OSIA 4OKXA 3ADUA 3W0GA 1ZH7A 2GPUA 2ZXMA 2AB2A 1RDTD 4OZTU 1P93A 3A40X 3VJSA 3FEIA 3FUGA 3A2HA 5DZIA 3HO0A 3R5NA 2QR9A 1FM9D 3FC6A 1XAPA 1X7RA 4Q0AC 2AM9A 2ZMJA 2PIXA 2YFEA 3ADXA 3NSPA 4WHFA 5FQRA 4JL4A 2PJLA 1YY4A 1G2NA 1YYEA 1E3GA 3AURA 4ZNTA 1XP9A 4WVDA 4DK8A 5G42A 1T79A 3A3ZX 2R40A 4BCRA 4A4VA 4OEAA 3W0HA 5IAWA 1S19A 4FN9A 3VRUA 2OCFA 5DK9A 1YMTA 1PZLA 2JF9A 5JJMB 2ZL9A 5DWJA 1YINA 5G44A 2GP7A 3L3ZA 1S0XA 3OSAA 4J5WC 4EMAA 1T7TA 3OMKA 2J14A 2VV0A 2ZKCA 1I7GA 2AX8A 3LMPA 1XP1A 2QSEA 3MNEA 2QA8B 4RZGA 3B0TA 5AVLA 1FCXA 1N83A 3K8SA 3R8AA 1R1KA 4ONIA 2O4RA 1SJ0A 1X76A 4KZIA 2AX7A 2AAXA 2VSTA 2ZLCA 2B1ZA 3M7RA 5E0XA 5DSHA 1S9QA 2J7XA 4XTAA 1EREA 3W0YA 3BQDA 3S9SA 4R6SA 4YMQA 5M96A 2NW4A 4G2IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A4W A;  3A2J A;  1L2I A;  4ZOM A;  3DZY A;  1OVL B;  1R20 D;  3CS4 A;  3OKI A;  3IPS A;  1PQ6 A;  1RK3 A;  3FUR A;  2AA6 A;  4ZNW A;  4QL8 A;  3GWX A;  3UP0 A;  3AFR A;  2Q70 A;  1A52 A;  4WQP A;  3W0C A;  4IU7 A;  4POJ A;  2Q59 A;  1BSX A;  2REW A;  5F9B A;  3WJ4 A;  3N00 A;  4X1F A;  1L2J A;  4RZF A;  5G43 A;  3VHU A;  5DV3 A;  5DXK A;  5KYJ A;  5JJM A;  1YJE A;  3VN2 A;  4FNE A;  2QA6 A;  5DKG A;  3R29 A;  2QPY A;  4PF3 A;  3WT5 A;  3OZ0 A;  2Z4B A;  3R5M A;  2P7Z A;  4IA1 A;  2Q6S A;  3KWY A;  4IW6 A;  2F4B A;  5EIT A;  3X1I A;  1IE9 A;  2QH6 A;  3VHV A;  3AUQ A;  1VJB A;  2QA8 A;  4IWF A;  3B0Q A;  3A9E A;  1XDK A;  3DT3 A;  1G50 A;  2PIW A;  5JI0 D;  4QM0 A;  3L3X A;  3IXP D;  5DKE A;  4L98 A;  5KRI A;  1U9E A;  3D24 A;  3E00 D;  3CDS A;  4MGA A;  3R2A A;  4UDC A;  2IOG A;  4FHI A;  2Q61 A;  3L0J A;  5HYK A;  1T74 A;  5HYR A;  5AWJ A;  1R5K A;  1ZDT A;  1ZKY A;  3GBK A;  2ZNO A;  2Q6J A;  2G5O A;  1TXI A;  1ZGY A;  3F5C A;  4K7A A;  5GIE A;  2Q1V A;  3W0A A;  4E4Q A;  4MG9 A;  1ILG A;  1G1U A;  1NUO A;  4K4J A;  2AA5 A;  1UOM A;  3ADT A;  3FC6 B;  4L96 A;  3RVF A;  4R2U A;  2AXA A;  4ZJW A;  5KCC A;  4LSJ A;  3OS8 C;  4FHH A;  2HBH A;  3X36 A;  3UUC A;  5E19 A;  3KMZ A;  3OLF A;  3FEJ A;  3UP3 A;  4REE A;  3HQ5 A;  4PVU A;  2QW4 A;  2VV3 A;  2Z4J A;  5AAV A;  3O1D A;  5DRJ A;  2IOK A;  3B1M A;  5DMF A;  4OFR A;  4ZNV A;  4POH A;  3ADV A;  1H9U A;  1NRL A;  1U3S A;  2Q60 A;  1Z5X E;  4ZO1 X;  1X7J A;  2P1U A;  5EHJ A;  4N73 A;  1XVP B;  1OSH A;  1QKU A;  4IVW A;  4ZI1 A;  3VT7 A;  1XIU A;  1XB7 A;  2BJ4 B;  4XLD A;  3UVV A;  2ZK1 A;  4IA7 A;  5E1C A;  3WTQ A;  1T76 A;  5DXB A;  1GWR A;  1XZX X;  5LWP A;  3SP9 A;  3VT5 A;  4ITF A;  3CDP A;  4B7W A;  2I4Z A;  4ZNS A;  3KMR A;  3AZ1 A;  2ZLA A;  2I4P A;  3ERT A;  2LBD A;  4YPQ A;  3P8X A;  4J5W A;  3KYT A;  1RKG A;  2Q7K A;  2QE4 A;  2GPV A;  2HB7 A;  2IHQ A;  2FSZ A;  2OUZ A;  3Q95 A;  3PRG A;  4HLW A;  4XUH A;  2I0G A;  5DI7 A;  3WWR A;  4YT1 A;  5GID A;  2HWQ A;  2YLQ A;  2H79 A;  3MNO A;  4WLB A;  4IW8 A;  3V49 A;  5KRA A;  3OZJ A;  4M8E A;  1A28 A;  1WM0 X;  2ZK5 A;  4S14 A;  5DZ1 A;  4IWC A;  2Q59 B;  2AA7 A;  5FQP A;  1ZEO A;  4N8R A;  4X1G A;  2PIN A;  5HJS A;  3PCU A;  5L7H A;  3SZ1 A;  5DXR A;  2P1T A;  4RAK A;  5FQS A;  3VTD A;  4S15 A;  2PIQ A;  1XP6 A;  2ZK3 A;  4ZNH A;  5DX3 A;  2E2R A;  1FCZ A;  1R6G A;  2Q1H A;  1XVP A;  3D6D A;  3VTB A;  2PIR A;  3ZQT A;  2P15 A;  4PP5 A;  3QT0 A;  3OMP A;  4R06 A;  4PRG A;  1RJK A;  2Q5G A;  3AUN A;  2BJ4 A;  5DV8 A;  4QE8 A;  2OZ7 A;  3UUD A;  2QZO A;  3V3Q A;  1Z95 A;  3A9E B;  1XDK B;  3HM1 A;  3P88 A;  5DVC A;  2NV7 A;  1FM6 A;  5DKS A;  4OH6 A;  5IZ0 A;  5C4S A;  3ILZ A;  4OFU A;  4TV1 B;  5G5W A;  5KD9 A;  2B1V A;  3WFG A;  1XNN A;  4MGA B;  4ZO1 B;  1G5Y A;  2PIO A;  2QAB A;  2YLP A;  2Q5S A;  1K74 D;  3NSQ A;  2GTK A;  5B5B A;  2HAS A;  1XV9 A;  4MG8 A;  4NUF A;  2B50 A;  3ADW A;  4RMD A;  1T7M A;  1T73 A;  5DYB A;  4DOS A;  5KCF A;  2P54 A;  1P8D A;  1PK5 A;  3F5C B;  1YOK A;  3B5R A;  1XJ7 A;  1XPC A;  3OLL