5JJMB

Crystal structure of homodimeric androgen receptor ligand-binding domain bound to dht and lxxll peptide
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
251
structure length
250
Chain Sequence
CQPIFLNVLEAIEPGVVAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSRMLYFAPDLVFNEYRMHKSRMYSQCVRMRHLSQEFGWLQITPQEFLCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELDRIIACKRKNPTSCSRRFYQLTKLLDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEIISVQVPKILSGKVKPIYFHTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Androgen receptor
publication title Structure of the homodimeric androgen receptor ligand-binding domain.
pubmed doi rcsb
source organism Homo sapiens
total genus 99
structure length 250
sequence length 251
ec nomenclature
pdb deposition date 2016-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 5jjmB00
4MGCA 4OC7A 3ET2A 1S0XA 2W8YA 4ZNWA 5DLRA 5DTVA 2PIPL 3HC5A 4MG9B 3GWXA 4OH6A 3PCUA 4XAOA 2GL8A 5FQTA 2XKWA 3SZ1A 1ZGYA 3VT3A 1K74D 4EM9A 3PO9A 3K6PA 4WQPA 1SQNA 3R5NA 3D5FA 4MGAB 3OS8A 3QT0A 3ET1A 4Q50A 4OJ9A 2FVJA 4RUPA 2A3IA 5DVSA 1PQ6A 2Q6JA 4N1YA 3F5CB 5G46A 1EREA 3A9EA 3W5QA 4OLMA 1X78A 5EITA 4P6XA 3W0IA 3ZRAA 3WMHA 2ZK0A 3ZQTA 1SR7A 2B23A 2QXSA 1GS4A 1XQ3A 3E7CA 2B1VA 3VT8A 4YNKA 3IXPD 2AAXA 2AMAA 1RDTD 1OSVA 4MG7B 1U9EA 4MG9A 4RAKA 5ETHA 5HCVA 2HWQA 1NUOA 3B0TA 4PVUA 4PLDA 3E00D 3V49A 5LWPA 2HWRA 4OZTE 1XAPA 2QW4A 3SP6A 3CJWA 4K7AA 2ATHA 4MGAA 5AK2A 2VV3A 2BAWA 3V9YA 3W0HA 2HAMA 2XYJA 3ZRBA 3FUGA 3VSOA 4TUZB 5DWGA 3F5CA 4OK1A 3UUAB 5KCUA 5HYRA 1N46A 4PP3A 5KYAA 2ABIA 3S9SA 4ZNVA 3A2HA 2O4RA 2QE4A 2LBDA 3OLSA 4ZJWA 1G1UA 2J4AA 2QMVA 3W0AA 3HVLA 1RKGA 1XP6A 1LV2A 2I4PA 4DORA 4MG7A 3RVFA 3W0CA 3A2IA 5E7VA 5EC9A 2PNUA 2JFAB 2OVHA 3W0GA 2P7GA 2QSEA 4WVDA 5HYKA 2P4YA 4XLDA 4XUMA 1P8DA 5AAUA 3UP0A 5IAWA 1EXXA 2Q60A 5HJPA 1YJEA 1PRGA 3WFFA 4OARA 5KRFA 3UUAA 1RDTA 3CWDA 4Q0AC 5FQRA 2OM9A 3W5RA 1FM9D 3GYUA 5DY8A 3BC5A 5DX3B 1L2JA 3FEJA 4MG8B 1Z5XE 1BSXA 1NQ0A 5DKEA 3WJ4A 2ZNOA 4UDBA 1IE8A 4QK4A 1S9QA 2P7ZA 4MDDA 3BQDA 4ONIA 5EJVA 5DK9A 4DOSA 2REWA 2HC4A 2JFAA 5KYJA 2R40D 1XVPB 3P0UA 5C4SA 2ZK1A 1M13A 2ZNNA 5F9BA 2G0GA 2YLQA 4RUOX 4IA7A 2HFPA 1MZNA 5KCTA 3CS6A 3ADTA 1I7GA 1TXIA 2PIWA 1NQ7A 3A78A 2QXMA 4JYGA 5DXEA 1U3QA 3OLLA 3MNEA 2Q5PA 5DX3A 3CS8A 3K22A 4MG8A 3RY9A 2G44A 3Q95B 2P1TA 1XLSA 4YPQA 2AMBA 3AZ2A 2Q59B 2HCDA 2YJDA 4LTWA 5DKGA 1NAXA 3R8DA 4Q13A 4WLBA 3TX7B 5HZCA 3CDPA 5DUGA 1T7TA 1R20A 1QKTA 3F7DA 3PEQA 1XVPA 5DZ1A 5L11A 2FAIA 3JZBA 1FCZA 3H0AA 1QKMA 3VJHA 1T65A 5APKA 5KRCA 2JJ3A 3FLIA 2G5OA 1FCYA 1UHLB 5C4TA 2ZMIA 3HC6A 3MNPA 2OZ7A 4LNWA 2Q61A 2Q6RA 5AWJA 3MNOA 3WWRA 4ZN9A 5DWLA 2QH6A 4MG5A 5DWEA 5DIEA 2R40A 2VV1B 3Q95A 4A4VA 3KMZA 1N4HA 3ILZA 3GN8A 2Q59A 2HASA 4RMEA 2VV0A 2Q3YA 4K6IA 4UDAA 1X7RA 3A2JA 3KMRA 5KRJA 1P93A 3HLVA 3VJSA 4M8HA 5KROA 3UUDB 4OKBA 4F9MA 5DXPA 2NPAA 3NOAA 1XDKB 4S15A 2FSZA 2P1VA 1T73A 3OSWA 2P7AA 2GPUA 1R6GA 2ZMJA 4ZOMA 5GICA 1YUCA 2XYWA 1YMTA 1UHLA 3O1EA 2AM9A 3VT5A 1PCGA 1Q4XA 4OEDA 5DRMA 1XP9A 3B0RA 3VTDA 4REFA 2ZL9A 3DZUA 3VHVA 2AX6A 5E19A 4E2JA 3VN2A 3W0JA 3R2AA 4QL8A 3V3QA 1S0ZA 2P54A 1I37A 2VV1A 4PLEA 1OSHA 2F4BA 5G3JA 3KBAA 1XNNA 4ITEA 4Y29A 4K4JA 1ZUCA 5KRHA 4RWVA 4E4KA 3OKHA 1T5ZA 4G1ZA 1NDEA 2AYRA 5FQSA 2Q6SA 3P89A 5L7EA 3L0EA 2EWPA 1YOWA 1R1KD 2H77A 3VT6A 5B5BA 1SJ0A 4PF3A 3UUDA 4PRGA 2AX9A 2Q7JA 1XDKA 2Q70A 4RUJA 3KFCA 1X7EA 2Q1HA 1NRLA 4XT9A 5E15A 2Q7IA 4N5GA 5GIDA 2PKLA 3G9EA 4J5XC 5KCWA 3P88A 4YT1A 4ZI1A 5EI1A 4G20A 4R06A 5DIGA 4S14A 4TV1B 1NAVA 1PQCA 3HQ5A 2AO6A 3AFRA 4OZRU 5M96A 1HJ1A 3VT7A 4ZN7A 4OJ4A 4RZEA 4PP5A 3NSQA 4IVWA 2GIUA 3DCUA 1XV9B 4ZNSA 5DWJA 4ZNHA 3EYBA 3VSPA 4RE8A 3DY6A 4A4WA 2NXXA 1NHZA 1YIMA 1ZAFA 4XTAA 2ZK6A 3G8IA 5DXGA 1ILHA 1FCXA 2R6WA 2ZLAA 1OVLB 2YHDA 2B1ZA 3GYTA 3PBAA 2OVMA 1DKFB 2YJAB 1XPCA 1FD0A 2QA6A 4KZIA 5DVVA 1K74A 2QR9A 3K23A 5DMCA 1K7LA 3W5TA 5IZ0A 4QE8A 1T79A 3KYTA 2ZY0A 5E14A 2Q8SA 5ICKA 5DKBA 4TV1A 3JZCA 1FM6D 1SKXA 2PIQA 4R2UA 5DYBA 1U3SA 5AWKA 1X7JA 3WT5A 2QZOB 1XLSE 1ZKYA 4N73A 5AVLA 1G50A 5E0WA 4JYIA 2AWHA 2AX8A 5DXRA 5DSHA 1UOMA 5DXKA 5KD9A 2QGTA 1A52A 1S9PA 3VRWA 1XV9A 5C4OA 2AXAA 3HZFA 3B3KA 2ZASA 2PINA 4IV2A 3IXPA 3DR1A 4TUZA 3GBKA 4DK8A 2Q7LA 5KRLA 3WT6A 1XP1A 3DT3A 4LNXA 3WTQA 4FGYA 5C4UA 3DZYD 3AUQA 1OVLA 4ITFA 5K13A 1Y0XX 3K8SA 2QTUA 3H52A 3M7RA 1DKFA 3OGTA 1KV6A 5AVIA 3X1IA 3E00A 4OH5A 4ZNUA 2GPOA 5IXKA 1XOWA 3W5PA 5GIEA 3B1MA 2J7XA 3WT7A 4OGHA 4DMAA 4KZJA 1EXAA 1E3KA 4FHHA 2AA7A 1YA3A 2OCFA 2PRGA 2ZBSA 3GWSX 3R8IA 2QZOA 4IV4A 3GZ9A 3LMPA 1E3GA 3OMKA 4JYHA 4KZMA 4OIUA 4PPPA 3VHWA 2YLYA 1K4WA 1ZH7A 5KRKA 3B0QA 5DV6A 5JJMB 2GP7A 1Y9RA 4EMAA 4ZJRA 3B65A 1XNXA 2QA8B 4N8RA 2IOKA 3ZR7A 4IVYA 3R5MA 3IMYA 2VV4B 2IOGA 3N00A 3G8OA 4OKXA 1U3RA 3V9TA 4APUA 2O4JA 4OEYA 4PXMA 2JF9A 4NUFA 3CTBA 4DQMA 5H1EA 4IQRA 4G2HA 1G5YA 5AYGA 2I0JA 5SYZA 3IPSA 4J5WC 4UDDA 1PQ9A 1XZXX 5E0XA 1FM9A 1N83A 5G45A 1ZDUA 5G43A 3HODA 3AX8A 4IWFA 4J26A 5JJMA 2ZXMA 4OKWA 2G0HA 2R6YA 2I0GA 4NY9A 4IA1A 5DV3A 3IPQA 5AAVB 4ZNTA 2ZK2A 1I38A 2I4ZA 4JL4A 1UPVA 1TFCA 5JI0D 4OILA 2VV4A 5DKSA 3TKCA 3VT4A 1IE9A 3CLDA 3AN4A 5FQVA 5DUEA 2P1UA 4OZRE 3OS8C 3A40X 2AA5A 4E4QA 4UDCA 3WFGA 2PIUA 4OFRA 5JY3A 3FS1A 5ACCA 4IWCA 1T63A 3X1HA 4IA2A 3OLFA 3UVVB 3A3ZX 3VRUA 2ZNPA 3BEJA 4RZFA 4ZO1X 2Z4JA 1ZDTA 2ACLB 2NXXE 2VV2A 5DZ3A 2P15A 4M8EA 3TY0A 2HARA 3UUCA 2J7YA 4XI3A 2O9IA 3CDSA 3L0LA 2ZK4A 4FNEA 4POHA 5AAVA 4RZGA 5KCEA 1GWRA 5DMFA 2XYXA 4A2JA 1T7FA 4X1GA 3TKMA 3OSAA 3KDTA 4PWLA 2ZXNA 3DCTA 3FURA 2PIOA 3KDUA 4PPSA 4QE6A 3T03A 5DXBB 3UP3A 3OMMA 4HLWA 1X7BA 1A28A 3D24A 5KCFA 2J14A 5DXQA 4G1YA 2QABA 2GPVA 4OJBA 5KCDA 2E2RA 1NQ1A 2YLOA 3OMQA 3UVVA 3VJTA 2HB8A 2ZKCA 1T7RA 3VTCA 2Z4BA 4FHIA 5DP0A 4CSJA 4O8FA 3IA6A 2ACLA 3OOFA 5B41A 4FN9A 1R5KA 4IA3A 1NQ2A 2GPPA 4REEA 1PZLA 3ADUA 2PITA 1T74A 3OMPA 5DIDA 5E1CA 4QJRA 1NYXA 4JAZA 5KRIA 5DXBA 2XHSA 3W0YA 3ADVA 4DM8A 2POBA 2ZVTA 3IPUA 3VRVA 4ZO1B 3RUUA 2ZLCA 3OMOA 4P6WA 1T7MA 3X36A 3PLZA 3R8AA 3VJIA 4OFUA 4NQAB 1YY4A 3VT9A 2AB2A 3V9VA 5L7GA 1UPWA 3CS4A 3ERDA 5KRAA 3AN3A 1ILGA 2BJ4B 4L98A 5G42A 5KRMA 1KNUA 3FEIA 1KKQA 3VI8A 3V3EA 5CJ6A 3L03A 1R1KA 4NB6A 5HJPB 5AZTA 3VTBA 3B0WA 2PJLA 3OZJA 3OOKA 3D57A 3G0WA 2PIXA 5GT4A 5DZIA 3ADWA 3E94A 3U9QA 2HB7A 4RMDA 4XUHA 3VHUA 3FC6B 3WGPA 2ZXZA 3AUNA 5DXMA 3NSPA 1ERRA 5HJSA 4J24A 2PIVA 4HEEX 5A86A 3SP9A 3B68A 2VSRA 1XIUA 4R6SA 3FALB 4J5XA 2HBHA 1XJ7A 3L3ZA 3RLLA 3ET3A 3O1DA 2BJ4A 1S19A 2GWXA 5G5WA 4LBDA 5L7HA 