5K13A

Crystal structure of the rar alpha ligand-binding domain in complex with an antagonist
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
235
structure length
235
Chain Sequence
TPEVGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTVEFAKQLPGFTTLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFANQLLPLEMDDAETGLLSAICLICGDRQDLEQPDRVDMLQEPLLEALKVYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Retinoic acid receptor alpha
publication title Identification of potent and selective retinoic acid receptor gamma (RAR gamma ) antagonists for the treatment of osteoarthritis pain using structure based drug design.
pubmed doi rcsb
source organism Homo sapiens
total genus 92
structure length 235
sequence length 235
ec nomenclature
pdb deposition date 2016-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 5k13A00
3OZ0A 4PP6A 1U3QA 4MG6A 3D6DA 5DX3B 1P8DA 4MGBA 4UDAA 3KPZA 5KRAA 3L3ZA 3OZJA 2AX7A 2FVJA 3H52A 1N83A 5DIGA 1Y0XX 5L7GA 5FQTA 3FALB 5DU5A 1I37A 3ERTA 3O1EA 3D90A 1ZKYA 3KMGA 1OSVA 2BAWA 3W5QA 4A2JA 3UUAA 3E7CA 2ZXMA 3IPQA 4F9MA 2VV4B 1R20D 1M7WA 1XDKB 5G5WA 1T7FA 2PKLA 2XYWA 5KRHA 3OAPA 4FNEA 2POGA 5DUEA 2HFPA 1NQ7A 1T79A 1M2ZA 2Q7IA 3CJWA 4DM8A 1GS4A 1FCXA 3DCUA 3DZUD 2QPYA 2W8YA 2AX9A 2Q6SA 5DXBB 3UUCA 3H0AA 4WVDA 3OSIA 1UHLB 2G0GA 5G3JA 3D57A 3W0AA 4QM0A 4ZNHA 4XTAA 2ZK3A 5DWLA 1T73A 3G0WA 3B65A 3N00A 5DRJA 4POHA 1NQ1A 2VV0A 4J5XC 4OKWA 5KRKA 4MGAA 4IWCA 4TUZA 5KCTA 4RMEA 2O9IA 4B7WA 2ZVTA 4G2IA 4OH6A 1YOWA 3HLVA 4XHDA 2REWA 5DZ0A 4MDDA 5KRLA 1NDEA 2I4JA 1ZDUA 4IV4A 3WT5A 3DCTA 4Q0AC 2JFAB 4PPPA 1U9EA 3L1BA 2YJDA 3V9YA 3GBKA 5DIDA 4DQMA 2XHSA 4IA7A 2G44A 2YFEA 3GWSX 3BQDA 2VV2A 1XNXA 4MG7A 4CSJA 3GZ9A 2HASA 5KCCA 5AK2A 4OEYA 3W5PA 4JGVA 2QA8A 1X7EA 3VHUA 2E2RA 2QE4A 1L2JA 4KZIA 4ZO1X 1MVCA 3UU7B 5DRMA 4DK8A 4R2UA 5DVCA 3SP6A 3WTQA 1A52A 2QA6A 3K6PA 4K7AA 3VRUA 2YHDA 4REFA 3W5TA 3IA6A 4RUPA 2AAXA 3UUDA 3VN2A 2I4ZA 1PQ6A 3HODA 3KDTA 4PP3A 3VT7A 4YT1A 4XI3A 3ADXA 4FGYA 5AWKA 2Q61A 1PRGA 1SR7A 1X76A 2Z4BA 3OKIA 4MG9A 2QH6A 2B23A 1GWXA 2Q59A 1XB7A 4PLEA 4IQRA 4LSJA 5DKGA 1XNNA 3A2JA 3UVVB 5DP0A 2PIPL 3KMZA 1YUCA 2B1ZA 2OVHA 2NV7A 1G50A 1K74D 1XJ7A 2R40A 4OZTE 4PPSA 4PXMA 4NUFA 1R1KA 3T03A 1NAXA 1FM6D 1R5KA 5G44A 4DOSA 4OZRE 5C4UA 4E2JA 5DTVA 1E3GA 4RZEA 2ABIA 2Q6JA 2QGWA 4N8RA 5C4SA 3WT7A 5F9BA 1T7TA 2OVMA 2AX8A 3VTCA 5DWGA 1XV9B 3VT9A 4PLDA 3ADSA 5HJSA 1DKFA 2GPUA 1YYEA 2AM9A 5KD9A 5L11A 3PBAA 5DK9A 