A;  1M13 A;  4MG6 A;  2NXX E;  5KRL A;  5DZ0 A;  3LBD A;  4MG9 B;  4OHA A;  4E4K A;  3P89 A;  2J4A A;  3FLI A;  2HWR A;  3HC6 A;  3K23 A;  2ZXN A;  3DCT A;  3W5P A;  3TKC A;  3ZR7 A;  1XQ3 A;  3VT6 A;  4P6W A;  4ZJR A;  2R40 D;  3V3E A;  4RUJ A;  4PPS A;  4OIV A;  5AAV B;  2ACL A;  3RLJ A;  3T03 A;  1ZAF A;  1QKN A;  1FD0 A;  5G46 A;  2Q5P A;  1OT7 A;  5KCT A;  3KDT A;  1ERR A;  2QNV A;  2HC4 A;  4OIL A;  1N4H A;  4OZT E;  1KV6 A;  3JZB A;  2ZNQ A;  1Y0X X;  3EYB A;  3IPQ A;  5DRM A;  3O1E A;  4HEE X;  3AN3 A;  2PNU A;  2OVH A;  1NAV A;  5GIC A;  2Q6R A;  3OS8 A;  2AO6 A;  4OGH A;  3P0U A;  2JFA B;  4MGD A;  4OZR U;  2XKW A;  5FQT A;  1T7F A;  3SP6 A;  1I37 A;  5C4U A;  3OS9 A;  2I0J A;  3G8I A;  3UVV B;  2EWP A;  4IS8 A;  3DZU D;  4RMC A;  2QGW A;  5DXB B;  3DR1 A;  3NOA A;  2G0G A;  4OJ4 A;  4J5X C;  3VSP A;  4QE6 A;  4TV1 A;  5DXQ A;  1FBY A;  4G1Y A;  1XQC A;  4DM6 A;  5KRK A;  1U3Q A;  1RKH A;  1QKT A;  3IMY A;  4TUZ B;  5DVV A;  3H0A A;  4OEY A;  4XI3 A;  2JJ3 A;  1NYX A;  1GWQ A;  1Q4X A;  4YNK A;  5ETH A;  3VTC A;  2Q7J A;  1I38 A;  2OAX A;  3Q95 B;  5AK2 A;  4OED A;  3DZY D;  4MDD A;  5EJV A;  1T7R A;  1XOW A;  4LBD A;  1K7L A;  5DID A;  3WGP A;  3VT4 A;  4OIU A;  5SYZ A;  1M7W A;  3OOK A;  4G1D A;  5L7E A;  4CI5 A;  2YLO A;  1T63 A;  2Q7L A;  3ADS A;  3CS6 A;  3BC5 A;  3G0W A;  2NPA A;  3OSW A;  4FGY A;  5DWL A;  3ET1 A;  1FCY A;  1ZUC A;  2P7A A;  1GWX A;  5E14 A;  2AYR A;  4IUI A;  5DX3 B;  4IA3 A;  2VV4 B;  3K22 A;  3L03 A;  4EM9 A;  1RDT A;  5KRC A;  1XNX A;  2JFA A;  1XLS A;  3TY0 A;  3CWD A;  5DVS A;  3VRW A;  1NQ7 A;  5ACC A;  5L7G A;  4XT9 A;  1YOW A;  4OKB A;  3UUD B;  1FM9 A;  2QZO B;  2ZAS A;  5DLR A;  3WT7 A;  1LBD A;  5HJP A;  5DZ3 A;  2HVC A;  3CQV A;  2XHS A;  4P6X A;  5KCE A;  2ATH A;  4JAZ A;  2V0V A;  3OGT A;  2ABI A;  2G0H A;  4TUZ A;  1NHZ A;  2Q8S A;  1X7B A;  1NQ2 A;  1UPV A;  2Q3Y A;  3JZC A;  4MG5 A;  1XV9 B;  4MG8 B;  1KNU A;  3KDU A;  5AYG A;  3U9Q A;  3VSO A;  3VRV A;  2ZK2 A;  2PIT A;  4A2J A;  4OZR E;  4IV2 A;  3UU7 B;  5E0W A;  3VT9 A;  3VRT A;  5DU5 A;  2V7C A;  5DXM A;  4G20 A;  2HFP A;  2ZMH A;  4RE8 A;  5AZT A;  1DB1 A;  2ZMI A;  4ZN9 A;  2ZVT A;  1HJ1 A;  3VHW A;  3B66 A;  3CJW A;  5H1E A;  3HVL A;  4RUP A;  2ZNP A;  2ACL B;  2HCD A;  3AX8 A;  4RUO X;  4MG7 A;  5DMC A;  2B23 A;  5GT4 A;  4S0T A;  3G8O A;  4DK7 A;  4G21 A;  3DCU A;  1Y0S A;  3OMM A;  3PLZ A;  4NB6 A;  3A2I A;  4Q13 A;  3TKM A;  3B0W A;  5DIG A;  5C4O A;  4MGB B;  5EC9 A;  5FQV A;  5DV6 A;  3DY6 A;  2VV4 A;  1T65 A;  5KRO A;  2VV1 A;  3MNP A;  3D90 A;  4ZNU A;  1UHL A;  4IA2 A;  5DZH A;  5APK A;  3X1H A;  4REF A;  1GS4 A;  1R20 A;  2HAR A;  4MGD B;  3ZRB A;  3ET0 A;  4LTW A;  4Q50 A;  4IV4 A;  5DTV A;  5JY3 A;  3L0L A;  1PQC A;  3KMG A;  3PEQ A;  1ILH A;  4G2H A;  1PCG A;  3D5F A;  3GD2 A;  2PIV A;  4M8H A;  5DXE A;  5IXK A;  4RWV A;  1S0Z A;  5KRH A;  4NQA B;  5K13 A;  2Q7I A;  5KCW A;  4UDB A;  4JYG A;  2XYJ A;  3WMH A;  3ET2 A;  3RLL A;  1S9P A;  3B65 A;  4PXM A;  1EXA A;  2ZBS A;  3HLV A;  5KRF A;  4DQM A;  5AVI A;  3B0R A;  1E3K A;  5AWK A;  4QJR A;  1TFC A;  1X78 A;  4MGC A;  3GN8 A;  3HZF A;  5AAU A;  3FAL A;  1U3R A;  1HG4 A;  3FXV A;  4J5X A;  4N1Y A;  2NXX A;  3K6P A;  2PRG A;  1UPW A;  5E15 A;  5KRJ A;  1PDU A;  1PQ9 A;  3L0E A;  1NQ0 A;  3DZU A;  4CI4 A;  5DUE A;  1NAX A;  5DYD A;  1YUC A;  4K6I A;  5B41 A;  3IXP A;  4PLE A;  3W5Q A;  1X7E A;  3UUA B;  4WHG A;  3E00 A;  2VV2 A;  5DXP A;  3HOD A;  2PKL A;  5DUG A;  3H52 A;  2YAT A;  4XHD A;  1NDE A;  2A3I A;  1KKQ A;  1DKF A;  4XUM A;  4MGB A;  4OLM A;  3W0J A;  1LV2 A;  4JYH A;  3VJT A;  4O8F A;  3TX7 B;  2PIU A;  3GZ9 A;  4ZN7 A;  1K4W A;  3VI8 A;  4IQR A;  1Z5X U;  2AWH A;  4E2J A;  4OC7 A;  3WT6 A;  3OKH A;  4J24 A;  2P1V A;  2ZK6 A;  4KZJ A;  3V9T A;  1Y9R A;  3X31 A;  4JGV A;  2W8Y