1YINA 5EGVA 2YFEA 4B7WA 5DV8A 1MVCA 2QGWA 4X1FA 5KR9A 2V0VA 3KPZA 1R20D 1VJBA 2ZFXA 3ADSA 4OEZA 1HG4A 4MG6A 5APJA 2QPYA 4POJA 3H0AD 2B50A 3FC6A 4IW8A 5APHA 5DWIA 2YLPA 2AA6A 5DRJA 1FM6A 1H9UA 2H79A 3OZ0A 3LBDA 3RUTA 1LBDA 4PP6A 1YOKA 4MGDB 5AZVA 3FALA 4CI4A 4G2IA 1GWXA 1YYEA 3ADXA 1OT7A 3HO0A 2V7CA 4OZTU 1PDUA 3RLJA 4IUIA 3P8XA 3B67A 4WPFA 2PIRA 3AZ1A 5DYDA 1RK3A 4DK7A 2AX7A 3OKIA 4JGVA 5DI7A 3DZYA 3B66A 4XHDA 1I7IA 3HM1A 3KMGA 1QKUA 3FXVA 4IW6A 1L2IA 4S0TA 3L1BA 5FQPA 4L96A 4S0SA 1T76A 2QA8A 2YATA 1XB7A 4NIEA 2Q1VA 3KWYA 5KCCA 2GTKA 3R29A 5G44A 1YP0A 4MGDA 3UU7B 4LSJA 2QNVA 2ZNQA 2HVCA 3DZUD 1XQCA 1Y0SA 2IHQA 4QM0A 2ZMHA 3D6DA 4DM6A 2POGA 4G21A 3B5RA 5LGAA 2VSTA 4G1DA 1RKHA 4MGBB 4OHAA 1G2NA 5DUHA 2Q5SA 5DL4A 4YMQA 1GWQA 3CQVA 2I4JA 2OAXA 2AA2A 4OEAA 3V4AA 3AZ3A 4CI5A 5DZ0A 1WM0X 3OS9A 4WHGA 5EHJA 4WHFA 2NV7A 5DU5A 1Z5XU 4IU7A 1MV9A 4OIVA 4RFWA 5DZHA 2ZK3A 3VRTA 3OSIA 2Q7KA 1M7WA 4IS8A 3AURA 4BCRA 3GD2A 1ZEOA 1QKNA 3WJ5A 3UU7A 3ERTA 5I4VA 3OAPA 1DB1A 1M2ZA 4RMCA 1X76A 1PK5A 1RJKA 1Z95A 2Q5GA 3L0JA 2ZK5A 3ET0A 3PRGA 4OKTA 3A9EB 4MGBA 2OUZA 3L3XA 3D90A 4J5WA 1FBYA 2NW4A 3X31A 5DVCA
chains in the Genus database with same CATH superfamily
4MGCA 4OC7A 3ET2A 1S0XA 2W8YA 4ZNWA 5DLRA 5DTVA 2PIPL 3HC5A 4MG9B 3GWXA 4OH6A 3PCUA 4XAOA 2GL8A 5FQTA 2XKWA 3SZ1A 1ZGYA 3VT3A 1K74D 4EM9A 3PO9A 3K6PA 4WQPA 1SQNA 3R5NA 3D5FA 4MGAB 3OS8A 3QT0A 3ET1A 4Q50A 4OJ9A 2FVJA 4RUPA 2A3IA 5DVSA 1PQ6A 2Q6JA 4N1YA 3F5CB 5G46A 1EREA 3A9EA 3W5QA 4OLMA 1X78A 5EITA 4P6XA 3W0IA 3ZRAA 3WMHA 2ZK0A 3ZQTA 1SR7A 2B23A 2QXSA 1GS4A 1XQ3A 3E7CA 2B1VA 3VT8A 4YNKA 3IXPD 2AAXA 2AMAA 1RDTD 1OSVA 4MG7B 1U9EA 4MG9A 4RAKA 5ETHA 5HCVA 2HWQA 1NUOA 3B0TA 4PVUA 4PLDA 3E00D 3V49A 5LWPA 2HWRA 4OZTE 1XAPA 2QW4A 3SP6A 3CJWA 4K7AA 2ATHA 4MGAA 5AK2A 2VV3A 2BAWA 3V9YA 3W0HA 2HAMA 2XYJA 3ZRBA 3FUGA 3VSOA 4TUZB 5DWGA 3F5CA 4OK1A 3UUAB 5KCUA 5HYRA 1N46A 4PP3A 5KYAA 2ABIA 3S9SA 4ZNVA 3A2HA 2O4RA 2QE4A 2LBDA 3OLSA 4ZJWA 1G1UA 2J4AA 2QMVA 3W0AA 3HVLA 1RKGA 1XP6A 1LV2A 2I4PA 4DORA 4MG7A 3RVFA 3W0CA 3A2IA 5E7VA 5EC9A 2PNUA 2JFAB 2OVHA 3W0GA 2P7GA 2QSEA 4WVDA 5HYKA 2P4YA 4XLDA 4XUMA 1P8DA 5AAUA 3UP0A 5IAWA 1EXXA 2Q60A 5HJPA 1YJEA 1PRGA 3WFFA 4OARA 5KRFA 3UUAA 1RDTA 3CWDA 4Q0AC 5FQRA 2OM9A 3W5RA 1FM9D 3GYUA 5DY8A 3BC5A 5DX3B 1L2JA 3FEJA 4MG8B 1Z5XE 1BSXA 1NQ0A 5DKEA 3WJ4A 2ZNOA 4UDBA 1IE8A 4QK4A 1S9QA 2P7ZA 4MDDA 3BQDA 4ONIA 5EJVA 5DK9A 4DOSA 2REWA 2HC4A 2JFAA 5KYJA 2R40D 1XVPB 3P0UA 5C4SA 2ZK1A 1M13A 2ZNNA 5F9BA 2G0GA 2YLQA 4RUOX 4IA7A 2HFPA 1MZNA 5KCTA 3CS6A 3ADTA 1I7GA 1TXIA 2PIWA 1NQ7A 3A78A 2QXMA 4JYGA 5DXEA 1U3QA 3OLLA 3MNEA 2Q5PA 5DX3A 3CS8A 3K22A 4MG8A 3RY9A 2G44A 3Q95B 2P1TA 1XLSA 4YPQA 2AMBA 3AZ2A 2Q59B 2HCDA 2YJDA 4LTWA 5DKGA 1NAXA 3R8DA 4Q13A 4WLBA 3TX7B 5HZCA 3CDPA 5DUGA 1T7TA 1R20A 1QKTA 3F7DA 3PEQA 1XVPA 5DZ1A 5L11A 2FAIA 3JZBA 1FCZA 3H0AA 1QKMA 3VJHA 1T65A 5APKA 5KRCA 2JJ3A 3FLIA 2G5OA 1FCYA 1UHLB 5C4TA 2ZMIA 3HC6A 3MNPA 2OZ7A 4LNWA 2Q61A 2Q6RA 5AWJA 3MNOA 3WWRA 4ZN9A 5DWLA 2QH6A 4MG5A 5DWEA 5DIEA 2R40A 2VV1B 3Q95A 4A4VA 3KMZA 1N4HA 3ILZA 3GN8A 2Q59A 2HASA 4RMEA 2VV0A 2Q3YA 4K6IA 4UDAA 1X7RA 3A2JA 3KMRA 5KRJA 1P93A 3HLVA 3VJSA 4M8HA 5KROA 3UUDB 4OKBA 4F9MA 5DXPA 2NPAA 3NOAA 1XDKB 4S15A 2FSZA 2P1VA 1T73A 3OSWA 2P7AA 2GPUA 1R6GA 2ZMJA 4ZOMA 5GICA 1YUCA 2XYWA 1YMTA 1UHLA 3O1EA 2AM9A 3VT5A 1PCGA 1Q4XA 4OEDA 5DRMA 1XP9A 3B0RA 3VTDA 4REFA 2ZL9A 3DZUA 3VHVA 2AX6A 5E19A 4E2JA 3VN2A 3W0JA 3R2AA 4QL8A 3V3QA 1S0ZA 2P54A 1I37A 2VV1A 4PLEA 1OSHA 2F4BA 5G3JA 3KBAA 1XNNA 4ITEA 4Y29A 4K4JA 1ZUCA 5KRHA 4RWVA 4E4KA 3OKHA 1T5ZA 4G1ZA 1NDEA 2AYRA 5FQSA 2Q6SA 3P89A 5L7EA 3L0EA 2EWPA 1YOWA 1R1KD 2H77A 3VT6A 5B5BA 1SJ0A 4PF3A 3UUDA 4PRGA 2AX9A 2Q7JA 1XDKA 2Q70A 4RUJA 3KFCA 1X7EA 2Q1HA 1NRLA 4XT9A 5E15A 2Q7IA 4N5GA 5GIDA 2PKLA 3G9EA 4J5XC 5KCWA 3P88A 4YT1A 4ZI1A 5EI1A 4G20A 4R06A 5DIGA 4S14A 4TV1B 1NAVA 1PQCA 3HQ5A 2AO6A 3AFRA 4OZRU 5M96A 1HJ1A 3VT7A 4ZN7A 4OJ4A 4RZEA 4PP5A 3NSQA 4IVWA 2GIUA 3DCUA 1XV9B 4ZNSA 5DWJA 4ZNHA 3EYBA 3VSPA 4RE8A 3DY6A 4A4WA 2NXXA 1NHZA 1YIMA 1ZAFA 4XTAA 2ZK6A 3G8IA 5DXGA 1ILHA 1FCXA 2R6WA 2ZLAA 1OVLB 2YHDA 2B1ZA 3GYTA 3PBAA 2OVMA 1DKFB 2YJAB 1XPCA 1FD0A 2QA6A 4KZIA 5DVVA 1K74A 2QR9A 3K23A 5DMCA 1K7LA 3W5TA 5IZ0A 4QE8A 1T79A 3KYTA 2ZY0A 5E14A 2Q8SA 5ICKA 5DKBA 4TV1A 3JZCA 1FM6D 1SKXA 2PIQA 4R2UA 5DYBA 1U3SA 5AWKA 1X7JA 3WT5A 2QZOB 1XLSE 1ZKYA 4N73A 5AVLA 1G50A 5E0WA 4JYIA 2AWHA 2AX8A 5DXRA 5DSHA 1UOMA 5DXKA 5KD9A 2QGTA 1A52A 1S9PA 3VRWA 1XV9A 5C4OA 2AXAA 3HZFA 3B3KA 2ZASA 2PINA 4IV2A 3IXPA 3DR1A 4TUZA 3GBKA 4DK8A 2Q7LA 5KRLA 3WT6A 1XP1A 3DT3A 4LNXA 3WTQA 4FGYA 5C4UA 3DZYD 3AUQA 1OVLA 4ITFA 5K13A 1Y0XX 3K8SA 2QTUA 3H52A 3M7RA 1DKFA 3OGTA 1KV6A 5AVIA 3X1IA 3E00A 4OH5A 4ZNUA 2GPOA 5IXKA 1XOWA 3W5PA 5GIEA 3B1MA 2J7XA 3WT7A 4OGHA 4DMAA 4KZJA 1EXAA 1E3KA 4FHHA 2AA7A 1YA3A 2OCFA 2PRGA 2ZBSA 3GWSX 3R8IA 2QZOA 4IV4A 3GZ9A 3LMPA 1E3GA 3OMKA 4JYHA 4KZMA 4OIUA 4PPPA 3VHWA 2YLYA 1K4WA 1ZH7A 5KRKA 3B0QA 5DV6A 5JJMB 2GP7A 1Y9RA 4EMAA 4ZJRA 3B65A 1XNXA 2QA8B 4N8RA 2IOKA 3ZR7A 4IVYA 3R5MA 3IMYA 2VV4B 2IOGA 3N00A 3G8OA 4OKXA 1U3RA 3V9TA 4APUA 2O4JA 4OEYA 4PXMA 2JF9A 4NUFA 3CTBA 4DQMA 5H1EA 4IQRA 4G2HA 1G5YA 5AYGA 2I0JA 5SYZA 3IPSA 4J5WC 4UDDA 1PQ9A 1XZXX 5E0XA 1FM9A 1N83A 5G45A 1ZDUA 5G43A 3HODA 3AX8A 4IWFA 4J26A 5JJMA 2ZXMA 4OKWA 2G0HA 2R6YA 2I0GA 4NY9A 4IA1A 5DV3A 3IPQA 5AAVB 4ZNTA 2ZK2A 1I38A 2I4ZA 4JL4A 1UPVA 1TFCA 5JI0D 4OILA 2VV4A 5DKSA 3TKCA 3VT4A 1IE9A 3CLDA 3AN4A 5FQVA 5DUEA 2P1UA 4OZRE 3OS8C 3A40X 2AA5A 4E4QA 4UDCA 3WFGA 2PIUA 4OFRA 5JY3A 3FS1A 5ACCA 4IWCA 1T63A 3X1HA 4IA2A 3OLFA 3UVVB 3A3ZX 3VRUA 2ZNPA 3BEJA 4RZFA 4ZO1X 2Z4JA 1ZDTA 2ACLB 2NXXE 2VV2A 5DZ3A 2P15A 4M8EA 3TY0A 2HARA 3UUCA 2J7YA 4XI3A 2O9IA 3CDSA 3L0LA 2ZK4A 4FNEA 4POHA 5AAVA 4RZGA 5KCEA 1GWRA 5DMFA 2XYXA 4A2JA 1T7FA 4X1GA 3TKMA 3OSAA 3KDTA 4PWLA 2ZXNA 3DCTA 3FURA 2PIOA 3KDUA 4PPSA 4QE6A 3T03A 5DXBB 3UP3A 3OMMA 4HLWA 1X7BA 1A28A 3D24A 5KCFA 2J14A 5DXQA 4G1YA 2QABA 2GPVA 4OJBA 5KCDA 2E2RA 1NQ1A 2YLOA 3OMQA 3UVVA 3VJTA 2HB8A 2ZKCA 1T7RA 3VTCA 2Z4BA 4FHIA 5DP0A 4CSJA 4O8FA 3IA6A 2ACLA 3OOFA 5B41A 4FN9A 1R5KA 4IA3A 1NQ2A 2GPPA 4REEA 1PZLA 3ADUA 2PITA 1T74A 3OMPA 5DIDA 5E1CA 4QJRA 1NYXA 4JAZA 5KRIA 5DXBA 2XHSA 3W0YA 3ADVA 4DM8A 2POBA 2ZVTA 3IPUA 3VRVA 4ZO1B 3RUUA 2ZLCA 3OMOA 4P6WA 1T7MA 3X36A 3PLZA 3R8AA 3VJIA 4OFUA 4NQAB 1YY4A 3VT9A 2AB2A 3V9VA 5L7GA 1UPWA 3CS4A 3ERDA 5KRAA 3AN3A 1ILGA 2BJ4B 4L98A 5G42A 5KRMA 1KNUA 3FEIA 1KKQA 3VI8A 3V3EA 5CJ6A 3L03A 