3B68A 4HEEX 5AWJA 3JZCA 4OARA 2AYRA 5DWEA 3E00A 4MGDA 1YY4A 1XVPA 2VSRA 3CS8A 4OJ4A 4RUJA 3WGPA 3R2AA 1X78A 3ET3A 4OEZA 1VJBA 3ADWA 4DORA 4XLDA 2HB7A 3DZYD 1RDTA 1I7GA 2QW4A 1P93A 1ZH7A 4ZNWA 1Z5XU 1S0ZA 4MGCA 4PF3A 5DZHA 3IXPD 2R6YA 3B0QA 2HCDA 3KFCA 4XUHA 2B50A 1M13A 3CDSA 2FSZA 4J26A 1X7RA 4L98A 5AAUA 1K4WA 2ACLB 3O1DA 2Q5GA 4IUIA 1R20A 1IE9A 3IPUA 5DY8A 1FCYA 2VV1A 2QA8B 2HWRA 2P4YA 5C4TA 2H77A 2HAMA 5JI0D 5JJMA 2HARA 2QXMA 5CJ6A 1LBDA 4N73A 5IZ0A 4DMAA 1LV2A 2QR9A 4MG5A 1IE8A 1KKQA 4Y29A 5DIEA 3P88A 4IA2A 4MG8A 2ZMJA 1EXAA 2GL8A 3LMPA 4TV1A 4NIEA 5DYBA 2PIRA 2QXSA 4ZNUA 2R6WA 3PLZA 3R8AA 5HCVA 2ZXNA 4OJ9A 4S15A 1T5ZA 1PCGA 2P1UA 4XT9A 5EC9A 2G0HA 3B0WA 3B3KA 2PJLA 3F5CA 1Q4XA 3DY6A 1FM9D 3MNOA 3FC6A 4ONIA 2YLOA 4WLBA 3A2HA 5A86A 1WM0X 2Z4JA 3L0EA 1YINA 3CQVA 3P0UA 4IU7A 4OHAA 4M8EA 4J5XA 2POBA 2GPPA 1SJ0A 1N4HA 1SKXA 3OGTA 5DXMA 2QZOB 1L2IA 2NW4A 2ZMIA 3B0TA 5ETHA 3DT3A 1QKMA 1PQ9A 3ET2A 1PK5A 1Z95A 2BJ4A 4OKBA 3S9SA 2ZMHA 3G8IA 4RMCA 3V49A 5HYKA 4IWFA 3W0YA 2Q7KA 2GPOA 4YNKA 1XP1A 3OMMA 5HJPB 3PCUA 5DYDA 4UDDA 3HM1A 4ZN9A 2YJAB 2AMBA 4OFUA 3A9EB 3Q95B 1UOMA 3PRGA 3B67A 1KV6A 3VTBA 3RUTA 1N46A 4P6WA 5C4OA 3A3ZX 3RLJA 5FQRA 1YP0A 1UPWA 5AAVA 2OM9A 2ZASA 2OUZA 5HYRA 2PIXA 3RVFA 1TFCA 2Q5SA 1U3SA 2P54A 3KYTA 5KROA 4IVWA 3B66A 3VTDA 5DI7A 2J7XA 4N5GA 4LNXA 3HC5A 4RWVA 4NQAB 3OMKA 5SYZA 1K74A 3L03A 4EMAA 3OOFA 1NUOA 2EWPA 5DXEA 2GIUA 1K7LA 1FM6A 2AA2A 4REEA 4J5WC 3K22A 4IS8A 1FCZA 5DKEA 2Q7LA 5DV6A 5DXRA 5KRFA 4ZJRA 4MGBB 3WMHA 2HVCA 3X1IA 5GIEA 5G45A 5E19A 1ILGA 2ZXZA 3ADVA 3VT3A 3ZRBA 2ATHA 2AX6A 3ET1A 4APUA 3R29A 4XAOA 3X1HA 5KCUA 5H1EA 5KCDA 2Q1VA 2QSEA 2HC4A 2V0VA 1YJEA 2YATA 3A2IA 2VV3A 4IA3A 3TY0A 2O4RA 4OKXA 2HBHA 4E4QA 1EREA 3CLDA 5EHJA 3UUAB 1XZXX 3W0IA 3PO9A 4KZJA 3AURA 1OVLA 4RZGA 1Y9RA 2YLQA 3DZYA 1TXIA 3GYUA 4ZI1A 5KRCA 2IHQA 4FHIA 5B5BA 4DM6A 3IXPA 4FHHA 1NHZA 2J14A 3VSOA 2PNUA 3DR1A 1G2NA 2QMVA 3OMOA 1HG4A 3V3EA 5KRMA 4NB6A 3OSWA 4G20A 4G1YA 3UP3A 4WHFA 5KYJA 3B0RA 2PIQA 2AMAA 1T63A 4P6XA 2IOGA 5E0WA 4MGAB 2I4PA 4TUZB 2XYXA 1XQ3A 4PVUA 5E0XA 4Q50A 5DX3A 3ZQTA 5DXKA 5KRJA 1QKNA 3OMQA 1S9QA 1NYXA 3ADUA 5DKSA 5E15A 4QE8A 3OOKA 5APJA 2HB8A 4UDCA 2Q1HA 2P7GA 1X7BA 3FALA 3ZR7A 3VT5A 4QK4A 3FXVA 3NOAA 2Q60A 2ZK5A 5APHA 1XOWA 4YPQA 1OSHA 2FAIA 3HVLA 1BSXA 3E94A 4G2HA 1FM9A 4EM9A 4OKTA 1YMTA 3ERDA 3WWRA 2VV4A 4IA1A 3VI8A 4RZFA 1XDKA 2ZBSA 4MG7B 1G5YA 4OJBA 3B1MA 5ICKA 1RKHA 3P89A 5K13A 3CDPA 5DZ1A 5GICA 1XQCA 3W5RA 