A;  1FM6 D;  4PPP A;  1R1K D;  2QXM A;  4APU A;  1YIM A;  2P7G A;  4CSJ A;  3V9V A;  5HJP B;  4OK1 A;  3F7D A;  3OLS A;  4F9M A;  4IVY A;  3CS8 A;  5DIE A;  4JYI A;  3W5R A;  2AMB A;  4DM8 A;  4N5G A;  4UDA A;  5CJ6 A;  3FS1 A;  5DKB A;  5DY8 A;  3AZ3 A;  5EGV A;  3R8I A;  2FVJ A;  5AZV A;  5HZC A;  4XAO A;  3E94 A;  2AA2 A;  5C4T A;  4OAR A;  1MZN A;  1MV9 A;  2POB A;  3RUT A;  2ZFX A;  5DWG A;  3AN4 A;  5KYA A;  1QKM A;  4KZM A;  3B3K A;  3IA6 A;  2H77 A;  5DL4 A;  1SKX A;  2QMV A;  1EXX A;  3B67 A;  2QXS A;  4WPF A;  3W5T A;  5A86 A;  5DWI A;  2ZK4 A;  3AZ2 A;  2GL8 A;  2QGT A;  3W0I A;  3WJ5 A;  2HB8 A;  1I7I A;  5I4V A;  1IE8 A;  3UUA A;  4MG7 B;  5ICK A;  4G1Z A;  3OAP A;  3OMQ A;  5KRM A;  3BEJ A;  4LNW A;  4OJB A;  4DMA A;  2VSR A;  3VT8 A;  5DP0 A;  3GYT A;  1YA3 A;  1M2Z A;  2GPP A;  2BAW A;  2HAM A;  3D57 A;  2FAI A;  2VV1 B;  4UDD A;  1OVL A;  2GWX A;  2XYW A;  1UHL B;  3CLD A;  3VJI A;  2ZXZ A;  2YLY A;  3L1B A;  1SQN A;  4PLD A;  4RME A;  3R8D A;  1T5Z A;  3V9Y A;  3UU7 A;  1PRG A;  3ET3 A;  4LNX A;  3ZRA A;  5EI1 A;  2PIP L;  1NQ1 A;  2YHD A;  4J26 A;  4OKT A;  2O4J A;  3V4A A;  3VJH A;  3H0A D;  5DUH A;  3KBA A;  1OSV A;  1MVC A;  1YP0 A;  3PBA A;  4PWL A;  1N46 A;  2OM9 A;  4NIE A;  5G3J A;  3RUU A;  3ERD A;  5APJ A;  3VT3 A;  4NY9 A;  2GIU A;  3PO9 A;  2R6W A;  1ZDU A;  3E7C A;  3OOF A;  5G45 A;  4OJ9 A;  2G44 A;  1XLS E;  2ZK0 A;  3GYU A;  3HC5 A;  3WFF A;  3B68 A;  2O9I A;  4DOR A;  3FAL B;  5DWE A;  5HCV A;  2P4Y A;  5L11 A;  4OH5 A;  3KFC A;  3KPZ A;  5DXG A;  4QK4 A;  4ITE A;  2I4J A;  3G9E A;  2J7Y A;  4OKW A;  1SR7 A;  3CTB A;  2AMA A;  2POG A;  2ZNN A;  3OMO A;  2QTU A;  3A78 A;  4OEZ A;  4Y29 A;  2R6Y A;  5KCD A;  2GPO A;  2YJA B;  4RZE A;  5APH A;  5LGA A;  3IPU A;  2AX9 A;  5E7V A;  5KR9 A;  4PP6 A;  2OVM A;  3GWS X;  4PP3 A;  4RFW A;  4S0S A;  3RY9 A;  2AX6 A;  2YJD A;  5KCU A;  2XYX A;  1K74 A;  2ZY0 A;  1DKF B;  3OSI A;  4OKX A;  3ADU A;  3W0G A;  1ZH7 A;  2GPU A;  2ZXM A;  2AB2 A;  1RDT D;  4OZT U;  1P93 A;  3A40 X;  3VJS A;  3FEI A;  3FUG A;  3A2H A;  5DZI A;  3HO0 A;  3R5N A;  2QR9 A;  1FM9 D;  3FC6 A;  1XAP A;  1X7R A;  4Q0A C;  2AM9 A;  2ZMJ A;  2PIX A;  2YFE A;  3ADX A;  3NSP A;  4WHF A;  5FQR A;  4JL4 A;  2PJL A;  1YY4 A;  1G2N A;  1YYE A;  1E3G A;  3AUR A;  4ZNT A;  1XP9 A;  4WVD A;  4DK8 A;  5G42 A;  1T79 A;  3A3Z X;  2R40 A;  4BCR A;  4A4V A;  4OEA A;  3W0H A;  5IAW A;  1S19 A;  4FN9 A;  3VRU A;  2OCF A;  5DK9 A;  1YMT A;  1PZL A;  2JF9 A;  5JJM B;  2ZL9 A;  5DWJ A;  1YIN A;  5G44 A;  2GP7 A;  3L3Z A;  1S0X A;  3OSA A;  4J5W C;  4EMA A;  1T7T A;  3OMK A;  2J14 A;  2VV0 A;  2ZKC A;  1I7G A;  2AX8 A;  3LMP A;  1XP1 A;  2QSE A;  3MNE A;  2QA8 B;  4RZG A;  3B0T A;  5AVL A;  1FCX A;  1N83 A;  3K8S A;  3R8A A;  1R1K A;  4ONI A;  2O4R A;  1SJ0 A;  1X76 A;  4KZI A;  2AX7 A;  2AAX A;  2VST A;  2ZLC A;  2B1Z A;  3M7R A;  5E0X A;  5DSH A;  1S9Q A;  2J7X A;  4XTA A;  1ERE A;  3W0Y A;  3BQD A;  3S9S A;  4R6S A;  4YMQ A;  5M96 A;  2NW4 A;  4G2I A; 
#chains in the Genus database with same CATH topology
 4A4W A;  3A2J A;  1L2I A;  4ZOM A;  3DZY A;  1OVL B;  1R20 D;  3CS4 A;  3OKI A;  3IPS A;  1PQ6 A;  1RK3 A;  3FUR A;  2AA6 A;  4ZNW A;  4QL8 A;  3GWX A;  3UP0 A;  3AFR A;  2Q70 A;  1A52 A;  4WQP A;  3W0C A;  4IU7 A;  4POJ A;  2Q59 A;  1BSX A;  2REW A;  5F9B A;  3WJ4 A;  3N00 A;  4X1F A;  1L2J A;  4RZF A;  5G43 A;  3VHU A;  5DV3 A;  5DXK A;  5KYJ A;  5JJM A;  1YJE A;  3VN2 A;  4FNE A;  2QA6 A;  5DKG A;  3R29 A;  2QPY A;  4PF3 A;  3WT5 A;  3OZ0 A;  2Z4B A;  3R5M A;  2P7Z A;  4IA1 A;  2Q6S A;  3KWY A;  4IW6 A;  2F4B A;  5EIT A;  3X1I A;  1IE9 A;  2QH6 A;  3VHV A;  3AUQ A;  1VJB A;  2QA8 A;  4IWF A;  3B0Q A;  3A9E A;  1XDK A;  3DT3 A;  1G50 A;  2PIW A;  5JI0 D;  4QM0 A;  3L3X A;  3IXP D;  5DKE A;  4L98 A;  5KRI A;  1U9E A;  3D24 A;  