1R1KA 4NB6A 5HJPB 5AZTA 3VTBA 3B0WA 2PJLA 3OZJA 3OOKA 3D57A 3G0WA 2PIXA 5GT4A 5DZIA 3ADWA 3E94A 3U9QA 2HB7A 4RMDA 4XUHA 3VHUA 3FC6B 3WGPA 2ZXZA 3AUNA 5DXMA 3NSPA 1ERRA 5HJSA 4J24A 2PIVA 4HEEX 5A86A 3SP9A 3B68A 2VSRA 1XIUA 4R6SA 3FALB 4J5XA 2HBHA 1XJ7A 3L3ZA 3RLLA 3ET3A 3O1DA 2BJ4A 1S19A 2GWXA 5G5WA 4LBDA 5L7HA 1YINA 5EGVA 2YFEA 4B7WA 5DV8A 1MVCA 2QGWA 4X1FA 5KR9A 2V0VA 3KPZA 1R20D 1VJBA 2ZFXA 3ADSA 4OEZA 1HG4A 4MG6A 5APJA 2QPYA 4POJA 3H0AD 2B50A 3FC6A 4IW8A 5APHA 5DWIA 2YLPA 2AA6A 5DRJA 1FM6A 1H9UA 2H79A 3OZ0A 3LBDA 3RUTA 1LBDA 4PP6A 1YOKA 4MGDB 5AZVA 3FALA 4CI4A 4G2IA 1GWXA 1YYEA 3ADXA 1OT7A 3HO0A 2V7CA 4OZTU 1PDUA 3RLJA 4IUIA 3P8XA 3B67A 4WPFA 2PIRA 3AZ1A 5DYDA 1RK3A 4DK7A 2AX7A 3OKIA 4JGVA 5DI7A 3DZYA 3B66A 4XHDA 1I7IA 3HM1A 3KMGA 1QKUA 3FXVA 4IW6A 1L2IA 4S0TA 3L1BA 5FQPA 4L96A 4S0SA 1T76A 2QA8A 2YATA 1XB7A 4NIEA 2Q1VA 3KWYA 5KCCA 2GTKA 3R29A 5G44A 1YP0A 4MGDA 3UU7B 4LSJA 2QNVA 2ZNQA 2HVCA 3DZUD 1XQCA 1Y0SA 2IHQA 4QM0A 2ZMHA 3D6DA 4DM6A 2POGA 4G21A 3B5RA 5LGAA 2VSTA 4G1DA 1RKHA 4MGBB 4OHAA 1G2NA 5DUHA 2Q5SA 5DL4A 4YMQA 1GWQA 3CQVA 2I4JA 2OAXA 2AA2A 4OEAA 3V4AA 3AZ3A 4CI5A 5DZ0A 1WM0X 3OS9A 4WHGA 5EHJA 4WHFA 2NV7A 5DU5A 1Z5XU 4IU7A 1MV9A 4OIVA 4RFWA 5DZHA 2ZK3A 3VRTA 3OSIA 2Q7KA 1M7WA 4IS8A 3AURA 4BCRA 3GD2A 1ZEOA 1QKNA 3WJ5A 3UU7A 3ERTA 5I4VA 3OAPA 1DB1A 1M2ZA 4RMCA 1X76A 1PK5A 1RJKA 1Z95A 2Q5GA 3L0JA 2ZK5A 3ET0A 3PRGA 4OKTA 3A9EB 4MGBA 2OUZA 3L3XA 3D90A 4J5WA 1FBYA 2NW4A 3X31A 5DVCA
chains in the Genus database with same CATH topology
4MGCA 4OC7A 3ET2A 1S0XA 2W8YA 4ZNWA 5DLRA 5DTVA 2PIPL 3HC5A 4MG9B 3GWXA 4OH6A 3PCUA 4XAOA 2GL8A 5FQTA 2XKWA 3SZ1A 1ZGYA 3VT3A 1K74D 4EM9A 3PO9A 3K6PA 4WQPA 1SQNA 3R5NA 3D5FA 4MGAB 3OS8A 3QT0A 3ET1A 4Q50A 4OJ9A 2FVJA 4RUPA 2A3IA 5DVSA 1PQ6A 2Q6JA 4N1YA 3F5CB 5G46A 1EREA 3A9EA 3W5QA 4OLMA 1X78A 5EITA 4P6XA 3W0IA 3ZRAA 3WMHA 2ZK0A 3ZQTA 1SR7A 2B23A 2QXSA 1GS4A 1XQ3A 3E7CA 2B1VA 3VT8A 4YNKA 3IXPD 2AAXA 2AMAA 1RDTD 1OSVA 4MG7B 1U9EA 4MG9A 4RAKA 5ETHA 5HCVA 2HWQA 1NUOA 3B0TA 4PVUA 4PLDA 3E00D 3V49A 5LWPA 2HWRA 4OZTE 1XAPA 2QW4A 3SP6A 3CJWA 4K7AA 2ATHA 4MGAA 5AK2A 2VV3A 2BAWA 3V9YA 3W0HA 2HAMA 2XYJA 3ZRBA 3FUGA 3VSOA 4TUZB 5DWGA 3F5CA 4OK1A 3UUAB 5KCUA 5HYRA 1N46A 4PP3A 5KYAA 2ABIA 3S9SA 4ZNVA 3A2HA 2O4RA 2QE4A 2LBDA 3OLSA 4ZJWA 1G1UA 2J4AA 2QMVA 3W0AA 3HVLA 1RKGA 1XP6A 1LV2A 2I4PA 4DORA 4MG7A 3RVFA 3W0CA 3A2IA 5E7VA 5EC9A 2PNUA 2JFAB 2OVHA 3W0GA 2P7GA 2QSEA 4WVDA 5HYKA 2P4YA 4XLDA 4XUMA 1P8DA 5AAUA 3UP0A 5IAWA 1EXXA 2Q60A 5HJPA 1YJEA 1PRGA 3WFFA 4OARA 5KRFA 3UUAA 1RDTA 3CWDA 4Q0AC 5FQRA 2OM9A 3W5RA 1FM9D 3GYUA 5DY8A 3BC5A 5DX3B 1L2JA 3FEJA 4MG8B 1Z5XE 1BSXA 1NQ0A 5DKEA 3WJ4A 2ZNOA 4UDBA 1IE8A 4QK4A 1S9QA 2P7ZA 4MDDA 3BQDA 4ONIA 5EJVA 5DK9A 4DOSA 2REWA 2HC4A 2JFAA 5KYJA 2R40D 1XVPB 3P0UA 5C4SA 2ZK1A 1M13A 2ZNNA 5F9BA 2G0GA 2YLQA 4RUOX 4IA7A 2HFPA 1MZNA 5KCTA 3CS6A 3ADTA 1I7GA 1TXIA 2PIWA 1NQ7A 3A78A 2QXMA 4JYGA 5DXEA 1U3QA 3OLLA 3MNEA 2Q5PA 5DX3A 3CS8A 3K22A 4MG8A 3RY9A 2G44A 3Q95B 2P1TA 1XLSA 4YPQA 2AMBA 3AZ2A 2Q59B 2HCDA 2YJDA 4LTWA 5DKGA 1NAXA 3R8DA 4Q13A 4WLBA 3TX7B 5HZCA 3CDPA 5DUGA 1T7TA 1R20A 1QKTA 3F7DA 3PEQA 1XVPA 5DZ1A 5L11A 2FAIA 3JZBA 1FCZA 3H0AA 1QKMA 3VJHA 1T65A 5APKA 5KRCA 2JJ3A 3FLIA 2G5OA 1FCYA 1UHLB 5C4TA 2ZMIA 3HC6A 3MNPA 2OZ7A 4LNWA 2Q61A 2Q6RA 5AWJA 3MNOA 3WWRA 4ZN9A 5DWLA 2QH6A 4MG5A 5DWEA 5DIEA 2R40A 2VV1B 3Q95A 4A4VA 3KMZA 1N4HA 3ILZA 3GN8A 2Q59A 2HASA 4RMEA 2VV0A 2Q3YA 4K6IA 4UDAA 1X7RA 3A2JA 3KMRA 5KRJA 1P93A 3HLVA 3VJSA 4M8HA 5KROA 3UUDB 4OKBA 4F9MA 5DXPA 2NPAA 3NOAA 1XDKB 4S15A 2FSZA 2P1VA 1T73A 3OSWA 2P7AA 2GPUA 1R6GA 2ZMJA 4ZOMA 5GICA 1YUCA 2XYWA 1YMTA 1UHLA 3O1EA 2AM9A 3VT5A 1PCGA 1Q4XA 4OEDA 5DRMA 1XP9A 3B0RA 3VTDA 4REFA 2ZL9A 3DZUA 3VHVA 2AX6A 5E19A 4E2JA 3VN2A 3W0JA 3R2AA 4QL8A 3V3QA 1S0ZA 2P54A 1I37A 2VV1A 4PLEA 1OSHA 2F4BA 5G3JA 3KBAA 1XNNA 4ITEA 4Y29A 4K4JA 1ZUCA 5KRHA 4RWVA 4E4KA 3OKHA 1T5ZA 4G1ZA 1NDEA 2AYRA 5FQSA 2Q6SA 3P89A 5L7EA 3L0EA 2EWPA 1YOWA 1R1KD 2H77A 3VT6A 5B5BA 1SJ0A 4PF3A 3UUDA 4PRGA 2AX9A 2Q7JA 1XDKA 2Q70A 4RUJA 3KFCA 1X7EA 2Q1HA 1NRLA 4XT9A 5E15A 2Q7IA 4N5GA 5GIDA 2PKLA 3G9EA 4J5XC 5KCWA 3P88A 4YT1A 4ZI1A 5EI1A 4G20A 4R06A 5DIGA 4S14A 4TV1B 1NAVA 1PQCA 3HQ5A 2AO6A 3AFRA 4OZRU 5M96A 1HJ1A 3VT7A 4ZN7A 4OJ4A 4RZEA 4PP5A 3NSQA 4IVWA 2GIUA 3DCUA 1XV9B 4ZNSA 5DWJA 4ZNHA 3EYBA 3VSPA 4RE8A 3DY6A 4A4WA 2NXXA 1NHZA 1YIMA 1ZAFA 4XTAA 2ZK6A 3G8IA 5DXGA 1ILHA 1FCXA 2R6WA 2ZLAA 1OVLB 2YHDA 2B1ZA 3GYTA 3PBAA 2OVMA 1DKFB 2YJAB 1XPCA 1FD0A 2QA6A 4KZIA 5DVVA 1K74A 2QR9A 3K23A 5DMCA 1K7LA 3W5TA 5IZ0A 4QE8A 1T79A 3KYTA 2ZY0A 5E14A 2Q8SA 5ICKA 5DKBA 4TV1A 3JZCA 1FM6D 1SKXA 2PIQA 4R2UA 5DYBA 1U3SA 5AWKA 1X7JA 3WT5A 2QZOB 1XLSE 1ZKYA 4N73A 5AVLA 1G50A 5E0WA 4JYIA 2AWHA 2AX8A 5DXRA 5DSHA 1UOMA 5DXKA 5KD9A 2QGTA 1A52A 1S9PA 3VRWA 1XV9A 5C4OA 2AXAA 3HZFA 3B3KA 2ZASA 2PINA 4IV2A 3IXPA 3DR1A 4TUZA 3GBKA 4DK8A 2Q7LA 5KRLA 3WT6A 1XP1A 3DT3A 4LNXA 3WTQA 4FGYA 5C4UA 3DZYD 3AUQA 1OVLA 4ITFA 5K13A 1Y0XX 3K8SA 2QTUA 3H52A 3M7RA 1DKFA 3OGTA 1KV6A 5AVIA 3X1IA 3E00A 4OH5A 4ZNUA 2GPOA 5IXKA 1XOWA 3W5PA 5GIEA 3B1MA 2J7XA 3WT7A 4OGHA 4DMAA 4KZJA 1EXAA 1E3KA 4FHHA 2AA7A 1YA3A 2OCFA 2PRGA 2ZBSA 3GWSX 3R8IA 2QZOA 4IV4A 3GZ9A 3LMPA 1E3GA 3OMKA 4JYHA 4KZMA 4OIUA 4PPPA 3VHWA 2YLYA 1K4WA 1ZH7A 5KRKA 3B0QA 5DV6A 5JJMB 2GP7A 1Y9RA 4EMAA 4ZJRA 3B65A 1XNXA 2QA8B 4N8RA 2IOKA 3ZR7A 4IVYA 3R5MA 3IMYA 2VV4B 2IOGA 3N00A 3G8OA 4OKXA 1U3RA 3V9TA 4APUA 2O4JA 4OEYA 4PXMA 2JF9A 4NUFA 3CTBA 4DQMA 5H1EA 4IQRA 4G2HA 1G5YA 5AYGA 2I0JA 5SYZA 3IPSA 4J5WC 4UDDA 1PQ9A 1XZXX 5E0XA 1FM9A 1N83A 5G45A 1ZDUA 5G43A 3HODA 3AX8A 4IWFA 4J26A 5JJMA 2ZXMA 4OKWA 2G0HA 2R6YA 2I0GA 4NY9A 4IA1A 5DV3A 3IPQA 5AAVB 4ZNTA 2ZK2A 1I38A 2I4ZA 4JL4A 1UPVA 1TFCA 5JI0D 4OILA 2VV4A 5DKSA 3TKCA 3VT4A 1IE9A 3CLDA 3AN4A 5FQVA 5DUEA 2P1UA 4OZRE 3OS8C 3A40X 2AA5A 4E4QA 4UDCA 3WFGA 2PIUA 4OFRA 5JY3A 3FS1A 5ACCA 4IWCA 1T63A 3X1HA 4IA2A 3OLFA 3UVVB 3A3ZX 3VRUA 2ZNPA 3BEJA 4RZFA 4ZO1X 2Z4JA 1ZDTA 2ACLB 2NXXE 2VV2A 5DZ3A 2P15A 4M8EA 3TY0A 2HARA 3UUCA 2J7YA 4XI3A 2O9IA 3CDSA 3L0LA 2ZK4A 4FNEA 4POHA 5AAVA 4RZGA 5KCEA 1GWRA 5DMFA 2XYXA 4A2JA 1T7FA 4X1GA 3TKMA 3OSAA 3KDTA 4PWLA 2ZXNA 3DCTA 3FURA 2PIOA 3KDUA 4PPSA 4QE6A 3T03A 5DXBB 3UP3A 3OMMA 4HLWA 1X7BA 1A28A 3D24A 5KCFA 2J14A 5DXQA 4G1YA 2QABA 2GPVA 4OJBA 5KCDA 2E2RA 1NQ1A 2YLOA 3OMQA 3UVVA 3VJTA 2HB8A 2ZKCA 1T7RA 3VTCA 2Z4BA 4FHIA 5DP0A 4CSJA 4O8FA 3IA6A 2ACLA 3OOFA 5B41A 4FN9A 1R5KA 4IA3A 1NQ2A 2GPPA 4REEA 1PZLA 3ADUA 