3TKCA 3K8SA 2I0GA 2OAXA 3K23A 3KDUA 3PEQA 2P1VA 3JZBA 1ILHA 5DMCA 1ZEOA 3AZ2A 4HLWA 5DUHA 2PRGA 5KCEA 1X7JA 4LNWA 5DXBA 3DZUA 4UDBA 1E3KA 5DV8A 1UHLA 1MZNA 4Q13A 2NXXE 3GWXA 3UUDB 2NXXA 2YLYA 5EI1A 3NSQA 4OFRA 4RE8A 5EJVA 5G46A 4MG9B 2PIVA 5EGVA 2Q59B 1ZUCA 4S0TA 2VSTA 5DMFA 5E14A 3WT6A 3FS1A 3GD2A 4WQPA 2GTKA 1EXXA 2XYJA 4J24A 2ZKCA 3AN3A 4JYIA 5DWJA 5DXPA 3OS8C 2Q7JA 3W0HA 5KCFA 3R5MA 5DWIA 1FBYA 3D24A 3RUUA 1T76A 2JFAA 3RLLA 1ZGYA 2J7YA 4G1ZA 5EITA 1PZLA 2ZY0A 4ZNTA 5DL4A 1OT7A 1NAVA 3MNPA 3LBDA 4K4JA 3VRVA 2A3IA 5B41A 4A4WA 1MV9A 4PRGA 1DKFB 2AWHA 3SP9A 3E00D 3W0GA 1YA3A 5G42A 3BEJA 3A78A 1ZAFA 3QT0A 3W0CA 5DXQA 2AB2A 1A28A 2AA7A 4MGDB 4N1YA 1XVPB 4R6SA 5AVIA 3ILZA 3UU7A 2OCFA 1RDTD 3FLIA 1QKUA 2JF9A 4WHGA 2H79A 5AVLA 2ZK1A 2Q8SA 2AXAA 2P15A 4QL8A 2QGTA 2XKWA 1GWQA 4J5WA 3AX8A 3R8DA 3VHWA 3WFGA 2J4AA 2ZFXA 4IW8A 3X36A 1XP6A 4IW6A 3V4AA 4RFWA 4ZO1B 2ZLCA 1DB1A 4OIVA 5L7HA 4XUMA 2VV1B 3VRTA 4OLMA 3TKMA 3CWDA 4OEDA 3P8XA 4X1GA 3UVVA 3BC5A 5DUGA 2PITA 2ZNNA 5KCWA 1T65A 3AUNA 1XAPA 5JJMB 2GP7A 4ITFA 5HZCA 4A4VA 3HC6A 4LBDA 3VT6A 1RJKA 1XPCA 2GPVA 4ZNVA 3V9VA 3MNEA 3VT8A 4ZNSA 3FEIA 3VJSA 4MG8B 4TV1B 3HQ5A 3L0JA 5DSHA 4RUOX 3VJHA 1XV9A 3B5RA 4G21A 1XIUA 1RKGA 4YMQA 5GIDA 1XP9A 4O8FA 4OILA 3ET0A 4S0SA 5DKBA 3KMRA 2P7ZA 2ZNQA 4DK7A 4NY9A 3IMYA 3EYBA 2G5OA 3F5CB 4ITEA 5IAWA 2LBDA 3FC6B 3V9TA 2PIWA 5DV3A 1U3RA 1YIMA 3CS6A 3AZ3A 2AA5A 3VJTA 1ZDTA 2O4JA 5E7VA 4JYHA 2NPAA 3NSPA 1S0XA 4JYGA 5FQSA 4KZMA 4OGHA 4RAKA 1I7IA 4QE6A 5ACCA 5DXGA 1Y0SA 2ACLA 2ZK0A 5FQVA 1QKTA 2BJ4B 2QTUA 3FUGA 3UP0A 2GWXA 3H0AD 1T7MA 3X31A 3AZ1A 2P7AA 1H9UA 3ADTA 2OZ7A 3GN8A 1G1UA 4ZJWA 5AYGA 2I0JA 2IOKA 3AN4A 4OZTU 3HZFA 5DVVA 3IPSA 4CI4A 1GWRA 1KNUA 3OKHA 3G8OA 1FD0A 4OZRU 3RY9A 1T7RA 4RMDA 4ZN7A 2ZLAA 3WJ5A 5IXKA 4JL4A 5M96A 3TX7B 3FURA 5AAVB 1ERRA 1S9PA 1XLSE 1XLSA 2ZL9A 3HO0A 3OLFA 4K6IA 2AO6A 5AZVA 2PINA 1PDUA 3GYTA 5DZIA 5KYAA 2ZNOA 3CTBA 3OLSA 1I38A 5E1CA 4IVYA 2Q6RA 3OLLA 3WJ4A 2PIOA 2QABA 3G9EA 2ZK4A 4QJRA 3R8IA 5LWPA 4POJA 1RK3A 5I4VA 3KWYA 1NQ2A 3A40X 2F4BA 3R5NA 1S19A 2HWQA 4OK1A 1NQ0A 2B1VA 3AUQA 3CS4A 3OMPA 4LTWA 4R06A 2ZK2A 4ZOMA 2QZOA 5G43A 2Q5PA 3F7DA 3SZ1A 2PIUA 3W0JA 4OC7A 3ZRAA 4E4KA 1SQNA 5FQPA 4IV2A 4PWLA 5JY3A 2P1TA 3OS8A 4OH5A 3V3QA 4BCRA 2ZK6A 3WFFA 5HJPA 3VJIA 3OSAA 4OIUA 1UPVA 5KRIA 5LGAA 4FN9A 1Z5XE 3L3XA 3OS9A 3A9EA 1YOKA 3Q95A 3VSPA 2JJ3A 3VT4A 5DZ3A 1HJ1A 1NRLA 1OVLB 3M7RA 2ZNPA 4M8HA 2AA6A 4X1FA 4OEAA 3FEJA 1R6GA 5DVSA 1T74A 4JAZA 2YLPA 5APKA 3VHVA 3L0LA 3D5FA 3KBAA 4G1DA 4PP5A 2R40D 5KR9A 5GT4A 4S14A 1R1KD 2Q70A 2QNVA 3VRWA 2V7CA 2Q3YA 3AFRA 3U9QA 4L96A 4CI5A 5L7EA 5DLRA 4WPFA 1PQCA 5AZTA