3E00 D;  3CDS A;  4MGA A;  3R2A A;  4UDC A;  2IOG A;  4FHI A;  2Q61 A;  3L0J A;  5HYK A;  1T74 A;  5HYR A;  5AWJ A;  1R5K A;  1ZDT A;  1ZKY A;  3GBK A;  2ZNO A;  2Q6J A;  2G5O A;  1TXI A;  1ZGY A;  3F5C A;  4K7A A;  5GIE A;  2Q1V A;  3W0A A;  4E4Q A;  4MG9 A;  1ILG A;  1G1U A;  1NUO A;  4K4J A;  2AA5 A;  1UOM A;  3ADT A;  3FC6 B;  4L96 A;  3RVF A;  4R2U A;  2AXA A;  4ZJW A;  5KCC A;  4LSJ A;  3OS8 C;  4FHH A;  2HBH A;  3X36 A;  3UUC A;  5E19 A;  3KMZ A;  3OLF A;  3FEJ A;  3UP3 A;  4REE A;  3HQ5 A;  4PVU A;  2QW4 A;  2VV3 A;  2Z4J A;  5AAV A;  3O1D A;  5DRJ A;  2IOK A;  3B1M A;  5DMF A;  4OFR A;  4ZNV A;  4POH A;  3ADV A;  1H9U A;  1NRL A;  1U3S A;  2Q60 A;  1Z5X E;  4ZO1 X;  1X7J A;  2P1U A;  5EHJ A;  4N73 A;  1XVP B;  1OSH A;  1QKU A;  4IVW A;  4ZI1 A;  3VT7 A;  1XIU A;  1XB7 A;  2BJ4 B;  4XLD A;  3UVV A;  2ZK1 A;  4IA7 A;  5E1C A;  3WTQ A;  1T76 A;  5DXB A;  1GWR A;  1XZX X;  5LWP A;  3SP9 A;  3VT5 A;  4ITF A;  3CDP A;  4B7W A;  2I4Z A;  4ZNS A;  3KMR A;  3AZ1 A;  2ZLA A;  2I4P A;  3ERT A;  2LBD A;  4YPQ A;  3P8X A;  4J5W A;  3KYT A;  1RKG A;  2Q7K A;  2QE4 A;  2GPV A;  2HB7 A;  2IHQ A;  2FSZ A;  2OUZ A;  3Q95 A;  3PRG A;  4HLW A;  4XUH A;  2I0G A;  5DI7 A;  3WWR A;  4YT1 A;  5GID A;  2HWQ A;  2YLQ A;  2H79 A;  3MNO A;  4WLB A;  4IW8 A;  3V49 A;  5KRA A;  3OZJ A;  4M8E A;  1A28 A;  1WM0 X;  2ZK5 A;  4S14 A;  5DZ1 A;  4IWC A;  2Q59 B;  2AA7 A;  5FQP A;  1ZEO A;  4N8R A;  4X1G A;  2PIN A;  5HJS A;  3PCU A;  5L7H A;  3SZ1 A;  5DXR A;  2P1T A;  4RAK A;  5FQS A;  3VTD A;  4S15 A;  2PIQ A;  1XP6 A;  2ZK3 A;  4ZNH A;  5DX3 A;  2E2R A;  1FCZ A;  1R6G A;  2Q1H A;  1XVP A;  3D6D A;  3VTB A;  2PIR A;  3ZQT A;  2P15 A;  4PP5 A;  3QT0 A;  3OMP A;  4R06 A;  4PRG A;  1RJK A;  2Q5G A;  3AUN A;  2BJ4 A;  5DV8 A;  4QE8 A;  2OZ7 A;  3UUD A;  2QZO A;  3V3Q A;  1Z95 A;  3A9E B;  1XDK B;  3HM1 A;  3P88 A;  5DVC A;  2NV7 A;  1FM6 A;  5DKS A;  4OH6 A;  5IZ0 A;  5C4S A;  3ILZ A;  4OFU A;  4TV1 B;  5G5W A;  5KD9 A;  2B1V A;  3WFG A;  1XNN A;  4MGA B;  4ZO1 B;  1G5Y A;  2PIO A;  2QAB A;  2YLP A;  2Q5S A;  1K74 D;  3NSQ A;  2GTK A;  5B5B A;  2HAS A;  1XV9 A;  4MG8 A;  4NUF A;  2B50 A;  3ADW A;  4RMD A;  1T7M A;  1T73 A;  5DYB A;  4DOS A;  5KCF A;  2P54 A;  1P8D A;  1PK5 A;  3F5C B;  1YOK A;  3B5R A;  1XJ7 A;  1XPC A;  3OLL A;  1M13 A;  4MG6 A;  2NXX E;  5KRL A;  5DZ0 A;  3LBD A;  4MG9 B;  4OHA A;  4E4K A;  3P89 A;  2J4A A;  3FLI A;  2HWR A;  3HC6 A;  3K23 A;  2ZXN A;  3DCT A;  3W5P A;  3TKC A;  3ZR7 A;  1XQ3 A;  3VT6 A;  4P6W A;  4ZJR A;  2R40 D;  3V3E A;  4RUJ A;  4PPS A;  4OIV A;  5AAV B;  2ACL A;  3RLJ A;  3T03 A;  1ZAF A;  1QKN A;  1FD0 A;  5G46 A;  2Q5P A;  1OT7 A;  5KCT A;  3KDT A;  1ERR A;  2QNV A;  2HC4 A;  4OIL A;  1N4H A;  4OZT E;  1KV6 A;  3JZB A;  2ZNQ A;  1Y0X X;  3EYB A;  3IPQ A;  5DRM A;  3O1E A;  4HEE X;  3AN3 A;  2PNU A;  2OVH A;  1NAV A;  5GIC A;  2Q6R A;  3OS8 A;  2AO6 A;  4OGH A;  3P0U A;  2JFA B;  4MGD A;  4OZR U;  2XKW A;  5FQT A;  1T7F A;  3SP6 A;  1I37 A;  5C4U A;  3OS9 A;  2I0J A;  3G8I A;  3UVV B;  2EWP A;  4IS8 A;  3DZU D;  4RMC A;  2QGW A;  5DXB B;  3DR1 A;  3NOA A;  2G0G A;  4OJ4 A;  4J5X C;  3VSP A;  4QE6 A;  4TV1 A;  5DXQ A;  1FBY A;  4G1Y A;  1XQC A;  4DM6 A;  5KRK A;  1U3Q A;  1RKH A;  1QKT A;  3IMY A;  4TUZ B;  5DVV A;  3H0A A;  4OEY A;  4XI3 A;  2JJ3 A;  1NYX A;  1GWQ A;  1Q4X A;  4YNK A;  5ETH A;  3VTC A;  2Q7J A;  1I38 A;  2OAX A;  3Q95 B;  5AK2 A;  4OED A;  3DZY D;  4MDD A;  5EJV A;  1T7R A;  1XOW A;  4LBD A;  1K7L A;  5DID A;  3WGP A;  3VT4 A;  4OIU A;  5SYZ A;  1M7W A;  3OOK A;  4G1D A;  5L7E A;  4CI5 A;  2YLO A;  1T63 A;  2Q7L A;  3ADS A;  3CS6 A;  3BC5 A;  3G0W A;  2NPA A;  3OSW A;  4FGY A;  5DWL A;  3ET1 A;  1FCY A;  1ZUC A;  2P7A A;  1GWX A;  5E14 A;  2AYR A;  4IUI A;  5DX3 B;  4IA3 A;  2VV4 B;  3K22 A;  3L03 A;  4EM9 A;  1RDT A;  5KRC A;  