2PITA 1T74A 3OMPA 5DIDA 5E1CA 4QJRA 1NYXA 4JAZA 5KRIA 5DXBA 2XHSA 3W0YA 3ADVA 4DM8A 2POBA 2ZVTA 3IPUA 3VRVA 4ZO1B 3RUUA 2ZLCA 3OMOA 4P6WA 1T7MA 3X36A 3PLZA 3R8AA 3VJIA 4OFUA 4NQAB 1YY4A 3VT9A 2AB2A 3V9VA 5L7GA 1UPWA 3CS4A 3ERDA 5KRAA 3AN3A 1ILGA 2BJ4B 4L98A 5G42A 5KRMA 1KNUA 3FEIA 1KKQA 3VI8A 3V3EA 5CJ6A 3L03A 1R1KA 4NB6A 5HJPB 5AZTA 3VTBA 3B0WA 2PJLA 3OZJA 3OOKA 3D57A 3G0WA 2PIXA 5GT4A 5DZIA 3ADWA 3E94A 3U9QA 2HB7A 4RMDA 4XUHA 3VHUA 3FC6B 3WGPA 2ZXZA 3AUNA 5DXMA 3NSPA 1ERRA 5HJSA 4J24A 2PIVA 4HEEX 5A86A 3SP9A 3B68A 2VSRA 1XIUA 4R6SA 3FALB 4J5XA 2HBHA 1XJ7A 3L3ZA 3RLLA 3ET3A 3O1DA 2BJ4A 1S19A 2GWXA 5G5WA 4LBDA 5L7HA 1YINA 5EGVA 2YFEA 4B7WA 5DV8A 1MVCA 2QGWA 4X1FA 5KR9A 2V0VA 3KPZA 1R20D 1VJBA 2ZFXA 3ADSA 4OEZA 1HG4A 4MG6A 5APJA 2QPYA 4POJA 3H0AD 2B50A 3FC6A 4IW8A 5APHA 5DWIA 2YLPA 2AA6A 5DRJA 1FM6A 1H9UA 2H79A 3OZ0A 3LBDA 3RUTA 1LBDA 4PP6A 1YOKA 4MGDB 5AZVA 3FALA 4CI4A 4G2IA 1GWXA 1YYEA 3ADXA 1OT7A 3HO0A 2V7CA 4OZTU 1PDUA 3RLJA 4IUIA 3P8XA 3B67A 4WPFA 2PIRA 3AZ1A 5DYDA 1RK3A 4DK7A 2AX7A 3OKIA 4JGVA 5DI7A 3DZYA 3B66A 4XHDA 1I7IA 3HM1A 3KMGA 1QKUA 3FXVA 4IW6A 1L2IA 4S0TA 3L1BA 5FQPA 4L96A 4S0SA 1T76A 2QA8A 2YATA 1XB7A 4NIEA 2Q1VA 3KWYA 5KCCA 2GTKA 3R29A 5G44A 1YP0A 4MGDA 3UU7B 4LSJA 2QNVA 2ZNQA 2HVCA 3DZUD 1XQCA 1Y0SA 2IHQA 4QM0A 2ZMHA 3D6DA 4DM6A 2POGA 4G21A 3B5RA 5LGAA 2VSTA 4G1DA 1RKHA 4MGBB 4OHAA 1G2NA 5DUHA 2Q5SA 5DL4A 4YMQA 1GWQA 3CQVA 2I4JA 2OAXA 2AA2A 4OEAA 3V4AA 3AZ3A 4CI5A 5DZ0A 1WM0X 3OS9A 4WHGA 5EHJA 4WHFA 2NV7A 5DU5A 1Z5XU 4IU7A 1MV9A 4OIVA 4RFWA 5DZHA 2ZK3A 3VRTA 3OSIA 2Q7KA 1M7WA 4IS8A 3AURA 4BCRA 3GD2A 1ZEOA 1QKNA 3WJ5A 3UU7A 3ERTA 5I4VA 3OAPA 1DB1A 1M2ZA 4RMCA 1X76A 1PK5A 1RJKA 1Z95A 2Q5GA 3L0JA 2ZK5A 3ET0A 3PRGA 4OKTA 3A9EB 4MGBA 2OUZA 3L3XA 3D90A 4J5WA 1FBYA 2NW4A 3X31A 5DVCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MGC A;  4OC7 A;  3ET2 A;  1S0X A;  2W8Y A;  4ZNW A;  5DLR A;  5DTV A;  2PIP L;  3HC5 A;  4MG9 B;  3GWX A;  4OH6 A;  3PCU A;  4XAO A;  2GL8 A;  5FQT A;  2XKW A;  3SZ1 A;  1ZGY A;  3VT3 A;  1K74 D;  4EM9 A;  3PO9 A;  3K6P A;  4WQP A;  1SQN A;  3R5N A;  3D5F A;  4MGA B;  3OS8 A;  3QT0 A;  3ET1 A;  4Q50 A;  4OJ9 A;  2FVJ A;  4RUP A;  2A3I A;  5DVS A;  1PQ6 A;  2Q6J A;  4N1Y A;  3F5C B;  5G46 A;  1ERE A;  3A9E A;  3W5Q A;  4OLM A;  1X78 A;  5EIT A;  4P6X A;  3W0I A;  3ZRA A;  3WMH A;  2ZK0 A;  3ZQT A;  1SR7 A;  2B23 A;  2QXS A;  1GS4 A;  1XQ3 A;  3E7C A;  2B1V A;  3VT8 A;  4YNK A;  3IXP D;  2AAX A;  2AMA A;  1RDT D;  1OSV A;  4MG7 B;  1U9E A;  4MG9 A;  4RAK A;  5ETH A;  5HCV A;  2HWQ A;  1NUO A;  3B0T A;  4PVU A;  4PLD A;  3E00 D;  3V49 A;  5LWP A;  2HWR A;  4OZT E;  1XAP A;  2QW4 A;  3SP6 A;  3CJW A;  4K7A A;  2ATH A;  4MGA A;  5AK2 A;  2VV3 A;  2BAW A;  3V9Y A;  3W0H A;  2HAM A;  2XYJ A;  3ZRB A;  3FUG A;  3VSO A;  4TUZ B;  5DWG A;  3F5C A;  4OK1 A;  3UUA B;  5KCU A;  5HYR A;  1N46 A;  4PP3 A;  5KYA A;  2ABI A;  3S9S A;  4ZNV A;  3A2H A;  2O4R A;  2QE4 A;  2LBD A;  3OLS A;  4ZJW A;  1G1U A;  2J4A A;  2QMV A;  3W0A A;  3HVL A;  1RKG A;  1XP6 A;  1LV2 A;  2I4P A;  4DOR A;  4MG7 A;  3RVF A;  3W0C A;  3A2I A;  5E7V A;  5EC9 A;  2PNU A;  2JFA B;  2OVH A;  3W0G A;  2P7G A;  2QSE A;  4WVD A;  5HYK A;  2P4Y A;  4XLD A;  4XUM A;  1P8D A;  5AAU A;  3UP0 A;  5IAW A;  1EXX A;  2Q60 A;  5HJP A;  1YJE A;  1PRG A;  3WFF A;  4OAR A;  5KRF A;  3UUA A;  1RDT A;  3CWD A;  4Q0A C;  5FQR A;  2OM9 A;  3W5R A;  1FM9 D;  3GYU A;  5DY8 A;  3BC5 A;  5DX3 B;  1L2J A;  3FEJ A;  4MG8 B;  1Z5X E;  1BSX A;  1NQ0 A;  5DKE A;  3WJ4 A;  2ZNO A;  4UDB A;  1IE8 A;  4QK4 A;  1S9Q A;  2P7Z A;  4MDD A;  3BQD A;  4ONI A;  5EJV A;  5DK9 A;  4DOS A;  2REW A;  2HC4 A;  2JFA A;  5KYJ A;  2R40 D;  1XVP B;  3P0U A;  5C4S A;  2ZK1 A;  1M13 A;  2ZNN A;  5F9B A;  2G0G A;  2YLQ A;  4RUO X;  4IA7 A;  2HFP A;  1MZN A;  5KCT A;  3CS6 A;  3ADT A;  1I7G A;  1TXI A;  2PIW A;  1NQ7 A;  3A78 A;  2QXM A;  4JYG A;  5DXE A;  1U3Q A;  3OLL A;  3MNE A;  2Q5P A;  5DX3 A;  3CS8 A;  3K22 A;  4MG8 A;  3RY9 A;  2G44 A;  3Q95 B;  2P1T A;  1XLS A;  4YPQ A;  2AMB A;  3AZ2 A;  2Q59 B;  2HCD A;  2YJD A;  4LTW A;  5DKG A;  1NAX A;  3R8D A;  4Q13 A;  4WLB A;  3TX7 B;  5HZC A;  3CDP A;  5DUG A;  1T7T A;  1R20 A;  1QKT A;  3F7D A;  3PEQ A;  1XVP A;  5DZ1 A;  5L11 A;  2FAI A;  3JZB A;  1FCZ A;  3H0A A;  1QKM A;  3VJH A;  1T65 A;  5APK A;  5KRC A;  2JJ3 A;  3FLI A;  2G5O A;  1FCY A;  1UHL B;  5C4T A;  2ZMI A;  3HC6 A;  3MNP A;  2OZ7 A;  4LNW A;  2Q61 A;  2Q6R A;  5AWJ A;  3MNO A;  3WWR A;  4ZN9 A;  5DWL A;  2QH6 A;  4MG5 A;  5DWE A;  5DIE A;  2R40 A;  2VV1 B;  3Q95 A;  4A4V A;  3KMZ A;  1N4H A;  3ILZ A;  3GN8 A;  2Q59 A;  2HAS A;  4RME A;  2VV0 A;  2Q3Y A;  4K6I A;  4UDA A;  1X7R A;  3A2J A;  3KMR A;  5KRJ A;  1P93 A;  3HLV A;  3VJS A;  4M8H A;  5KRO A;  3UUD B;  4OKB A;  4F9M A;  5DXP A;  2NPA A;  3NOA A;  1XDK B;  4S15 A;  2FSZ A;  2P1V A;  1T73 A;  3OSW A;  2P7A A;  2GPU A;  1R6G A;  2ZMJ A;  4ZOM A;  5GIC A;  1YUC A;  2XYW A;  1YMT A;  1UHL A;  3O1E A;  2AM9 A;  3VT5 A;  1PCG A;  1Q4X A;  4OED A;  5DRM A;  1XP9 A;  3B0R A;  3VTD A;  4REF A;  2ZL9 A;  3DZU A;  3VHV A;  2AX6 A;  5E19 A;  4E2J A;  3VN2 A;  3W0J A;  3R2A A;  4QL8 A;  3V3Q A;  1S0Z A;  2P54 A;  1I37 A;  2VV1 A;  4PLE A;  1OSH A;  2F4B A;  5G3J A;  3KBA A;  1XNN A;  4ITE A;  4Y29 A;  4K4J A;  1ZUC A;  5KRH A;  4RWV A;  4E4K A;  3OKH A;  1T5Z A;  4G1Z A;  1NDE A;  2AYR A;  5FQS A;  2Q6S A;  3P89 A;  5L7E A;  3L0E A;  2EWP A;  1YOW A;  1R1K D;  2H77 A;  3VT6 A;  5B5B A;  1SJ0 A;  4PF3 A;  3UUD A;  4PRG A;  2AX9 A;  2Q7J A;  1XDK A;  2Q70 A;  4RUJ A;  3KFC A;  1X7E A;  2Q1H A;  1NRL A;  4XT9 A;  5E15 A;  2Q7I A;  4N5G A;  5GID A;  2PKL A;  3G9E A;  4J5X C;  5KCW A;  3P88 A;  4YT1 A;  4ZI1 A;  5EI1 A;  4G20 A;  4R06 A;  5DIG A;  4S14 A;  4TV1 B;  1NAV A;  1PQC A;  3HQ5 A;  2AO6 A;  3AFR A;  4OZR U;  5M96 A;  1HJ1 A;  3VT7 A;  4ZN7 A;  4OJ4 A;  4RZE A;  4PP5 A;  3NSQ A;  4IVW A;  2GIU A;  3DCU A;  1XV9 B;  4ZNS A;  5DWJ A;  4ZNH A;  3EYB A;  3VSP A;  4RE8 A;  3DY6 A;  4A4W A;  2NXX A;  1NHZ A;  1YIM A;  1ZAF A;  4XTA A;  2ZK6 A;  3G8I A;  5DXG A;  1ILH A;  1FCX A;  2R6W A;  2ZLA A;  1OVL B;  2YHD A;  2B1Z A;  3GYT A;  3PBA A;  2OVM A;  1DKF B;  2YJA B;  1XPC A;  1FD0 A;  2QA6 A;  4KZI A;  5DVV A;  1K74 A;  2QR9 A;  3K23 A;  5DMC A;  1K7L A;  3W5T A;  5IZ0 A;  4QE8 A;  1T79 A;  3KYT A;  2ZY0 A;  5E14 A;  2Q8S A;  5ICK A;  5DKB A;  