chains in the Genus database with same CATH superfamily
3OZ0A 4PP6A 1U3QA 4MG6A 3D6DA 5DX3B 1P8DA 4MGBA 4UDAA 3KPZA 5KRAA 3L3ZA 3OZJA 2AX7A 2FVJA 3H52A 1N83A 5DIGA 1Y0XX 5L7GA 5FQTA 3FALB 5DU5A 1I37A 3ERTA 3O1EA 3D90A 1ZKYA 3KMGA 1OSVA 2BAWA 3W5QA 4A2JA 3UUAA 3E7CA 2ZXMA 3IPQA 4F9MA 2VV4B 1R20D 1M7WA 1XDKB 5G5WA 1T7FA 2PKLA 2XYWA 5KRHA 3OAPA 4FNEA 2POGA 5DUEA 2HFPA 1NQ7A 1T79A 1M2ZA 2Q7IA 3CJWA 4DM8A 1GS4A 1FCXA 3DCUA 3DZUD 2QPYA 2W8YA 2AX9A 2Q6SA 5DXBB 3UUCA 3H0AA 4WVDA 3OSIA 1UHLB 2G0GA 5G3JA 3D57A 3W0AA 4QM0A 4ZNHA 4XTAA 2ZK3A 5DWLA 1T73A 3G0WA 3B65A 3N00A 5DRJA 4POHA 1NQ1A 2VV0A 4J5XC 4OKWA 5KRKA 4MGAA 4IWCA 4TUZA 5KCTA 4RMEA 2O9IA 4B7WA 2ZVTA 4G2IA 4OH6A 1YOWA 3HLVA 4XHDA 2REWA 5DZ0A 4MDDA 5KRLA 1NDEA 2I4JA 1ZDUA 4IV4A 3WT5A 3DCTA 4Q0AC 2JFAB 4PPPA 1U9EA 3L1BA 2YJDA 3V9YA 3GBKA 5DIDA 4DQMA 2XHSA 4IA7A 2G44A 2YFEA 3GWSX 3BQDA 2VV2A 1XNXA 4MG7A 4CSJA 3GZ9A 2HASA 5KCCA 5AK2A 4OEYA 3W5PA 4JGVA 2QA8A 1X7EA 3VHUA 2E2RA 2QE4A 1L2JA 4KZIA 4ZO1X 1MVCA 3UU7B 5DRMA 4DK8A 4R2UA 5DVCA 3SP6A 3WTQA 1A52A 2QA6A 3K6PA 4K7AA 3VRUA 2YHDA 4REFA 3W5TA 3IA6A 4RUPA 2AAXA 3UUDA 3VN2A 2I4ZA 1PQ6A 3HODA 3KDTA 4PP3A 3VT7A 4YT1A 4XI3A 3ADXA 4FGYA 5AWKA 2Q61A 1PRGA 1SR7A 1X76A 2Z4BA 3OKIA 4MG9A 2QH6A 2B23A 1GWXA 2Q59A 1XB7A 4PLEA 4IQRA 4LSJA 5DKGA 1XNNA 3A2JA 3UVVB 5DP0A 2PIPL 3KMZA 1YUCA 2B1ZA 2OVHA 2NV7A 1G50A 1K74D 1XJ7A 2R40A 4OZTE 4PPSA 4PXMA 4NUFA 1R1KA 3T03A 1NAXA 1FM6D 1R5KA 5G44A 4DOSA 4OZRE 5C4UA 4E2JA 5DTVA 1E3GA 4RZEA 2ABIA 2Q6JA 2QGWA 4N8RA 5C4SA 3WT7A 5F9BA 1T7TA 2OVMA 2AX8A 3VTCA 5DWGA 1XV9B 3VT9A 4PLDA 3ADSA 5HJSA 1DKFA 2GPUA 1YYEA 2AM9A 5KD9A 5L11A 3PBAA 5DK9A 3B68A 4HEEX 5AWJA 3JZCA 4OARA 2AYRA 5DWEA 3E00A 4MGDA 1YY4A 1XVPA 2VSRA 3CS8A 4OJ4A 4RUJA 3WGPA 3R2AA 1X78A 3ET3A 4OEZA 1VJBA 3ADWA 4DORA 4XLDA 2HB7A 3DZYD 1RDTA 1I7GA 2QW4A 1P93A 1ZH7A 4ZNWA 1Z5XU 1S0ZA 4MGCA 4PF3A 5DZHA 3IXPD 2R6YA 3B0QA 2HCDA 3KFCA 4XUHA 2B50A 1M13A 3CDSA 2FSZA 4J26A 1X7RA 4L98A 5AAUA 1K4WA 2ACLB 3O1DA 2Q5GA 4IUIA 1R20A 1IE9A 3IPUA 5DY8A 1FCYA 2VV1A 2QA8B 2HWRA 2P4YA 5C4TA 2H77A 2HAMA 5JI0D 5JJMA 2HARA 2QXMA 5CJ6A 1LBDA 4N73A 5IZ0A 4DMAA 1LV2A 2QR9A 4MG5A 1IE8A 1KKQA 4Y29A 5DIEA 3P88A 4IA2A 4MG8A 2ZMJA 1EXAA 2GL8A 3LMPA 4TV1A 4NIEA 5DYBA 2PIRA 2QXSA 4ZNUA 2R6WA 3PLZA 3R8AA 5HCVA 2ZXNA 4OJ9A 