1XNX A;  2JFA A;  1XLS A;  3TY0 A;  3CWD A;  5DVS A;  3VRW A;  1NQ7 A;  5ACC A;  5L7G A;  4XT9 A;  1YOW A;  4OKB A;  3UUD B;  1FM9 A;  2QZO B;  2ZAS A;  5DLR A;  3WT7 A;  1LBD A;  5HJP A;  5DZ3 A;  2HVC A;  3CQV A;  2XHS A;  4P6X A;  5KCE A;  2ATH A;  4JAZ A;  2V0V A;  3OGT A;  2ABI A;  2G0H A;  4TUZ A;  1NHZ A;  2Q8S A;  1X7B A;  1NQ2 A;  1UPV A;  2Q3Y A;  3JZC A;  4MG5 A;  1XV9 B;  4MG8 B;  1KNU A;  3KDU A;  5AYG A;  3U9Q A;  3VSO A;  3VRV A;  2ZK2 A;  2PIT A;  4A2J A;  4OZR E;  4IV2 A;  3UU7 B;  5E0W A;  3VT9 A;  3VRT A;  5DU5 A;  2V7C A;  5DXM A;  4G20 A;  2HFP A;  2ZMH A;  4RE8 A;  5AZT A;  1DB1 A;  2ZMI A;  4ZN9 A;  2ZVT A;  1HJ1 A;  3VHW A;  3B66 A;  3CJW A;  5H1E A;  3HVL A;  4RUP A;  2ZNP A;  2ACL B;  2HCD A;  3AX8 A;  4RUO X;  4MG7 A;  5DMC A;  2B23 A;  5GT4 A;  4S0T A;  3G8O A;  4DK7 A;  4G21 A;  3DCU A;  1Y0S A;  3OMM A;  3PLZ A;  4NB6 A;  3A2I A;  4Q13 A;  3TKM A;  3B0W A;  5DIG A;  5C4O A;  4MGB B;  5EC9 A;  5FQV A;  5DV6 A;  3DY6 A;  2VV4 A;  1T65 A;  5KRO A;  2VV1 A;  3MNP A;  3D90 A;  4ZNU A;  1UHL A;  4IA2 A;  5DZH A;  5APK A;  3X1H A;  4REF A;  1GS4 A;  1R20 A;  2HAR A;  4MGD B;  3ZRB A;  3ET0 A;  4LTW A;  4Q50 A;  4IV4 A;  5DTV A;  5JY3 A;  3L0L A;  1PQC A;  3KMG A;  3PEQ A;  1ILH A;  4G2H A;  1PCG A;  3D5F A;  3GD2 A;  2PIV A;  4M8H A;  5DXE A;  5IXK A;  4RWV A;  1S0Z A;  5KRH A;  4NQA B;  5K13 A;  2Q7I A;  5KCW A;  4UDB A;  4JYG A;  2XYJ A;  3WMH A;  3ET2 A;  3RLL A;  1S9P A;  3B65 A;  4PXM A;  1EXA A;  2ZBS A;  3HLV A;  5KRF A;  4DQM A;  5AVI A;  3B0R A;  1E3K A;  5AWK A;  4QJR A;  1TFC A;  1X78 A;  4MGC A;  3GN8 A;  3HZF A;  5AAU A;  3FAL A;  1U3R A;  1HG4 A;  3FXV A;  4J5X A;  4N1Y A;  2NXX A;  3K6P A;  2PRG A;  1UPW A;  5E15 A;  5KRJ A;  1PDU A;  1PQ9 A;  3L0E A;  1NQ0 A;  3DZU A;  4CI4 A;  5DUE A;  1NAX A;  5DYD A;  1YUC A;  4K6I A;  5B41 A;  3IXP A;  4PLE A;  3W5Q A;  1X7E A;  3UUA B;  4WHG A;  3E00 A;  2VV2 A;  5DXP A;  3HOD A;  2PKL A;  5DUG A;  3H52 A;  2YAT A;  4XHD A;  1NDE A;  2A3I A;  1KKQ A;  1DKF A;  4XUM A;  4MGB A;  4OLM A;  3W0J A;  1LV2 A;  4JYH A;  3VJT A;  4O8F A;  3TX7 B;  2PIU A;  3GZ9 A;  4ZN7 A;  1K4W A;  3VI8 A;  4IQR A;  1Z5X U;  2AWH A;  4E2J A;  4OC7 A;  3WT6 A;  3OKH A;  4J24 A;  2P1V A;  2ZK6 A;  4KZJ A;  3V9T A;  1Y9R A;  3X31 A;  4JGV A;  2W8Y A;  1FM6 D;  4PPP A;  1R1K D;  2QXM A;  4APU A;  1YIM A;  2P7G A;  4CSJ A;  3V9V A;  5HJP B;  4OK1 A;  3F7D A;  3OLS A;  4F9M A;  4IVY A;  3CS8 A;  5DIE A;  4JYI A;  3W5R A;  2AMB A;  4DM8 A;  4N5G A;  4UDA A;  5CJ6 A;  3FS1 A;  5DKB A;  5DY8 A;  3AZ3 A;  5EGV A;  3R8I A;  2FVJ A;  5AZV A;  5HZC A;  4XAO A;  3E94 A;  2AA2 A;  5C4T A;  4OAR A;  1MZN A;  1MV9 A;  2POB A;  3RUT A;  2ZFX A;  5DWG A;  3AN4 A;  5KYA A;  1QKM A;  4KZM A;  3B3K A;  3IA6 A;  2H77 A;  5DL4 A;  1SKX A;  2QMV A;  1EXX A;  3B67 A;  2QXS A;  4WPF A;  3W5T A;  5A86 A;  5DWI A;  2ZK4 A;  3AZ2 A;  2GL8 A;  2QGT A;  3W0I A;  3WJ5 A;  2HB8 A;  1I7I A;  5I4V A;  1IE8 A;  3UUA A;  4MG7 B;  5ICK A;  4G1Z A;  3OAP A;  3OMQ A;  5KRM A;  3BEJ A;  4LNW A;  4OJB A;  4DMA A;  2VSR A;  3VT8 A;  5DP0 A;  3GYT A;  1YA3 A;  1M2Z A;  2GPP A;  2BAW A;  2HAM A;  3D57 A;  2FAI A;  2VV1 B;  4UDD A;  1OVL A;  2GWX A;  2XYW A;  1UHL B;  3CLD A;  3VJI A;  2ZXZ A;  2YLY A;  3L1B A;  1SQN A;  4PLD A;  4RME A;  3R8D A;  1T5Z A;  3V9Y A;  3UU7 A;  1PRG A;  3ET3 A;  4LNX A;  3ZRA A;  5EI1 A;  2PIP L;  1NQ1 A;  2YHD A;  4J26 A;  4OKT A;  2O4J A;  3V4A A;  3VJH A;  3H0A D;  5DUH A;  3KBA A;  1OSV A;  1MVC A;  1YP0 A;  3PBA A;  4PWL A;  1N46 A;  2OM9 A;  4NIE A;  5G3J A;  3RUU A;  3ERD A;  5APJ A;  3VT3 A;  4NY9 A;  2GIU A;  3PO9 A;  2R6W A;  1ZDU A;  3E7C A;  3OOF A;  5G45 A;  4OJ9 A;  2G44 A;  1XLS E;  2ZK0 A;  3GYU A;  3HC5 A;  3WFF A;  3B68 A;  2O9I A;  4DOR A;  3FAL B;  5DWE A;  5HCV A;  2P4Y A;  5L11 A;  4OH5 A;  3KFC A;  