4TV1 A;  3JZC A;  1FM6 D;  1SKX A;  2PIQ A;  4R2U A;  5DYB A;  1U3S A;  5AWK A;  1X7J A;  3WT5 A;  2QZO B;  1XLS E;  1ZKY A;  4N73 A;  5AVL A;  1G50 A;  5E0W A;  4JYI A;  2AWH A;  2AX8 A;  5DXR A;  5DSH A;  1UOM A;  5DXK A;  5KD9 A;  2QGT A;  1A52 A;  1S9P A;  3VRW A;  1XV9 A;  5C4O A;  2AXA A;  3HZF A;  3B3K A;  2ZAS A;  2PIN A;  4IV2 A;  3IXP A;  3DR1 A;  4TUZ A;  3GBK A;  4DK8 A;  2Q7L A;  5KRL A;  3WT6 A;  1XP1 A;  3DT3 A;  4LNX A;  3WTQ A;  4FGY A;  5C4U A;  3DZY D;  3AUQ A;  1OVL A;  4ITF A;  5K13 A;  1Y0X X;  3K8S A;  2QTU A;  3H52 A;  3M7R A;  1DKF A;  3OGT A;  1KV6 A;  5AVI A;  3X1I A;  3E00 A;  4OH5 A;  4ZNU A;  2GPO A;  5IXK A;  1XOW A;  3W5P A;  5GIE A;  3B1M A;  2J7X A;  3WT7 A;  4OGH A;  4DMA A;  4KZJ A;  1EXA A;  1E3K A;  4FHH A;  2AA7 A;  1YA3 A;  2OCF A;  2PRG A;  2ZBS A;  3GWS X;  3R8I A;  2QZO A;  4IV4 A;  3GZ9 A;  3LMP A;  1E3G A;  3OMK A;  4JYH A;  4KZM A;  4OIU A;  4PPP A;  3VHW A;  2YLY A;  1K4W A;  1ZH7 A;  5KRK A;  3B0Q A;  5DV6 A;  5JJM B;  2GP7 A;  1Y9R A;  4EMA A;  4ZJR A;  3B65 A;  1XNX A;  2QA8 B;  4N8R A;  2IOK A;  3ZR7 A;  4IVY A;  3R5M A;  3IMY A;  2VV4 B;  2IOG A;  3N00 A;  3G8O A;  4OKX A;  1U3R A;  3V9T A;  4APU A;  2O4J A;  4OEY A;  4PXM A;  2JF9 A;  4NUF A;  3CTB A;  4DQM A;  5H1E A;  4IQR A;  4G2H A;  1G5Y A;  5AYG A;  2I0J A;  5SYZ A;  3IPS A;  4J5W C;  4UDD A;  1PQ9 A;  1XZX X;  5E0X A;  1FM9 A;  1N83 A;  5G45 A;  1ZDU A;  5G43 A;  3HOD A;  3AX8 A;  4IWF A;  4J26 A;  5JJM A;  2ZXM A;  4OKW A;  2G0H A;  2R6Y A;  2I0G A;  4NY9 A;  4IA1 A;  5DV3 A;  3IPQ A;  5AAV B;  4ZNT A;  2ZK2 A;  1I38 A;  2I4Z A;  4JL4 A;  1UPV A;  1TFC A;  5JI0 D;  4OIL A;  2VV4 A;  5DKS A;  3TKC A;  3VT4 A;  1IE9 A;  3CLD A;  3AN4 A;  5FQV A;  5DUE A;  2P1U A;  4OZR E;  3OS8 C;  3A40 X;  2AA5 A;  4E4Q A;  4UDC A;  3WFG A;  2PIU A;  4OFR A;  5JY3 A;  3FS1 A;  5ACC A;  4IWC A;  1T63 A;  3X1H A;  4IA2 A;  3OLF A;  3UVV B;  3A3Z X;  3VRU A;  2ZNP A;  3BEJ A;  4RZF A;  4ZO1 X;  2Z4J A;  1ZDT A;  2ACL B;  2NXX E;  2VV2 A;  5DZ3 A;  2P15 A;  4M8E A;  3TY0 A;  2HAR A;  3UUC A;  2J7Y A;  4XI3 A;  2O9I A;  3CDS A;  3L0L A;  2ZK4 A;  4FNE A;  4POH A;  5AAV A;  4RZG A;  5KCE A;  1GWR A;  5DMF A;  2XYX A;  4A2J A;  1T7F A;  4X1G A;  3TKM A;  3OSA A;  3KDT A;  4PWL A;  2ZXN A;  3DCT A;  3FUR A;  2PIO A;  3KDU A;  4PPS A;  4QE6 A;  3T03 A;  5DXB B;  3UP3 A;  3OMM A;  4HLW A;  1X7B A;  1A28 A;  3D24 A;  5KCF A;  2J14 A;  5DXQ A;  4G1Y A;  2QAB A;  2GPV A;  4OJB A;  5KCD A;  2E2R A;  1NQ1 A;  2YLO A;  3OMQ A;  3UVV A;  3VJT A;  2HB8 A;  2ZKC A;  1T7R A;  3VTC A;  2Z4B A;  4FHI A;  5DP0 A;  4CSJ A;  4O8F A;  3IA6 A;  2ACL A;  3OOF A;  5B41 A;  4FN9 A;  1R5K A;  4IA3 A;  1NQ2 A;  2GPP A;  4REE A;  1PZL A;  3ADU A;  2PIT A;  1T74 A;  3OMP A;  5DID A;  5E1C A;  4QJR A;  1NYX A;  4JAZ A;  5KRI A;  5DXB A;  2XHS A;  3W0Y A;  3ADV A;  4DM8 A;  2POB A;  2ZVT A;  3IPU A;  3VRV A;  4ZO1 B;  3RUU A;  2ZLC A;  3OMO A;  4P6W A;  1T7M A;  3X36 A;  3PLZ A;  3R8A A;  3VJI A;  4OFU A;  4NQA B;  1YY4 A;  3VT9 A;  2AB2 A;  3V9V A;  5L7G A;  1UPW A;  3CS4 A;  3ERD A;  5KRA A;  3AN3 A;  1ILG A;  2BJ4 B;  4L98 A;  5G42 A;  5KRM A;  1KNU A;  3FEI A;  1KKQ A;  3VI8 A;  3V3E A;  5CJ6 A;  3L03 A;  1R1K A;  4NB6 A;  5HJP B;  5AZT A;  3VTB A;  3B0W A;  2PJL A;  3OZJ A;  3OOK A;  3D57 A;  3G0W A;  2PIX A;  5GT4 A;  5DZI A;  3ADW A;  3E94 A;  3U9Q A;  2HB7 A;  4RMD A;  4XUH A;  3VHU A;  3FC6 B;  3WGP A;  2ZXZ A;  3AUN A;  5DXM A;  3NSP A;  1ERR A;  5HJS A;  4J24 A;  2PIV A;  4HEE X;  5A86 A;  3SP9 A;  3B68 A;  2VSR A;  1XIU A;  4R6S A;  3FAL B;  4J5X A;  2HBH A;  1XJ7 A;  3L3Z A;  3RLL A;  3ET3 A;  3O1D A;  2BJ4 A;  1S19 A;  2GWX A;  5G5W A;  4LBD A;  5L7H A;  1YIN A;  5EGV A;  2YFE A;  4B7W A;  5DV8 A;  1MVC A;  2QGW A;  4X1F A;  5KR9 A;  2V0V A;  3KPZ A;  1R20 D;  1VJB A;  2ZFX A;  3ADS A;  4OEZ A;  1HG4 A;  4MG6 A;  5APJ A;  2QPY A;  4POJ A;  3H0A D;  2B50 A;  3FC6 A;  4IW8 A;  5APH A;  5DWI A;  2YLP A;  2AA6 A;  5DRJ A;  1FM6 A;  1H9U A;  2H79 A;  3OZ0 A;  3LBD A;  3RUT A;  1LBD A;  4PP6 A;  1YOK A;  4MGD B;  5AZV A;  3FAL A;  4CI4 A;  4G2I A;  1GWX A;  1YYE A;  3ADX A;  1OT7 A;  3HO0 A;  2V7C A;  4OZT U;  1PDU A;  3RLJ A;  4IUI A;  3P8X A;  3B67 A;  4WPF A;  2PIR A;  3AZ1 A;  5DYD A;  1RK3 A;  4DK7 A;  2AX7 A;  3OKI A;  4JGV A;  5DI7 A;  3DZY A;  3B66 A;  4XHD A;  1I7I A;  3HM1 A;  3KMG A;  1QKU A;  3FXV A;  4IW6 A;  1L2I A;  4S0T A;  3L1B A;  5FQP A;  4L96 A;  4S0S A;  1T76 A;  2QA8 A;  2YAT A;  1XB7 A;  4NIE A;  2Q1V A;  3KWY A;  5KCC A;  2GTK A;  3R29 A;  5G44 A;  1YP0 A;  4MGD A;  3UU7 B;  4LSJ A;  2QNV A;  2ZNQ A;  2HVC A;  3DZU D;  1XQC A;  1Y0S A;  2IHQ A;  4QM0 A;  2ZMH A;  3D6D A;  4DM6 A;  2POG A;  4G21 A;  3B5R A;  5LGA A;  2VST A;  4G1D A;  1RKH A;  4MGB B;  4OHA A;  1G2N A;  5DUH A;  2Q5S A;  5DL4 A;  4YMQ A;  1GWQ A;  3CQV A;  2I4J A;  2OAX A;  2AA2 A;  4OEA A;  3V4A A;  3AZ3 A;  4CI5 A;  5DZ0 A;  1WM0 X;  3OS9 A;  4WHG A;  5EHJ A;  4WHF A;  2NV7 A;  5DU5 A;  1Z5X U;  4IU7 A;  1MV9 A;  4OIV A;  4RFW A;  5DZH A;  2ZK3 A;  3VRT A;  3OSI A;  2Q7K A;  1M7W A;  4IS8 A;  3AUR A;  4BCR A;  3GD2 A;  1ZEO A;  1QKN A;  3WJ5 A;  3UU7 A;  3ERT A;  5I4V A;  3OAP A;  1DB1 A;  1M2Z A;  4RMC A;  1X76 A;  1PK5 A;  1RJK A;  1Z95 A;  2Q5G A;  3L0J A;  2ZK5 A;  3ET0 A;  3PRG A;  4OKT A;  3A9E B;  4MGB A;  2OUZ A;  3L3X A;  3D90 A;  4J5W A;  1FBY A;  2NW4 A;  3X31 A;  5DVC A; 
#chains in the Genus database with same CATH topology