4S15A 1T5ZA 1PCGA 2P1UA 4XT9A 5EC9A 2G0HA 3B0WA 3B3KA 2PJLA 3F5CA 1Q4XA 3DY6A 1FM9D 3MNOA 3FC6A 4ONIA 2YLOA 4WLBA 3A2HA 5A86A 1WM0X 2Z4JA 3L0EA 1YINA 3CQVA 3P0UA 4IU7A 4OHAA 4M8EA 4J5XA 2POBA 2GPPA 1SJ0A 1N4HA 1SKXA 3OGTA 5DXMA 2QZOB 1L2IA 2NW4A 2ZMIA 3B0TA 5ETHA 3DT3A 1QKMA 1PQ9A 3ET2A 1PK5A 1Z95A 2BJ4A 4OKBA 3S9SA 2ZMHA 3G8IA 4RMCA 3V49A 5HYKA 4IWFA 3W0YA 2Q7KA 2GPOA 4YNKA 1XP1A 3OMMA 5HJPB 3PCUA 5DYDA 4UDDA 3HM1A 4ZN9A 2YJAB 2AMBA 4OFUA 3A9EB 3Q95B 1UOMA 3PRGA 3B67A 1KV6A 3VTBA 3RUTA 1N46A 4P6WA 5C4OA 3A3ZX 3RLJA 5FQRA 1YP0A 1UPWA 5AAVA 2OM9A 2ZASA 2OUZA 5HYRA 2PIXA 3RVFA 1TFCA 2Q5SA 1U3SA 2P54A 3KYTA 5KROA 4IVWA 3B66A 3VTDA 5DI7A 2J7XA 4N5GA 4LNXA 3HC5A 4RWVA 4NQAB 3OMKA 5SYZA 1K74A 3L03A 4EMAA 3OOFA 1NUOA 2EWPA 5DXEA 2GIUA 1K7LA 1FM6A 2AA2A 4REEA 4J5WC 3K22A 4IS8A 1FCZA 5DKEA 2Q7LA 5DV6A 5DXRA 5KRFA 4ZJRA 4MGBB 3WMHA 2HVCA 3X1IA 5GIEA 5G45A 5E19A 1ILGA 2ZXZA 3ADVA 3VT3A 3ZRBA 2ATHA 2AX6A 3ET1A 4APUA 3R29A 4XAOA 3X1HA 5KCUA 5H1EA 5KCDA 2Q1VA 2QSEA 2HC4A 2V0VA 1YJEA 2YATA 3A2IA 2VV3A 4IA3A 3TY0A 2O4RA 4OKXA 2HBHA 4E4QA 1EREA 3CLDA 5EHJA 3UUAB 1XZXX 3W0IA 3PO9A 4KZJA 3AURA 1OVLA 4RZGA 1Y9RA 2YLQA 3DZYA 1TXIA 3GYUA 4ZI1A 5KRCA 2IHQA 4FHIA 5B5BA 4DM6A 3IXPA 4FHHA 1NHZA 2J14A 3VSOA 2PNUA 3DR1A 1G2NA 2QMVA 3OMOA 1HG4A 3V3EA 5KRMA 4NB6A 3OSWA 4G20A 4G1YA 3UP3A 4WHFA 5KYJA 3B0RA 2PIQA 2AMAA 1T63A 4P6XA 2IOGA 5E0WA 4MGAB 2I4PA 4TUZB 2XYXA 1XQ3A 4PVUA 5E0XA 4Q50A 5DX3A 3ZQTA 5DXKA 5KRJA 1QKNA 3OMQA 1S9QA 1NYXA 3ADUA 5DKSA 5E15A 4QE8A 3OOKA 5APJA 2HB8A 4UDCA 2Q1HA 2P7GA 1X7BA 3FALA 3ZR7A 3VT5A 4QK4A 3FXVA 3NOAA 2Q60A 2ZK5A 5APHA 1XOWA 4YPQA 1OSHA 2FAIA 3HVLA 1BSXA 3E94A 4G2HA 1FM9A 4EM9A 4OKTA 1YMTA 3ERDA 3WWRA 2VV4A 4IA1A 3VI8A 4RZFA 1XDKA 2ZBSA 4MG7B 1G5YA 4OJBA 3B1MA 5ICKA 1RKHA 3P89A 5K13A 3CDPA 5DZ1A 5GICA 1XQCA 3W5RA 3TKCA 3K8SA 2I0GA 2OAXA 3K23A 3KDUA 3PEQA 2P1VA 3JZBA 1ILHA 5DMCA 1ZEOA 3AZ2A 4HLWA 5DUHA 2PRGA 5KCEA 1X7JA 4LNWA 5DXBA 3DZUA 4UDBA 1E3KA 5DV8A 1UHLA 1MZNA 4Q13A 2NXXE 3GWXA 3UUDB 2NXXA 2YLYA 5EI1A 3NSQA 4OFRA 4RE8A 5EJVA 5G46A 4MG9B 2PIVA 5EGVA 2Q59B 1ZUCA 4S0TA 2VSTA 5DMFA 5E14A 3WT6A 3FS1A 3GD2A 4WQPA 2GTKA 1EXXA 2XYJA 4J24A 2ZKCA 3AN3A 4JYIA 5DWJA 5DXPA 3OS8C 2Q7JA 3W0HA 5KCFA 3R5MA 5DWIA 1FBYA 3D24A 3RUUA 1T76A 2JFAA 3RLLA 1ZGYA 2J7YA 4G1ZA 5EITA 1PZLA 2ZY0A 4ZNTA 5DL4A 1OT7A 1NAVA 3MNPA 3LBDA 4K4JA 3VRVA 2A3IA 5B41A 4A4WA 1MV9A 4PRGA 1DKFB 2AWHA 3SP9A 3E00D 3W0GA 1YA3A 5G42A 3BEJA 3A78A 1ZAFA 3QT0A 3W0CA 