3KPZ A;  5DXG A;  4QK4 A;  4ITE A;  2I4J A;  3G9E A;  2J7Y A;  4OKW A;  1SR7 A;  3CTB A;  2AMA A;  2POG A;  2ZNN A;  3OMO A;  2QTU A;  3A78 A;  4OEZ A;  4Y29 A;  2R6Y A;  5KCD A;  2GPO A;  2YJA B;  4RZE A;  5APH A;  5LGA A;  3IPU A;  2AX9 A;  5E7V A;  5KR9 A;  4PP6 A;  2OVM A;  3GWS X;  4PP3 A;  4RFW A;  4S0S A;  3RY9 A;  2AX6 A;  2YJD A;  5KCU A;  2XYX A;  1K74 A;  2ZY0 A;  1DKF B;  3OSI A;  4OKX A;  3ADU A;  3W0G A;  1ZH7 A;  2GPU A;  2ZXM A;  2AB2 A;  1RDT D;  4OZT U;  1P93 A;  3A40 X;  3VJS A;  3FEI A;  3FUG A;  3A2H A;  5DZI A;  3HO0 A;  3R5N A;  2QR9 A;  1FM9 D;  3FC6 A;  1XAP A;  1X7R A;  4Q0A C;  2AM9 A;  2ZMJ A;  2PIX A;  2YFE A;  3ADX A;  3NSP A;  4WHF A;  5FQR A;  4JL4 A;  2PJL A;  1YY4 A;  1G2N A;  1YYE A;  1E3G A;  3AUR A;  4ZNT A;  1XP9 A;  4WVD A;  4DK8 A;  5G42 A;  1T79 A;  3A3Z X;  2R40 A;  4BCR A;  4A4V A;  4OEA A;  3W0H A;  5IAW A;  1S19 A;  4FN9 A;  3VRU A;  2OCF A;  5DK9 A;  1YMT A;  1PZL A;  2JF9 A;  5JJM B;  2ZL9 A;  5DWJ A;  1YIN A;  5G44 A;  2GP7 A;  3L3Z A;  1S0X A;  3OSA A;  4J5W C;  4EMA A;  1T7T A;  3OMK A;  2J14 A;  2VV0 A;  2ZKC A;  1I7G A;  2AX8 A;  3LMP A;  1XP1 A;  2QSE A;  3MNE A;  2QA8 B;  4RZG A;  3B0T A;  5AVL A;  1FCX A;  1N83 A;  3K8S A;  3R8A A;  1R1K A;  4ONI A;  2O4R A;  1SJ0 A;  1X76 A;  4KZI A;  2AX7 A;  2AAX A;  2VST A;  2ZLC A;  2B1Z A;  3M7R A;  5E0X A;  5DSH A;  1S9Q A;  2J7X A;  4XTA A;  1ERE A;  3W0Y A;  3BQD A;  3S9S A;  4R6S A;  4YMQ A;  5M96 A;  2NW4 A;  4G2I A; 
#chains in the Genus database with same CATH homology
 4A4W A;  3A2J A;  1L2I A;  4ZOM A;  3DZY A;  1OVL B;  1R20 D;  3CS4 A;  3OKI A;  3IPS A;  1PQ6 A;  1RK3 A;  3FUR A;  2AA6 A;  4ZNW A;  4QL8 A;  3GWX A;  3UP0 A;  3AFR A;  2Q70 A;  1A52 A;  4WQP A;  3W0C A;  4IU7 A;  4POJ A;  2Q59 A;  1BSX A;  2REW A;  5F9B A;  3WJ4 A;  3N00 A;  4X1F A;  1L2J A;  4RZF A;  5G43 A;  3VHU A;  5DV3 A;  5DXK A;  5KYJ A;  5JJM A;  1YJE A;  3VN2 A;  4FNE A;  2QA6 A;  5DKG A;  3R29 A;  2QPY A;  4PF3 A;  3WT5 A;  3OZ0 A;  2Z4B A;  3R5M A;  2P7Z A;  4IA1 A;  2Q6S A;  3KWY A;  4IW6 A;  2F4B A;  5EIT A;  3X1I A;  1IE9 A;  2QH6 A;  3VHV A;  3AUQ A;  1VJB A;  2QA8 A;  4IWF A;  3B0Q A;  3A9E A;  1XDK A;  3DT3 A;  1G50 A;  2PIW A;  5JI0 D;  4QM0 A;  3L3X A;  3IXP D;  5DKE A;  4L98 A;  5KRI A;  1U9E A;  3D24 A;  3E00 D;  3CDS A;  4MGA A;  3R2A A;  4UDC A;  2IOG A;  4FHI A;  2Q61 A;  3L0J A;  5HYK A;  1T74 A;  5HYR A;  5AWJ A;  1R5K A;  1ZDT A;  1ZKY A;  3GBK A;  2ZNO A;  2Q6J A;  2G5O A;  1TXI A;  1ZGY A;  3F5C A;  4K7A A;  5GIE A;  2Q1V A;  3W0A A;  4E4Q A;  4MG9 A;  1ILG A;  1G1U A;  1NUO A;  4K4J A;  2AA5 A;  1UOM A;  3ADT A;  3FC6 B;  4L96 A;  3RVF A;  4R2U A;  2AXA A;  4ZJW A;  5KCC A;  4LSJ A;  3OS8 C;  4FHH A;  2HBH A;  3X36 A;  3UUC A;  5E19 A;  3KMZ A;  3OLF A;  3FEJ A;  3UP3 A;  4REE A;  3HQ5 A;  4PVU A;  2QW4 A;  2VV3 A;  2Z4J A;  5AAV A;  3O1D A;  5DRJ A;  2IOK A;  3B1M A;  5DMF A;  4OFR A;  4ZNV A;  4POH A;  3ADV A;  1H9U A;  1NRL A;  1U3S A;  2Q60 A;  1Z5X E;  4ZO1 X;  1X7J A;  2P1U A;  5EHJ A;  4N73 A;  1XVP B;  1OSH A;  1QKU A;  4IVW A;  4ZI1 A;  3VT7 A;  1XIU A;  1XB7 A;  2BJ4 B;  4XLD A;  3UVV A;  2ZK1 A;  4IA7 A;  5E1C A;  3WTQ A;  1T76 A;  5DXB A;  1GWR A;  1XZX X;  5LWP A;  3SP9 A;  3VT5 A;  4ITF A;  3CDP A;  4B7W A;  2I4Z A;  4ZNS A;  3KMR A;  3AZ1 A;  2ZLA A;  2I4P A;  3ERT A;  2LBD A;  4YPQ A;  3P8X A;  4J5W A;  3KYT A;  1RKG A;  2Q7K A;  2QE4 A;  2GPV A;  2HB7 A;  2IHQ A;  2FSZ A;  2OUZ A;  3Q95 A;  3PRG A;  4HLW A;  4XUH A;  2I0G A;  5DI7 A;  3WWR A;  4YT1 A;  5GID A;  2HWQ A;  2YLQ A;  2H79 A;  3MNO A;  4WLB A;  4IW8 A;  3V49 A;  5KRA A;  3OZJ A;  4M8E A;  1A28 A;  1WM0 X;  2ZK5 A;  4S14 A;  5DZ1 A;  4IWC A;  2Q59 B;  2AA7 A;  5FQP A;  1ZEO A;  4N8R A;  4X1G A;  2PIN A;  5HJS A;  3PCU A;  5L7H A;  3SZ1 A;  5DXR A;  2P1T A;  4RAK A;  5FQS A;  3VTD A;  