 4MGC A;  4OC7 A;  3ET2 A;  1S0X A;  2W8Y A;  4ZNW A;  5DLR A;  5DTV A;  2PIP L;  3HC5 A;  4MG9 B;  3GWX A;  4OH6 A;  3PCU A;  4XAO A;  2GL8 A;  5FQT A;  2XKW A;  3SZ1 A;  1ZGY A;  3VT3 A;  1K74 D;  4EM9 A;  3PO9 A;  3K6P A;  4WQP A;  1SQN A;  3R5N A;  3D5F A;  4MGA B;  3OS8 A;  3QT0 A;  3ET1 A;  4Q50 A;  4OJ9 A;  2FVJ A;  4RUP A;  2A3I A;  5DVS A;  1PQ6 A;  2Q6J A;  4N1Y A;  3F5C B;  5G46 A;  1ERE A;  3A9E A;  3W5Q A;  4OLM A;  1X78 A;  5EIT A;  4P6X A;  3W0I A;  3ZRA A;  3WMH A;  2ZK0 A;  3ZQT A;  1SR7 A;  2B23 A;  2QXS A;  1GS4 A;  1XQ3 A;  3E7C A;  2B1V A;  3VT8 A;  4YNK A;  3IXP D;  2AAX A;  2AMA A;  1RDT D;  1OSV A;  4MG7 B;  1U9E A;  4MG9 A;  4RAK A;  5ETH A;  5HCV A;  2HWQ A;  1NUO A;  3B0T A;  4PVU A;  4PLD A;  3E00 D;  3V49 A;  5LWP A;  2HWR A;  4OZT E;  1XAP A;  2QW4 A;  3SP6 A;  3CJW A;  4K7A A;  2ATH A;  4MGA A;  5AK2 A;  2VV3 A;  2BAW A;  3V9Y A;  3W0H A;  2HAM A;  2XYJ A;  3ZRB A;  3FUG A;  3VSO A;  4TUZ B;  5DWG A;  3F5C A;  4OK1 A;  3UUA B;  5KCU A;  5HYR A;  1N46 A;  4PP3 A;  5KYA A;  2ABI A;  3S9S A;  4ZNV A;  3A2H A;  2O4R A;  2QE4 A;  2LBD A;  3OLS A;  4ZJW A;  1G1U A;  2J4A A;  2QMV A;  3W0A A;  3HVL A;  1RKG A;  1XP6 A;  1LV2 A;  2I4P A;  4DOR A;  4MG7 A;  3RVF A;  3W0C A;  3A2I A;  5E7V A;  5EC9 A;  2PNU A;  2JFA B;  2OVH A;  3W0G A;  2P7G A;  2QSE A;  4WVD A;  5HYK A;  2P4Y A;  4XLD A;  4XUM A;  1P8D A;  5AAU A;  3UP0 A;  5IAW A;  1EXX A;  2Q60 A;  5HJP A;  1YJE A;  1PRG A;  3WFF A;  4OAR A;  5KRF A;  3UUA A;  1RDT A;  3CWD A;  4Q0A C;  5FQR A;  2OM9 A;  3W5R A;  1FM9 D;  3GYU A;  5DY8 A;  3BC5 A;  5DX3 B;  1L2J A;  3FEJ A;  4MG8 B;  1Z5X E;  1BSX A;  1NQ0 A;  5DKE A;  3WJ4 A;  2ZNO A;  4UDB A;  1IE8 A;  4QK4 A;  1S9Q A;  2P7Z A;  4MDD A;  3BQD A;  4ONI A;  5EJV A;  5DK9 A;  4DOS A;  2REW A;  2HC4 A;  2JFA A;  5KYJ A;  2R40 D;  1XVP B;  3P0U A;  5C4S A;  2ZK1 A;  1M13 A;  2ZNN A;  5F9B A;  2G0G A;  2YLQ A;  4RUO X;  4IA7 A;  2HFP A;  1MZN A;  5KCT A;  3CS6 A;  3ADT A;  1I7G A;  1TXI A;  2PIW A;  1NQ7 A;  3A78 A;  2QXM A;  4JYG A;  5DXE A;  1U3Q A;  3OLL A;  3MNE A;  2Q5P A;  5DX3 A;  3CS8 A;  3K22 A;  4MG8 A;  3RY9 A;  2G44 A;  3Q95 B;  2P1T A;  1XLS A;  4YPQ A;  2AMB A;  3AZ2 A;  2Q59 B;  2HCD A;  2YJD A;  4LTW A;  5DKG A;  1NAX A;  3R8D A;  4Q13 A;  4WLB A;  3TX7 B;  5HZC A;  3CDP A;  5DUG A;  1T7T A;  1R20 A;  1QKT A;  3F7D A;  3PEQ A;  1XVP A;  5DZ1 A;  5L11 A;  2FAI A;  3JZB A;  1FCZ A;  3H0A A;  1QKM A;  3VJH A;  1T65 A;  5APK A;  5KRC A;  2JJ3 A;  3FLI A;  2G5O A;  1FCY A;  1UHL B;  5C4T A;  2ZMI A;  3HC6 A;  3MNP A;  2OZ7 A;  4LNW A;  2Q61 A;  2Q6R A;  5AWJ A;  3MNO A;  3WWR A;  4ZN9 A;  5DWL A;  2QH6 A;  4MG5 A;  5DWE A;  5DIE A;  2R40 A;  2VV1 B;  3Q95 A;  4A4V A;  3KMZ A;  1N4H A;  3ILZ A;  3GN8 A;  2Q59 A;  2HAS A;  4RME A;  2VV0 A;  2Q3Y A;  4K6I A;  4UDA A;  1X7R A;  3A2J A;  3KMR A;  5KRJ A;  1P93 A;  3HLV A;  3VJS A;  4M8H A;  5KRO A;  3UUD B;  4OKB A;  4F9M A;  5DXP A;  2NPA A;  3NOA A;  1XDK B;  4S15 A;  2FSZ A;  2P1V A;  1T73 A;  3OSW A;  2P7A A;  2GPU A;  1R6G A;  2ZMJ A;  4ZOM A;  5GIC A;  1YUC A;  2XYW A;  1YMT A;  1UHL A;  3O1E A;  2AM9 A;  3VT5 A;  1PCG A;  1Q4X A;  4OED A;  5DRM A;  1XP9 A;  3B0R A;  3VTD A;  4REF A;  2ZL9 A;  3DZU A;  3VHV A;  2AX6 A;  5E19 A;  4E2J A;  3VN2 A;  3W0J A;  3R2A A;  4QL8 A;  3V3Q A;  1S0Z A;  2P54 A;  1I37 A;  2VV1 A;  4PLE A;  1OSH A;  2F4B A;  5G3J A;  3KBA A;  1XNN A;  4ITE A;  4Y29 A;  4K4J A;  1ZUC A;  5KRH A;  4RWV A;  4E4K A;  3OKH A;  1T5Z A;  4G1Z A;  1NDE A;  2AYR A;  5FQS A;  2Q6S A;  3P89 A;  5L7E A;  3L0E A;  2EWP A;  1YOW A;  1R1K D;  2H77 A;  3VT6 A;  5B5B A;  1SJ0 A;  4PF3 A;  3UUD A;  4PRG A;  2AX9 A;  2Q7J A;  1XDK A;  2Q70 A;  4RUJ A;  3KFC A;  1X7E A;  2Q1H A;  1NRL A;  4XT9 A;  5E15 A;  2Q7I A;  4N5G A;  5GID A;  2PKL A;  3G9E A;  4J5X C;  5KCW A;  3P88 A;  4YT1 A;  4ZI1 A;  5EI1 A;  4G20 A;  4R06 A;  5DIG A;  4S14 A;  4TV1 B;  1NAV A;  1PQC A;  3HQ5 A;  2AO6 A;  3AFR A;  4OZR U;  5M96 A;  1HJ1 A;  3VT7 A;  4ZN7 A;  4OJ4 A;  4RZE A;  4PP5 A;  3NSQ A;  4IVW A;  2GIU A;  3DCU A;  1XV9 B;  4ZNS A;  5DWJ A;  4ZNH A;  3EYB A;  3VSP A;  4RE8 A;  3DY6 A;  4A4W A;  2NXX A;  1NHZ A;  1YIM A;  1ZAF A;  4XTA A;  2ZK6 A;  3G8I A;  5DXG A;  1ILH A;  1FCX A;  2R6W A;  2ZLA A;  1OVL B;  2YHD A;  2B1Z A;  3GYT A;  3PBA A;  2OVM A;  1DKF B;  2YJA B;  1XPC A;  1FD0 A;  2QA6 A;  4KZI A;  5DVV A;  1K74 A;  2QR9 A;  3K23 A;  5DMC A;  1K7L A;  3W5T A;  5IZ0 A;  4QE8 A;  1T79 A;  3KYT A;  2ZY0 A;  5E14 A;  2Q8S A;  5ICK A;  5DKB A;  4TV1 A;  3JZC A;  1FM6 D;  1SKX A;  2PIQ A;  4R2U A;  5DYB A;  1U3S A;  5AWK A;  1X7J A;  3WT5 A;  2QZO B;  1XLS E;  1ZKY A;  4N73 A;  5AVL A;  1G50 A;  5E0W A;  4JYI A;  2AWH A;  2AX8 A;  5DXR A;  5DSH A;  1UOM A;  5DXK A;  5KD9 A;  2QGT A;  1A52 A;  1S9P A;  3VRW A;  1XV9 A;  5C4O A;  2AXA A;  3HZF A;  3B3K A;  2ZAS A;  2PIN A;  4IV2 A;  3IXP A;  3DR1 A;  4TUZ A;  3GBK A;  4DK8 A;  2Q7L A;  5KRL A;  3WT6 A;  1XP1 A;  3DT3 A;  4LNX A;  3WTQ A;  4FGY A;  5C4U A;  3DZY D;  3AUQ A;  1OVL A;  4ITF A;  5K13 A;  1Y0X X;  3K8S A;  2QTU A;  3H52 A;  3M7R A;  1DKF A;  3OGT A;  1KV6 A;  5AVI A;  3X1I A;  3E00 A;  4OH5 A;  4ZNU A;  2GPO A;  5IXK A;  1XOW A;  3W5P A;  5GIE A;  3B1M A;  2J7X A;  3WT7 A;  4OGH A;  4DMA A;  4KZJ A;  1EXA A;  1E3K A;  4FHH A;  2AA7 A;  1YA3 A;  2OCF A;  2PRG A;  2ZBS A;  3GWS X;  3R8I A;  2QZO A;  4IV4 A;  3GZ9 A;  3LMP A;  1E3G A;  3OMK A;  4JYH A;  4KZM A;  4OIU A;  4PPP A;  3VHW A;  2YLY A;  1K4W A;  1ZH7 A;  5KRK A;  3B0Q A;  5DV6 A;  5JJM B;  2GP7 A;  1Y9R A;  4EMA A;  4ZJR A;  3B65 A;  1XNX A;  2QA8 B;  4N8R A;  2IOK A;  3ZR7 A;  4IVY A;  3R5M A;  3IMY A;  2VV4 B;  2IOG A;  3N00 A;  3G8O A;  4OKX A;  1U3R A;  3V9T A;  4APU A;  2O4J A;  4OEY A;  4PXM A;  2JF9 A;  4NUF A;  3CTB A;  4DQM A;  5H1E A;  4IQR A;  4G2H A;  1G5Y A;  5AYG A;  2I0J A;  5SYZ A;  3IPS A;  4J5W C;  4UDD A;  1PQ9 A;  1XZX X;  5E0X A;  1FM9 A;  1N83 A;  5G45 A;  1ZDU A;  5G43 A;  3HOD A;  3AX8 A;  4IWF A;  4J26 A;  5JJM A;  2ZXM A;  4OKW A;  2G0H A;  2R6Y A;  2I0G A;  4NY9 A;  4IA1 A;  5DV3 A;  3IPQ A;  5AAV B;  4ZNT A;  2ZK2 A;  1I38 A;  2I4Z A;  4JL4 A;  1UPV A;  1TFC A;  5JI0 D;  4OIL A;  2VV4 A;  5DKS A;  3TKC A;  3VT4 A;  1IE9 A;  3CLD A;  3AN4 A;  5FQV A;  5DUE A;  2P1U A;  4OZR E;  3OS8 C;  3A40 X;  2AA5 A;  4E4Q A;  4UDC A;  3WFG A;  2PIU A;  4OFR A;  5JY3 A;  3FS1 A;  5ACC A;  4IWC A;  1T63 A;  3X1H A;  4IA2 A;  3OLF A;  3UVV B;  3A3Z X;  3VRU A;  2ZNP A;  3BEJ A;  4RZF A;  4ZO1 X;  2Z4J A;  1ZDT A;  2ACL B;  2NXX E;  2VV2 A;  5DZ3 A;  2P15 A;  4M8E A;  3TY0 A;  2HAR A;  3UUC A;  2J7Y A;  4XI3 A;  2O9I A;  3CDS A;  3L0L A;  2ZK4 A;  4FNE A;  4POH A;  5AAV A;  4RZG A;  5KCE A;  1GWR A;  5DMF A;  2XYX A;  4A2J A;  1T7F A;  4X1G A;  3TKM A;  3OSA A;  3KDT A;  4PWL A;  2ZXN A;  3DCT A;  3FUR A;  2PIO A;  3KDU A;  4PPS A;  4QE6 A;  3T03 A;  5DXB B;  3UP3 A;  3OMM A;  4HLW A;  1X7B A;  1A28 A;  3D24 A;  5KCF A;  2J14 A;  5DXQ A;  4G1Y A;  2QAB A;  2GPV A;  4OJB A;  5KCD A;  2E2R A;  1NQ1 A;  2YLO A;  3OMQ A;  3UVV A;  3VJT A;  2HB8 A;  2ZKC A;  1T7R A;  3VTC A;  2Z4B A;  4FHI A;  5DP0 A;  4CSJ A;  4O8F A;  3IA6 A;  2ACL A;  3OOF A;  5B41 A;  4FN9 A;  1R5K A;  4IA3 A;  1NQ2 A;  2GPP A;  4REE A;  1PZL A;  