5DXQA 2AB2A 1A28A 2AA7A 4MGDB 4N1YA 1XVPB 4R6SA 5AVIA 3ILZA 3UU7A 2OCFA 1RDTD 3FLIA 1QKUA 2JF9A 4WHGA 2H79A 5AVLA 2ZK1A 2Q8SA 2AXAA 2P15A 4QL8A 2QGTA 2XKWA 1GWQA 4J5WA 3AX8A 3R8DA 3VHWA 3WFGA 2J4AA 2ZFXA 4IW8A 3X36A 1XP6A 4IW6A 3V4AA 4RFWA 4ZO1B 2ZLCA 1DB1A 4OIVA 5L7HA 4XUMA 2VV1B 3VRTA 4OLMA 3TKMA 3CWDA 4OEDA 3P8XA 4X1GA 3UVVA 3BC5A 5DUGA 2PITA 2ZNNA 5KCWA 1T65A 3AUNA 1XAPA 5JJMB 2GP7A 4ITFA 5HZCA 4A4VA 3HC6A 4LBDA 3VT6A 1RJKA 1XPCA 2GPVA 4ZNVA 3V9VA 3MNEA 3VT8A 4ZNSA 3FEIA 3VJSA 4MG8B 4TV1B 3HQ5A 3L0JA 5DSHA 4RUOX 3VJHA 1XV9A 3B5RA 4G21A 1XIUA 1RKGA 4YMQA 5GIDA 1XP9A 4O8FA 4OILA 3ET0A 4S0SA 5DKBA 3KMRA 2P7ZA 2ZNQA 4DK7A 4NY9A 3IMYA 3EYBA 2G5OA 3F5CB 4ITEA 5IAWA 2LBDA 3FC6B 3V9TA 2PIWA 5DV3A 1U3RA 1YIMA 3CS6A 3AZ3A 2AA5A 3VJTA 1ZDTA 2O4JA 5E7VA 4JYHA 2NPAA 3NSPA 1S0XA 4JYGA 5FQSA 4KZMA 4OGHA 4RAKA 1I7IA 4QE6A 5ACCA 5DXGA 1Y0SA 2ACLA 2ZK0A 5FQVA 1QKTA 2BJ4B 2QTUA 3FUGA 3UP0A 2GWXA 3H0AD 1T7MA 3X31A 3AZ1A 2P7AA 1H9UA 3ADTA 2OZ7A 3GN8A 1G1UA 4ZJWA 5AYGA 2I0JA 2IOKA 3AN4A 4OZTU 3HZFA 5DVVA 3IPSA 4CI4A 1GWRA 1KNUA 3OKHA 3G8OA 1FD0A 4OZRU 3RY9A 1T7RA 4RMDA 4ZN7A 2ZLAA 3WJ5A 5IXKA 4JL4A 5M96A 3TX7B 3FURA 5AAVB 1ERRA 1S9PA 1XLSE 1XLSA 2ZL9A 3HO0A 3OLFA 4K6IA 2AO6A 5AZVA 2PINA 1PDUA 3GYTA 5DZIA 5KYAA 2ZNOA 3CTBA 3OLSA 1I38A 5E1CA 4IVYA 2Q6RA 3OLLA 3WJ4A 2PIOA 2QABA 3G9EA 2ZK4A 4QJRA 3R8IA 5LWPA 4POJA 1RK3A 5I4VA 3KWYA 1NQ2A 3A40X 2F4BA 3R5NA 1S19A 2HWQA 4OK1A 1NQ0A 2B1VA 3AUQA 3CS4A 3OMPA 4LTWA 4R06A 2ZK2A 4ZOMA 2QZOA 5G43A 2Q5PA 3F7DA 3SZ1A 2PIUA 3W0JA 4OC7A 3ZRAA 4E4KA 1SQNA 5FQPA 4IV2A 4PWLA 5JY3A 2P1TA 3OS8A 4OH5A 3V3QA 4BCRA 2ZK6A 3WFFA 5HJPA 3VJIA 3OSAA 4OIUA 1UPVA 5KRIA 5LGAA 4FN9A 1Z5XE 3L3XA 3OS9A 3A9EA 1YOKA 3Q95A 3VSPA 2JJ3A 3VT4A 5DZ3A 1HJ1A 1NRLA 1OVLB 3M7RA 2ZNPA 4M8HA 2AA6A 4X1FA 4OEAA 3FEJA 1R6GA 5DVSA 1T74A 4JAZA 2YLPA 5APKA 3VHVA 3L0LA 3D5FA 3KBAA 4G1DA 4PP5A 2R40D 5KR9A 5GT4A 4S14A 1R1KD 2Q70A 2QNVA 3VRWA 2V7CA 2Q3YA 3AFRA 3U9QA 4L96A 4CI5A 5L7EA 5DLRA 4WPFA 1PQCA 5AZTA
chains in the Genus database with same CATH topology
3OZ0A 4PP6A 1U3QA 4MG6A 3D6DA 5DX3B 1P8DA 4MGBA 4UDAA 3KPZA 5KRAA 3L3ZA 3OZJA 2AX7A 2FVJA 3H52A 1N83A 5DIGA 1Y0XX 5L7GA 5FQTA 3FALB 5DU5A 1I37A 3ERTA 3O1EA 3D90A 1ZKYA 3KMGA 1OSVA 2BAWA 3W5QA 4A2JA 3UUAA 3E7CA 2ZXMA 3IPQA 4F9MA 2VV4B 1R20D 1M7WA 1XDKB 5G5WA 1T7FA 2PKLA 2XYWA 5KRHA 3OAPA 4FNEA 2POGA 5DUEA 2HFPA 1NQ7A 1T79A 1M2ZA 2Q7IA 3CJWA 4DM8A 1GS4A 1FCXA 3DCUA 3DZUD 2QPYA 2W8YA 2AX9A 2Q6SA 