4S15 A;  2PIQ A;  1XP6 A;  2ZK3 A;  4ZNH A;  5DX3 A;  2E2R A;  1FCZ A;  1R6G A;  2Q1H A;  1XVP A;  3D6D A;  3VTB A;  2PIR A;  3ZQT A;  2P15 A;  4PP5 A;  3QT0 A;  3OMP A;  4R06 A;  4PRG A;  1RJK A;  2Q5G A;  3AUN A;  2BJ4 A;  5DV8 A;  4QE8 A;  2OZ7 A;  3UUD A;  2QZO A;  3V3Q A;  1Z95 A;  3A9E B;  1XDK B;  3HM1 A;  3P88 A;  5DVC A;  2NV7 A;  1FM6 A;  5DKS A;  4OH6 A;  5IZ0 A;  5C4S A;  3ILZ A;  4OFU A;  4TV1 B;  5G5W A;  5KD9 A;  2B1V A;  3WFG A;  1XNN A;  4MGA B;  4ZO1 B;  1G5Y A;  2PIO A;  2QAB A;  2YLP A;  2Q5S A;  1K74 D;  3NSQ A;  2GTK A;  5B5B A;  2HAS A;  1XV9 A;  4MG8 A;  4NUF A;  2B50 A;  3ADW A;  4RMD A;  1T7M A;  1T73 A;  5DYB A;  4DOS A;  5KCF A;  2P54 A;  1P8D A;  1PK5 A;  3F5C B;  1YOK A;  3B5R A;  1XJ7 A;  1XPC A;  3OLL A;  1M13 A;  4MG6 A;  2NXX E;  5KRL A;  5DZ0 A;  3LBD A;  4MG9 B;  4OHA A;  4E4K A;  3P89 A;  2J4A A;  3FLI A;  2HWR A;  3HC6 A;  3K23 A;  2ZXN A;  3DCT A;  3W5P A;  3TKC A;  3ZR7 A;  1XQ3 A;  3VT6 A;  4P6W A;  4ZJR A;  2R40 D;  3V3E A;  4RUJ A;  4PPS A;  4OIV A;  5AAV B;  2ACL A;  3RLJ A;  3T03 A;  1ZAF A;  1QKN A;  1FD0 A;  5G46 A;  2Q5P A;  1OT7 A;  5KCT A;  3KDT A;  1ERR A;  2QNV A;  2HC4 A;  4OIL A;  1N4H A;  4OZT E;  1KV6 A;  3JZB A;  2ZNQ A;  1Y0X X;  3EYB A;  3IPQ A;  5DRM A;  3O1E A;  4HEE X;  3AN3 A;  2PNU A;  2OVH A;  1NAV A;  5GIC A;  2Q6R A;  3OS8 A;  2AO6 A;  4OGH A;  3P0U A;  2JFA B;  4MGD A;  4OZR U;  2XKW A;  5FQT A;  1T7F A;  3SP6 A;  1I37 A;  5C4U A;  3OS9 A;  2I0J A;  3G8I A;  3UVV B;  2EWP A;  4IS8 A;  3DZU D;  4RMC A;  2QGW A;  5DXB B;  3DR1 A;  3NOA A;  2G0G A;  4OJ4 A;  4J5X C;  3VSP A;  4QE6 A;  4TV1 A;  5DXQ A;  1FBY A;  4G1Y A;  1XQC A;  4DM6 A;  5KRK A;  1U3Q A;  1RKH A;  1QKT A;  3IMY A;  4TUZ B;  5DVV A;  3H0A A;  4OEY A;  4XI3 A;  2JJ3 A;  1NYX A;  1GWQ A;  1Q4X A;  4YNK A;  5ETH A;  3VTC A;  2Q7J A;  1I38 A;  2OAX A;  3Q95 B;  5AK2 A;  4OED A;  3DZY D;  4MDD A;  5EJV A;  1T7R A;  1XOW A;  4LBD A;  1K7L A;  5DID A;  3WGP A;  3VT4 A;  4OIU A;  5SYZ A;  1M7W A;  3OOK A;  4G1D A;  5L7E A;  4CI5 A;  2YLO A;  1T63 A;  2Q7L A;  3ADS A;  3CS6 A;  3BC5 A;  3G0W A;  2NPA A;  3OSW A;  4FGY A;  5DWL A;  3ET1 A;  1FCY A;  1ZUC A;  2P7A A;  1GWX A;  5E14 A;  2AYR A;  4IUI A;  5DX3 B;  4IA3 A;  2VV4 B;  3K22 A;  3L03 A;  4EM9 A;  1RDT A;  5KRC A;  1XNX A;  2JFA A;  1XLS A;  3TY0 A;  3CWD A;  5DVS A;  3VRW A;  1NQ7 A;  5ACC A;  5L7G A;  4XT9 A;  1YOW A;  4OKB A;  3UUD B;  1FM9 A;  2QZO B;  2ZAS A;  5DLR A;  3WT7 A;  1LBD A;  5HJP A;  5DZ3 A;  2HVC A;  3CQV A;  2XHS A;  4P6X A;  5KCE A;  2ATH A;  4JAZ A;  2V0V A;  3OGT A;  2ABI A;  2G0H A;  4TUZ A;  1NHZ A;  2Q8S A;  1X7B A;  1NQ2 A;  1UPV A;  2Q3Y A;  3JZC A;  4MG5 A;  1XV9 B;  4MG8 B;  1KNU A;  3KDU A;  5AYG A;  3U9Q A;  3VSO A;  3VRV A;  2ZK2 A;  2PIT A;  4A2J A;  4OZR E;  4IV2 A;  3UU7 B;  5E0W A;  3VT9 A;  3VRT A;  5DU5 A;  2V7C A;  5DXM A;  4G20 A;  2HFP A;  2ZMH A;  4RE8 A;  5AZT A;  1DB1 A;  2ZMI A;  4ZN9 A;  2ZVT A;  1HJ1 A;  3VHW A;  3B66 A;  3CJW A;  5H1E A;  3HVL A;  4RUP A;  2ZNP A;  2ACL B;  2HCD A;  3AX8 A;  4RUO X;  4MG7 A;  5DMC A;  2B23 A;  5GT4 A;  4S0T A;  3G8O A;  4DK7 A;  4G21 A;  3DCU A;  1Y0S A;  3OMM A;  3PLZ A;  4NB6 A;  3A2I A;  4Q13 A;  3TKM A;  3B0W A;  5DIG A;  5C4O A;  4MGB B;  5EC9 A;  5FQV A;  5DV6 A;  3DY6 A;  2VV4 A;  1T65 A;  5KRO A;  2VV1 A;  3MNP A;  3D90 A;  4ZNU A;  1UHL A;  4IA2 A;  5DZH A;  5APK A;  3X1H A;  4REF A;  1GS4 A;  1R20 A;  2HAR A;  4MGD B;  3ZRB A;  3ET0 A;  4LTW A;  4Q50 A;  4IV4 A;  5DTV A;  5JY3 A;  3L0L A;  1PQC A;  3KMG A;  3PEQ A;  1ILH A;  4G2H A;  1PCG A;  3D5F A;  3GD2 A;  2PIV A;  4M8H A;  5DXE A;  5IXK A;  4RWV A;  1S0Z A;  5KRH A;  4NQA B;  5K13 A;  2Q7I A;  5KCW A;  4UDB A;  4JYG A;  2XYJ A;  3WMH A;  3ET2 A;  3RLL A;  1S9P A;  3B65 A;  4PXM A;  1EXA A;  2ZBS A;  3HLV A;  5KRF A;  4DQM A;  5AVI