3ADU A;  2PIT A;  1T74 A;  3OMP A;  5DID A;  5E1C A;  4QJR A;  1NYX A;  4JAZ A;  5KRI A;  5DXB A;  2XHS A;  3W0Y A;  3ADV A;  4DM8 A;  2POB A;  2ZVT A;  3IPU A;  3VRV A;  4ZO1 B;  3RUU A;  2ZLC A;  3OMO A;  4P6W A;  1T7M A;  3X36 A;  3PLZ A;  3R8A A;  3VJI A;  4OFU A;  4NQA B;  1YY4 A;  3VT9 A;  2AB2 A;  3V9V A;  5L7G A;  1UPW A;  3CS4 A;  3ERD A;  5KRA A;  3AN3 A;  1ILG A;  2BJ4 B;  4L98 A;  5G42 A;  5KRM A;  1KNU A;  3FEI A;  1KKQ A;  3VI8 A;  3V3E A;  5CJ6 A;  3L03 A;  1R1K A;  4NB6 A;  5HJP B;  5AZT A;  3VTB A;  3B0W A;  2PJL A;  3OZJ A;  3OOK A;  3D57 A;  3G0W A;  2PIX A;  5GT4 A;  5DZI A;  3ADW A;  3E94 A;  3U9Q A;  2HB7 A;  4RMD A;  4XUH A;  3VHU A;  3FC6 B;  3WGP A;  2ZXZ A;  3AUN A;  5DXM A;  3NSP A;  1ERR A;  5HJS A;  4J24 A;  2PIV A;  4HEE X;  5A86 A;  3SP9 A;  3B68 A;  2VSR A;  1XIU A;  4R6S A;  3FAL B;  4J5X A;  2HBH A;  1XJ7 A;  3L3Z A;  3RLL A;  3ET3 A;  3O1D A;  2BJ4 A;  1S19 A;  2GWX A;  5G5W A;  4LBD A;  5L7H A;  1YIN A;  5EGV A;  2YFE A;  4B7W A;  5DV8 A;  1MVC A;  2QGW A;  4X1F A;  5KR9 A;  2V0V A;  3KPZ A;  1R20 D;  1VJB A;  2ZFX A;  3ADS A;  4OEZ A;  1HG4 A;  4MG6 A;  5APJ A;  2QPY A;  4POJ A;  3H0A D;  2B50 A;  3FC6 A;  4IW8 A;  5APH A;  5DWI A;  2YLP A;  2AA6 A;  5DRJ A;  1FM6 A;  1H9U A;  2H79 A;  3OZ0 A;  3LBD A;  3RUT A;  1LBD A;  4PP6 A;  1YOK A;  4MGD B;  5AZV A;  3FAL A;  4CI4 A;  4G2I A;  1GWX A;  1YYE A;  3ADX A;  1OT7 A;  3HO0 A;  2V7C A;  4OZT U;  1PDU A;  3RLJ A;  4IUI A;  3P8X A;  3B67 A;  4WPF A;  2PIR A;  3AZ1 A;  5DYD A;  1RK3 A;  4DK7 A;  2AX7 A;  3OKI A;  4JGV A;  5DI7 A;  3DZY A;  3B66 A;  4XHD A;  1I7I A;  3HM1 A;  3KMG A;  1QKU A;  3FXV A;  4IW6 A;  1L2I A;  4S0T A;  3L1B A;  5FQP A;  4L96 A;  4S0S A;  1T76 A;  2QA8 A;  2YAT A;  1XB7 A;  4NIE A;  2Q1V A;  3KWY A;  5KCC A;  2GTK A;  3R29 A;  5G44 A;  1YP0 A;  4MGD A;  3UU7 B;  4LSJ A;  2QNV A;  2ZNQ A;  2HVC A;  3DZU D;  1XQC A;  1Y0S A;  2IHQ A;  4QM0 A;  2ZMH A;  3D6D A;  4DM6 A;  2POG A;  4G21 A;  3B5R A;  5LGA A;  2VST A;  4G1D A;  1RKH A;  4MGB B;  4OHA A;  1G2N A;  5DUH A;  2Q5S A;  5DL4 A;  4YMQ A;  1GWQ A;  3CQV A;  2I4J A;  2OAX A;  2AA2 A;  4OEA A;  3V4A A;  3AZ3 A;  4CI5 A;  5DZ0 A;  1WM0 X;  3OS9 A;  4WHG A;  5EHJ A;  4WHF A;  2NV7 A;  5DU5 A;  1Z5X U;  4IU7 A;  1MV9 A;  4OIV A;  4RFW A;  5DZH A;  2ZK3 A;  3VRT A;  3OSI A;  2Q7K A;  1M7W A;  4IS8 A;  3AUR A;  4BCR A;  3GD2 A;  1ZEO A;  1QKN A;  3WJ5 A;  3UU7 A;  3ERT A;  5I4V A;  3OAP A;  1DB1 A;  1M2Z A;  4RMC A;  1X76 A;  1PK5 A;  1RJK A;  1Z95 A;  2Q5G A;  3L0J A;  2ZK5 A;  3ET0 A;  3PRG A;  4OKT A;  3A9E B;  4MGB A;  2OUZ A;  3L3X A;  3D90 A;  4J5W A;  1FBY A;  2NW4 A;  3X31 A;  5DVC A; 
#chains in the Genus database with same CATH homology
 4MGC A;  4OC7 A;  3ET2 A;  1S0X A;  2W8Y A;  4ZNW A;  5DLR A;  5DTV A;  2PIP L;  3HC5 A;  4MG9 B;  3GWX A;  4OH6 A;  3PCU A;  4XAO A;  2GL8 A;  5FQT A;  2XKW A;  3SZ1 A;  1ZGY A;  3VT3 A;  1K74 D;  4EM9 A;  3PO9 A;  3K6P A;  4WQP A;  1SQN A;  3R5N A;  3D5F A;  4MGA B;  3OS8 A;  3QT0 A;  3ET1 A;  4Q50 A;  4OJ9 A;  2FVJ A;  4RUP A;  2A3I A;  5DVS A;  1PQ6 A;  2Q6J A;  4N1Y A;  3F5C B;  5G46 A;  1ERE A;  3A9E A;  3W5Q A;  4OLM A;  1X78 A;  5EIT A;  4P6X A;  3W0I A;  3ZRA A;  3WMH A;  2ZK0 A;  3ZQT A;  1SR7 A;  2B23 A;  2QXS A;  1GS4 A;  1XQ3 A;  3E7C A;  2B1V A;  3VT8 A;  4YNK A;  3IXP D;  2AAX A;  2AMA A;  1RDT D;  1OSV A;  4MG7 B;  1U9E A;  4MG9 A;  4RAK A;  5ETH A;  5HCV A;  2HWQ A;  1NUO A;  3B0T A;  4PVU A;  4PLD A;  3E00 D;  3V49 A;  5LWP A;  2HWR A;  4OZT E;  1XAP A;  2QW4 A;  3SP6 A;  3CJW A;  4K7A A;  2ATH A;  4MGA A;  5AK2 A;  2VV3 A;  2BAW A;  3V9Y A;  3W0H A;  2HAM A;  2XYJ A;  3ZRB A;  3FUG A;  3VSO A;  4TUZ B;  5DWG A;  3F5C A;  4OK1 A;  3UUA B;  5KCU A;  5HYR A;  1N46 A;  4PP3 A;  5KYA A;  2ABI A;  3S9S A;  4ZNV A;  3A2H A;  2O4R A;  2QE4 A;  2LBD A;  3OLS A;  4ZJW A;  1G1U A;  2J4A A;  2QMV A;  3W0A A;  3HVL A;  1RKG A;  1XP6 A;  1LV2 A;  2I4P A;  4DOR A;  4MG7 A;  3RVF A;  3W0C A;  3A2I A;  5E7V A;  5EC9 A;  2PNU A;  2JFA B;  2OVH A;  3W0G A;  2P7G A;  2QSE A;  4WVD A;  5HYK A;  2P4Y A;  4XLD A;  4XUM A;  1P8D A;  5AAU A;  3UP0 A;  5IAW A;  1EXX A;  2Q60 A;  5HJP A;  1YJE A;  1PRG A;  3WFF A;  4OAR A;  5KRF A;  3UUA A;  1RDT A;  3CWD A;  4Q0A C;  5FQR A;  2OM9 A;  3W5R A;  1FM9 D;  3GYU A;  5DY8 A;  3BC5 A;  5DX3 B;  1L2J A;  3FEJ A;  4MG8 B;  1Z5X E;  1BSX A;  1NQ0 A;  5DKE A;  3WJ4 A;  2ZNO A;  4UDB A;  1IE8 A;  4QK4 A;  1S9Q A;  2P7Z A;  4MDD A;  3BQD A;  4ONI A;  5EJV A;  5DK9 A;  4DOS A;  2REW A;  2HC4 A;  2JFA A;  5KYJ A;  2R40 D;  1XVP B;  3P0U A;  5C4S A;  2ZK1 A;  1M13 A;  2ZNN A;  5F9B A;  2G0G A;  2YLQ A;  4RUO X;  4IA7 A;  2HFP A;  1MZN A;  5KCT A;  3CS6 A;  3ADT A;  1I7G A;  1TXI A;  2PIW A;  1NQ7 A;  3A78 A;  2QXM A;  4JYG A;  5DXE A;  1U3Q A;  3OLL A;  3MNE A;  2Q5P A;  5DX3 A;  3CS8 A;  3K22 A;  4MG8 A;  3RY9 A;  2G44 A;  3Q95 B;  2P1T A;  1XLS A;  4YPQ A;  2AMB A;  3AZ2 A;  2Q59 B;  2HCD A;  2YJD A;  4LTW A;  5DKG A;  1NAX A;  3R8D A;  4Q13 A;  4WLB A;  3TX7 B;  5HZC A;  3CDP A;  5DUG A;  1T7T A;  1R20 A;  1QKT A;  3F7D A;  3PEQ A;  1XVP A;  5DZ1 A;  5L11 A;  2FAI A;  3JZB A;  1FCZ A;  3H0A A;  1QKM A;  3VJH A;  1T65 A;  5APK A;  5KRC A;  2JJ3 A;  3FLI A;  2G5O A;  1FCY A;  1UHL B;  5C4T A;  2ZMI A;  3HC6 A;  3MNP A;  2OZ7 A;  4LNW A;  2Q61 A;  2Q6R A;  5AWJ A;  3MNO A;  3WWR A;  4ZN9 A;  5DWL A;  2QH6 A;  4MG5 A;  5DWE A;  5DIE A;  2R40 A;  2VV1 B;  3Q95 A;  4A4V A;  3KMZ A;  1N4H A;  3ILZ A;  3GN8 A;  2Q59 A;  2HAS A;  4RME A;  2VV0 A;  2Q3Y A;  4K6I A;  4UDA A;  1X7R A;  3A2J A;  3KMR A;  5KRJ A;  1P93 A;  3HLV A;  3VJS A;  4M8H A;  5KRO A;  3UUD B;  4OKB A;  4F9M A;  5DXP A;  2NPA A;  3NOA A;  1XDK B;  4S15 A;  2FSZ A;  2P1V A;  1T73 A;  3OSW A;  2P7A A;  2GPU A;  1R6G A;  2ZMJ A;  4ZOM A;  5GIC A;  1YUC A;  2XYW A;  1YMT A;  1UHL A;  3O1E A;  2AM9 A;  3VT5 A;  1PCG A;  1Q4X A;  4OED A;  5DRM A;  1XP9 A;  3B0R A;  3VTD A;  4REF A;  2ZL9 A;  3DZU A;  3VHV A;  2AX6 A;  5E19 A;  4E2J A;  3VN2 A;  3W0J A;  3R2A A;  4QL8 A;  3V3Q A;  1S0Z A;  2P54 A;  1I37 A;  2VV1 A;  4PLE A;  1OSH A;  2F4B A;  5G3J A;  3KBA A;  1XNN A;  4ITE A;  4Y29 A;  4K4J A;  1ZUC A;  5KRH A;  4RWV A;  4E4K A;  3OKH A;  1T5Z A;  4G1Z A;  1NDE A;  2AYR A;  5FQS A;  2Q6S A;  3P89 A;  5L7E A;  3L0E A;  2EWP A;  1YOW A;  1R1K D;  2H77 A;  3VT6 A;  5B5B