5DXBB 3UUCA 3H0AA 4WVDA 3OSIA 1UHLB 2G0GA 5G3JA 3D57A 3W0AA 4QM0A 4ZNHA 4XTAA 2ZK3A 5DWLA 1T73A 3G0WA 3B65A 3N00A 5DRJA 4POHA 1NQ1A 2VV0A 4J5XC 4OKWA 5KRKA 4MGAA 4IWCA 4TUZA 5KCTA 4RMEA 2O9IA 4B7WA 2ZVTA 4G2IA 4OH6A 1YOWA 3HLVA 4XHDA 2REWA 5DZ0A 4MDDA 5KRLA 1NDEA 2I4JA 1ZDUA 4IV4A 3WT5A 3DCTA 4Q0AC 2JFAB 4PPPA 1U9EA 3L1BA 2YJDA 3V9YA 3GBKA 5DIDA 4DQMA 2XHSA 4IA7A 2G44A 2YFEA 3GWSX 3BQDA 2VV2A 1XNXA 4MG7A 4CSJA 3GZ9A 2HASA 5KCCA 5AK2A 4OEYA 3W5PA 4JGVA 2QA8A 1X7EA 3VHUA 2E2RA 2QE4A 1L2JA 4KZIA 4ZO1X 1MVCA 3UU7B 5DRMA 4DK8A 4R2UA 5DVCA 3SP6A 3WTQA 1A52A 2QA6A 3K6PA 4K7AA 3VRUA 2YHDA 4REFA 3W5TA 3IA6A 4RUPA 2AAXA 3UUDA 3VN2A 2I4ZA 1PQ6A 3HODA 3KDTA 4PP3A 3VT7A 4YT1A 4XI3A 3ADXA 4FGYA 5AWKA 2Q61A 1PRGA 1SR7A 1X76A 2Z4BA 3OKIA 4MG9A 2QH6A 2B23A 1GWXA 2Q59A 1XB7A 4PLEA 4IQRA 4LSJA 5DKGA 1XNNA 3A2JA 3UVVB 5DP0A 2PIPL 3KMZA 1YUCA 2B1ZA 2OVHA 2NV7A 1G50A 1K74D 1XJ7A 2R40A 4OZTE 4PPSA 4PXMA 4NUFA 1R1KA 3T03A 1NAXA 1FM6D 1R5KA 5G44A 4DOSA 4OZRE 5C4UA 4E2JA 5DTVA 1E3GA 4RZEA 2ABIA 2Q6JA 2QGWA 4N8RA 5C4SA 3WT7A 5F9BA 1T7TA 2OVMA 2AX8A 3VTCA 5DWGA 1XV9B 3VT9A 4PLDA 3ADSA 5HJSA 1DKFA 2GPUA 1YYEA 2AM9A 5KD9A 5L11A 3PBAA 5DK9A 3B68A 4HEEX 5AWJA 3JZCA 4OARA 2AYRA 5DWEA 3E00A 4MGDA 1YY4A 1XVPA 2VSRA 3CS8A 4OJ4A 4RUJA 3WGPA 3R2AA 1X78A 3ET3A 4OEZA 1VJBA 3ADWA 4DORA 4XLDA 2HB7A 3DZYD 1RDTA 1I7GA 2QW4A 1P93A 1ZH7A 4ZNWA 1Z5XU 1S0ZA 4MGCA 4PF3A 5DZHA 3IXPD 2R6YA 3B0QA 2HCDA 3KFCA 4XUHA 2B50A 1M13A 3CDSA 2FSZA 4J26A 1X7RA 4L98A 5AAUA 1K4WA 2ACLB 3O1DA 2Q5GA 4IUIA 1R20A 1IE9A 3IPUA 5DY8A 1FCYA 2VV1A 2QA8B 2HWRA 2P4YA 5C4TA 2H77A 2HAMA 5JI0D 5JJMA 2HARA 2QXMA 5CJ6A 1LBDA 4N73A 5IZ0A 4DMAA 1LV2A 2QR9A 4MG5A 1IE8A 1KKQA 4Y29A 5DIEA 3P88A 4IA2A 4MG8A 2ZMJA 1EXAA 2GL8A 3LMPA 4TV1A 4NIEA 5DYBA 2PIRA 2QXSA 4ZNUA 2R6WA 3PLZA 3R8AA 5HCVA 2ZXNA 4OJ9A 4S15A 1T5ZA 1PCGA 2P1UA 4XT9A 5EC9A 2G0HA 3B0WA 3B3KA 2PJLA 3F5CA 1Q4XA 3DY6A 1FM9D 3MNOA 3FC6A 4ONIA 2YLOA 4WLBA 3A2HA 5A86A 1WM0X 2Z4JA 3L0EA 1YINA 3CQVA 3P0UA 4IU7A 4OHAA 4M8EA 4J5XA 2POBA 2GPPA 1SJ0A 1N4HA 1SKXA 3OGTA 5DXMA 2QZOB 1L2IA 2NW4A 2ZMIA 3B0TA 5ETHA 3DT3A 1QKMA 1PQ9A 3ET2A 1PK5A 1Z95A 2BJ4A 4OKBA 3S9SA 2ZMHA 3G8IA 4RMCA 3V49A 5HYKA 4IWFA 3W0YA 2Q7KA 2GPOA 4YNKA 1XP1A 3OMMA 5HJPB 3PCUA 5DYDA 4UDDA 3HM1A 4ZN9A 2YJAB 2AMBA 4OFUA 3A9EB 3Q95B 1UOMA 3PRGA 3B67A 1KV6A 3VTBA 3RUTA 1N46A 4P6WA 5C4OA 3A3ZX 3RLJA 5FQRA 1YP0A 1UPWA 5AAVA 2OM9A 2ZASA 2OUZA 5HYRA 2PIXA 3RVFA 1TFCA 2Q5SA 1U3SA 2P54A 3KYTA 5KROA 