A;  3B0R A;  1E3K A;  5AWK A;  4QJR A;  1TFC A;  1X78 A;  4MGC A;  3GN8 A;  3HZF A;  5AAU A;  3FAL A;  1U3R A;  1HG4 A;  3FXV A;  4J5X A;  4N1Y A;  2NXX A;  3K6P A;  2PRG A;  1UPW A;  5E15 A;  5KRJ A;  1PDU A;  1PQ9 A;  3L0E A;  1NQ0 A;  3DZU A;  4CI4 A;  5DUE A;  1NAX A;  5DYD A;  1YUC A;  4K6I A;  5B41 A;  3IXP A;  4PLE A;  3W5Q A;  1X7E A;  3UUA B;  4WHG A;  3E00 A;  2VV2 A;  5DXP A;  3HOD A;  2PKL A;  5DUG A;  3H52 A;  2YAT A;  4XHD A;  1NDE A;  2A3I A;  1KKQ A;  1DKF A;  4XUM A;  4MGB A;  4OLM A;  3W0J A;  1LV2 A;  4JYH A;  3VJT A;  4O8F A;  3TX7 B;  2PIU A;  3GZ9 A;  4ZN7 A;  1K4W A;  3VI8 A;  4IQR A;  1Z5X U;  2AWH A;  4E2J A;  4OC7 A;  3WT6 A;  3OKH A;  4J24 A;  2P1V A;  2ZK6 A;  4KZJ A;  3V9T A;  1Y9R A;  3X31 A;  4JGV A;  2W8Y A;  1FM6 D;  4PPP A;  1R1K D;  2QXM A;  4APU A;  1YIM A;  2P7G A;  4CSJ A;  3V9V A;  5HJP B;  4OK1 A;  3F7D A;  3OLS A;  4F9M A;  4IVY A;  3CS8 A;  5DIE A;  4JYI A;  3W5R A;  2AMB A;  4DM8 A;  4N5G A;  4UDA A;  5CJ6 A;  3FS1 A;  5DKB A;  5DY8 A;  3AZ3 A;  5EGV A;  3R8I A;  2FVJ A;  5AZV A;  5HZC A;  4XAO A;  3E94 A;  2AA2 A;  5C4T A;  4OAR A;  1MZN A;  1MV9 A;  2POB A;  3RUT A;  2ZFX A;  5DWG A;  3AN4 A;  5KYA A;  1QKM A;  4KZM A;  3B3K A;  3IA6 A;  2H77 A;  5DL4 A;  1SKX A;  2QMV A;  1EXX A;  3B67 A;  2QXS A;  4WPF A;  3W5T A;  5A86 A;  5DWI A;  2ZK4 A;  3AZ2 A;  2GL8 A;  2QGT A;  3W0I A;  3WJ5 A;  2HB8 A;  1I7I A;  5I4V A;  1IE8 A;  3UUA A;  4MG7 B;  5ICK A;  4G1Z A;  3OAP A;  3OMQ A;  5KRM A;  3BEJ A;  4LNW A;  4OJB A;  4DMA A;  2VSR A;  3VT8 A;  5DP0 A;  3GYT A;  1YA3 A;  1M2Z A;  2GPP A;  2BAW A;  2HAM A;  3D57 A;  2FAI A;  2VV1 B;  4UDD A;  1OVL A;  2GWX A;  2XYW A;  1UHL B;  3CLD A;  3VJI A;  2ZXZ A;  2YLY A;  3L1B A;  1SQN A;  4PLD A;  4RME A;  3R8D A;  1T5Z A;  3V9Y A;  3UU7 A;  1PRG A;  3ET3 A;  4LNX A;  3ZRA A;  5EI1 A;  2PIP L;  1NQ1 A;  2YHD A;  4J26 A;  4OKT A;  2O4J A;  3V4A A;  3VJH A;  3H0A D;  5DUH A;  3KBA A;  1OSV A;  1MVC A;  1YP0 A;  3PBA A;  4PWL A;  1N46 A;  2OM9 A;  4NIE A;  5G3J A;  3RUU A;  3ERD A;  5APJ A;  3VT3 A;  4NY9 A;  2GIU A;  3PO9 A;  2R6W A;  1ZDU A;  3E7C A;  3OOF A;  5G45 A;  4OJ9 A;  2G44 A;  1XLS E;  2ZK0 A;  3GYU A;  3HC5 A;  3WFF A;  3B68 A;  2O9I A;  4DOR A;  3FAL B;  5DWE A;  5HCV A;  2P4Y A;  5L11 A;  4OH5 A;  3KFC A;  3KPZ A;  5DXG A;  4QK4 A;  4ITE A;  2I4J A;  3G9E A;  2J7Y A;  4OKW A;  1SR7 A;  3CTB A;  2AMA A;  2POG A;  2ZNN A;  3OMO A;  2QTU A;  3A78 A;  4OEZ A;  4Y29 A;  2R6Y A;  5KCD A;  2GPO A;  2YJA B;  4RZE A;  5APH A;  5LGA A;  3IPU A;  2AX9 A;  5E7V A;  5KR9 A;  4PP6 A;  2OVM A;  3GWS X;  4PP3 A;  4RFW A;  4S0S A;  3RY9 A;  2AX6 A;  2YJD A;  5KCU A;  2XYX A;  1K74 A;  2ZY0 A;  1DKF B;  3OSI A;  4OKX A;  3ADU A;  3W0G A;  1ZH7 A;  2GPU A;  2ZXM A;  2AB2 A;  1RDT D;  4OZT U;  1P93 A;  3A40 X;  3VJS A;  3FEI A;  3FUG A;  3A2H A;  5DZI A;  3HO0 A;  3R5N A;  2QR9 A;  1FM9 D;  3FC6 A;  1XAP A;  1X7R A;  4Q0A C;  2AM9 A;  2ZMJ A;  2PIX A;  2YFE A;  3ADX A;  3NSP A;  4WHF A;  5FQR A;  4JL4 A;  2PJL A;  1YY4 A;  1G2N A;  1YYE A;  1E3G A;  3AUR A;  4ZNT A;  1XP9 A;  4WVD A;  4DK8 A;  5G42 A;  1T79 A;  3A3Z X;  2R40 A;  4BCR A;  4A4V A;  4OEA A;  3W0H A;  5IAW A;  1S19 A;  4FN9 A;  3VRU A;  2OCF A;  5DK9 A;  1YMT A;  1PZL A;  2JF9 A;  5JJM B;  2ZL9 A;  5DWJ A;  1YIN A;  5G44 A;  2GP7 A;  3L3Z A;  1S0X A;  3OSA A;  4J5W C;  4EMA A;  1T7T A;  3OMK A;  2J14 A;  2VV0 A;  2ZKC A;  1I7G A;  2AX8 A;  3LMP A;  1XP1 A;  2QSE A;  3MNE A;  2QA8 B;  4RZG A;  3B0T A;  5AVL A;  1FCX A;  1N83 A;  3K8S A;  3R8A A;  1R1K A;  4ONI A;  2O4R A;  1SJ0 A;  1X76 A;  4KZI A;  2AX7 A;  2AAX A;  2VST A;  2ZLC A;  2B1Z A;  3M7R A;  5E0X A;  5DSH A;  1S9Q A;  2J7X A;  4XTA A;  1ERE A;  3W0Y A;  3BQD A;  3S9S A;  4R6S A;  4YMQ A;  5M96 A;  2NW4 A;  4G2I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...