A;  1SJ0 A;  4PF3 A;  3UUD A;  4PRG A;  2AX9 A;  2Q7J A;  1XDK A;  2Q70 A;  4RUJ A;  3KFC A;  1X7E A;  2Q1H A;  1NRL A;  4XT9 A;  5E15 A;  2Q7I A;  4N5G A;  5GID A;  2PKL A;  3G9E A;  4J5X C;  5KCW A;  3P88 A;  4YT1 A;  4ZI1 A;  5EI1 A;  4G20 A;  4R06 A;  5DIG A;  4S14 A;  4TV1 B;  1NAV A;  1PQC A;  3HQ5 A;  2AO6 A;  3AFR A;  4OZR U;  5M96 A;  1HJ1 A;  3VT7 A;  4ZN7 A;  4OJ4 A;  4RZE A;  4PP5 A;  3NSQ A;  4IVW A;  2GIU A;  3DCU A;  1XV9 B;  4ZNS A;  5DWJ A;  4ZNH A;  3EYB A;  3VSP A;  4RE8 A;  3DY6 A;  4A4W A;  2NXX A;  1NHZ A;  1YIM A;  1ZAF A;  4XTA A;  2ZK6 A;  3G8I A;  5DXG A;  1ILH A;  1FCX A;  2R6W A;  2ZLA A;  1OVL B;  2YHD A;  2B1Z A;  3GYT A;  3PBA A;  2OVM A;  1DKF B;  2YJA B;  1XPC A;  1FD0 A;  2QA6 A;  4KZI A;  5DVV A;  1K74 A;  2QR9 A;  3K23 A;  5DMC A;  1K7L A;  3W5T A;  5IZ0 A;  4QE8 A;  1T79 A;  3KYT A;  2ZY0 A;  5E14 A;  2Q8S A;  5ICK A;  5DKB A;  4TV1 A;  3JZC A;  1FM6 D;  1SKX A;  2PIQ A;  4R2U A;  5DYB A;  1U3S A;  5AWK A;  1X7J A;  3WT5 A;  2QZO B;  1XLS E;  1ZKY A;  4N73 A;  5AVL A;  1G50 A;  5E0W A;  4JYI A;  2AWH A;  2AX8 A;  5DXR A;  5DSH A;  1UOM A;  5DXK A;  5KD9 A;  2QGT A;  1A52 A;  1S9P A;  3VRW A;  1XV9 A;  5C4O A;  2AXA A;  3HZF A;  3B3K A;  2ZAS A;  2PIN A;  4IV2 A;  3IXP A;  3DR1 A;  4TUZ A;  3GBK A;  4DK8 A;  2Q7L A;  5KRL A;  3WT6 A;  1XP1 A;  3DT3 A;  4LNX A;  3WTQ A;  4FGY A;  5C4U A;  3DZY D;  3AUQ A;  1OVL A;  4ITF A;  5K13 A;  1Y0X X;  3K8S A;  2QTU A;  3H52 A;  3M7R A;  1DKF A;  3OGT A;  1KV6 A;  5AVI A;  3X1I A;  3E00 A;  4OH5 A;  4ZNU A;  2GPO A;  5IXK A;  1XOW A;  3W5P A;  5GIE A;  3B1M A;  2J7X A;  3WT7 A;  4OGH A;  4DMA A;  4KZJ A;  1EXA A;  1E3K A;  4FHH A;  2AA7 A;  1YA3 A;  2OCF A;  2PRG A;  2ZBS A;  3GWS X;  3R8I A;  2QZO A;  4IV4 A;  3GZ9 A;  3LMP A;  1E3G A;  3OMK A;  4JYH A;  4KZM A;  4OIU A;  4PPP A;  3VHW A;  2YLY A;  1K4W A;  1ZH7 A;  5KRK A;  3B0Q A;  5DV6 A;  5JJM B;  2GP7 A;  1Y9R A;  4EMA A;  4ZJR A;  3B65 A;  1XNX A;  2QA8 B;  4N8R A;  2IOK A;  3ZR7 A;  4IVY A;  3R5M A;  3IMY A;  2VV4 B;  2IOG A;  3N00 A;  3G8O A;  4OKX A;  1U3R A;  3V9T A;  4APU A;  2O4J A;  4OEY A;  4PXM A;  2JF9 A;  4NUF A;  3CTB A;  4DQM A;  5H1E A;  4IQR A;  4G2H A;  1G5Y A;  5AYG A;  2I0J A;  5SYZ A;  3IPS A;  4J5W C;  4UDD A;  1PQ9 A;  1XZX X;  5E0X A;  1FM9 A;  1N83 A;  5G45 A;  1ZDU A;  5G43 A;  3HOD A;  3AX8 A;  4IWF A;  4J26 A;  5JJM A;  2ZXM A;  4OKW A;  2G0H A;  2R6Y A;  2I0G A;  4NY9 A;  4IA1 A;  5DV3 A;  3IPQ A;  5AAV B;  4ZNT A;  2ZK2 A;  1I38 A;  2I4Z A;  4JL4 A;  1UPV A;  1TFC A;  5JI0 D;  4OIL A;  2VV4 A;  5DKS A;  3TKC A;  3VT4 A;  1IE9 A;  3CLD A;  3AN4 A;  5FQV A;  5DUE A;  2P1U A;  4OZR E;  3OS8 C;  3A40 X;  2AA5 A;  4E4Q A;  4UDC A;  3WFG A;  2PIU A;  4OFR A;  5JY3 A;  3FS1 A;  5ACC A;  4IWC A;  1T63 A;  3X1H A;  4IA2 A;  3OLF A;  3UVV B;  3A3Z X;  3VRU A;  2ZNP A;  3BEJ A;  4RZF A;  4ZO1 X;  2Z4J A;  1ZDT A;  2ACL B;  2NXX E;  2VV2 A;  5DZ3 A;  2P15 A;  4M8E A;  3TY0 A;  2HAR A;  3UUC A;  2J7Y A;  4XI3 A;  2O9I A;  3CDS A;  3L0L A;  2ZK4 A;  4FNE A;  4POH A;  5AAV A;  4RZG A;  5KCE A;  1GWR A;  5DMF A;  2XYX A;  4A2J A;  1T7F A;  4X1G A;  3TKM A;  3OSA A;  3KDT A;  4PWL A;  2ZXN A;  3DCT A;  3FUR A;  2PIO A;  3KDU A;  4PPS A;  4QE6 A;  3T03 A;  5DXB B;  3UP3 A;  3OMM A;  4HLW A;  1X7B A;  1A28 A;  3D24 A;  5KCF A;  2J14 A;  5DXQ A;  4G1Y A;  2QAB A;  2GPV A;  4OJB A;  5KCD A;  2E2R A;  1NQ1 A;  2YLO A;  3OMQ A;  3UVV A;  3VJT A;  2HB8 A;  2ZKC A;  1T7R A;  3VTC A;  2Z4B A;  4FHI A;  5DP0 A;  4CSJ A;  4O8F A;  3IA6 A;  2ACL A;  3OOF A;  5B41 A;  4FN9 A;  1R5K A;  4IA3 A;  1NQ2 A;  2GPP A;  4REE A;  1PZL A;  3ADU A;  2PIT A;  1T74 A;  3OMP A;  5DID A;  5E1C A;  4QJR A;  1NYX A;  4JAZ A;  5KRI A;  5DXB A;  2XHS A;  3W0Y A;  3ADV A;  4DM8 A;  2POB A;  2ZVT A;  3IPU A;  3VRV A;  4ZO1 B;  3RUU A;  2ZLC A;  3OMO A;  4P6W A;  1T7M A;  3X36 A;  3PLZ A;  3R8A A;  3VJI A;  4OFU A;  4NQA B;  1YY4 A;  3VT9 A;  2AB2 A;  3V9V A;  5L7G A;  1UPW A;  3CS4 A;  3ERD A;  5KRA A;  3AN3 A;  1ILG A;  2BJ4 B;  4L98 A;  5G42 A;  5KRM A;  1KNU A;  3FEI A;  1KKQ A;  3VI8 A;  3V3E A;  5CJ6 A;  3L03 A;  1R1K A;  4NB6 A;  5HJP B;  5AZT A;  3VTB A;  3B0W A;  2PJL A;  3OZJ A;  3OOK A;  3D57 A;  3G0W A;  2PIX A;  5GT4 A;  5DZI A;  3ADW A;  3E94 A;  3U9Q A;  2HB7 A;  4RMD A;  4XUH A;  3VHU A;  3FC6 B;  3WGP A;  2ZXZ A;  3AUN A;  5DXM A;  3NSP A;  1ERR A;  5HJS A;  4J24 A;  2PIV A;  4HEE X;  5A86 A;  3SP9 A;  3B68 A;  2VSR A;  1XIU A;  4R6S A;  3FAL B;  4J5X A;  2HBH A;  1XJ7 A;  3L3Z A;  3RLL A;  3ET3 A;  3O1D A;  2BJ4 A;  1S19 A;  2GWX A;  5G5W A;  4LBD A;  5L7H A;  1YIN A;  5EGV A;  2YFE A;  4B7W A;  5DV8 A;  1MVC A;  2QGW A;  4X1F A;  5KR9 A;  2V0V A;  3KPZ A;  1R20 D;  1VJB A;  2ZFX A;  3ADS A;  4OEZ A;  1HG4 A;  4MG6 A;  5APJ A;  2QPY A;  4POJ A;  3H0A D;  2B50 A;  3FC6 A;  4IW8 A;  5APH A;  5DWI A;  2YLP A;  2AA6 A;  5DRJ A;  1FM6 A;  1H9U A;  2H79 A;  3OZ0 A;  3LBD A;  3RUT A;  1LBD A;  4PP6 A;  1YOK A;  4MGD B;  5AZV A;  3FAL A;  4CI4 A;  4G2I A;  1GWX A;  1YYE A;  3ADX A;  1OT7 A;  3HO0 A;  2V7C A;  4OZT U;  1PDU A;  3RLJ A;  4IUI A;  3P8X A;  3B67 A;  4WPF A;  2PIR A;  3AZ1 A;  5DYD A;  1RK3 A;  4DK7 A;  2AX7 A;  3OKI A;  4JGV A;  5DI7 A;  3DZY A;  3B66 A;  4XHD A;  1I7I A;  3HM1 A;  3KMG A;  1QKU A;  3FXV A;  4IW6 A;  1L2I A;  4S0T A;  3L1B A;  5FQP A;  4L96 A;  4S0S A;  1T76 A;  2QA8 A;  2YAT A;  1XB7 A;  4NIE A;  2Q1V A;  3KWY A;  5KCC A;  2GTK A;  3R29 A;  5G44 A;  1YP0 A;  4MGD A;  3UU7 B;  4LSJ A;  2QNV A;  2ZNQ A;  2HVC A;  3DZU D;  1XQC A;  1Y0S A;  2IHQ A;  4QM0 A;  2ZMH A;  3D6D A;  4DM6 A;  2POG A;  4G21 A;  3B5R A;  5LGA A;  2VST A;  4G1D A;  1RKH A;  4MGB B;  4OHA A;  1G2N A;  5DUH A;  2Q5S A;  5DL4 A;  4YMQ A;  1GWQ A;  3CQV A;  2I4J A;  2OAX A;  2AA2 A;  4OEA A;  3V4A A;  3AZ3 A;  4CI5 A;  5DZ0 A;  1WM0 X;  3OS9 A;  4WHG A;  5EHJ A;  4WHF A;  2NV7 A;  5DU5 A;  1Z5X U;  4IU7 A;  1MV9 A;  4OIV A;  4RFW A;  5DZH A;  2ZK3 A;  3VRT A;  3OSI A;  2Q7K A;  1M7W A;  4IS8 A;  3AUR A;  4BCR A;  3GD2 A;  1ZEO A;  1QKN A;  3WJ5 A;  3UU7 A;  3ERT A;  5I4V A;  3OAP A;  1DB1 A;  1M2Z A;  4RMC A;  1X76 A;  1PK5 A;  1RJK A;  1Z95 A;  2Q5G A;  3L0J A;  2ZK5 A;  3ET0 A;  3PRG A;  4OKT A;  3A9E B;  4MGB A;  2OUZ A;  3L3X A;  3D90 A;  4J5W A;  1FBY A;  2NW4 A;  3X31 A;  5DVC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...