4IVWA 3B66A 3VTDA 5DI7A 2J7XA 4N5GA 4LNXA 3HC5A 4RWVA 4NQAB 3OMKA 5SYZA 1K74A 3L03A 4EMAA 3OOFA 1NUOA 2EWPA 5DXEA 2GIUA 1K7LA 1FM6A 2AA2A 4REEA 4J5WC 3K22A 4IS8A 1FCZA 5DKEA 2Q7LA 5DV6A 5DXRA 5KRFA 4ZJRA 4MGBB 3WMHA 2HVCA 3X1IA 5GIEA 5G45A 5E19A 1ILGA 2ZXZA 3ADVA 3VT3A 3ZRBA 2ATHA 2AX6A 3ET1A 4APUA 3R29A 4XAOA 3X1HA 5KCUA 5H1EA 5KCDA 2Q1VA 2QSEA 2HC4A 2V0VA 1YJEA 2YATA 3A2IA 2VV3A 4IA3A 3TY0A 2O4RA 4OKXA 2HBHA 4E4QA 1EREA 3CLDA 5EHJA 3UUAB 1XZXX 3W0IA 3PO9A 4KZJA 3AURA 1OVLA 4RZGA 1Y9RA 2YLQA 3DZYA 1TXIA 3GYUA 4ZI1A 5KRCA 2IHQA 4FHIA 5B5BA 4DM6A 3IXPA 4FHHA 1NHZA 2J14A 3VSOA 2PNUA 3DR1A 1G2NA 2QMVA 3OMOA 1HG4A 3V3EA 5KRMA 4NB6A 3OSWA 4G20A 4G1YA 3UP3A 4WHFA 5KYJA 3B0RA 2PIQA 2AMAA 1T63A 4P6XA 2IOGA 5E0WA 4MGAB 2I4PA 4TUZB 2XYXA 1XQ3A 4PVUA 5E0XA 4Q50A 5DX3A 3ZQTA 5DXKA 5KRJA 1QKNA 3OMQA 1S9QA 1NYXA 3ADUA 5DKSA 5E15A 4QE8A 3OOKA 5APJA 2HB8A 4UDCA 2Q1HA 2P7GA 1X7BA 3FALA 3ZR7A 3VT5A 4QK4A 3FXVA 3NOAA 2Q60A 2ZK5A 5APHA 1XOWA 4YPQA 1OSHA 2FAIA 3HVLA 1BSXA 3E94A 4G2HA 1FM9A 4EM9A 4OKTA 1YMTA 3ERDA 3WWRA 2VV4A 4IA1A 3VI8A 4RZFA 1XDKA 2ZBSA 4MG7B 1G5YA 4OJBA 3B1MA 5ICKA 1RKHA 3P89A 5K13A 3CDPA 5DZ1A 5GICA 1XQCA 3W5RA 3TKCA 3K8SA 2I0GA 2OAXA 3K23A 3KDUA 3PEQA 2P1VA 3JZBA 1ILHA 5DMCA 1ZEOA 3AZ2A 4HLWA 5DUHA 2PRGA 5KCEA 1X7JA 4LNWA 5DXBA 3DZUA 4UDBA 1E3KA 5DV8A 1UHLA 1MZNA 4Q13A 2NXXE 3GWXA 3UUDB 2NXXA 2YLYA 5EI1A 3NSQA 4OFRA 4RE8A 5EJVA 5G46A 4MG9B 2PIVA 5EGVA 2Q59B 1ZUCA 4S0TA 2VSTA 5DMFA 5E14A 3WT6A 3FS1A 3GD2A 4WQPA 2GTKA 1EXXA 2XYJA 4J24A 2ZKCA 3AN3A 4JYIA 5DWJA 5DXPA 3OS8C 2Q7JA 3W0HA 5KCFA 3R5MA 5DWIA 1FBYA 3D24A 3RUUA 1T76A 2JFAA 3RLLA 1ZGYA 2J7YA 4G1ZA 5EITA 1PZLA 2ZY0A 4ZNTA 5DL4A 1OT7A 1NAVA 3MNPA 3LBDA 4K4JA 3VRVA 2A3IA 5B41A 4A4WA 1MV9A 4PRGA 1DKFB 2AWHA 3SP9A 3E00D 3W0GA 1YA3A 5G42A 3BEJA 3A78A 1ZAFA 3QT0A 3W0CA 5DXQA 2AB2A 1A28A 2AA7A 4MGDB 4N1YA 1XVPB 4R6SA 5AVIA 3ILZA 3UU7A 2OCFA 1RDTD 3FLIA 1QKUA 2JF9A 4WHGA 2H79A 5AVLA 2ZK1A 2Q8SA 2AXAA 2P15A 4QL8A 2QGTA 2XKWA 1GWQA 4J5WA 3AX8A 3R8DA 3VHWA 3WFGA 2J4AA 2ZFXA 4IW8A 3X36A 1XP6A 4IW6A 3V4AA 4RFWA 4ZO1B 2ZLCA 1DB1A 4OIVA 5L7HA 4XUMA 2VV1B 3VRTA 4OLMA 3TKMA 3CWDA 4OEDA 3P8XA 4X1GA 3UVVA 3BC5A 5DUGA 2PITA 2ZNNA 5KCWA 1T65A 3AUNA 1XAPA 5JJMB 2GP7A 4ITFA 5HZCA 4A4VA 3HC6A 4LBDA 3VT6A 1RJKA 1XPCA 2GPVA 4ZNVA 3V9VA 3MNEA 3VT8A 4ZNSA 3FEIA 3VJSA 4MG8B 4TV1B 3HQ5A 3L0JA 5DSHA 4RUOX 3VJHA 1XV9A 3B5RA 4G21A 1XIUA 1RKGA 4YMQA 5GIDA 1XP9A 4O8FA 4OILA 3ET0A 4S0SA 5DKBA 3KMRA 2P7ZA 2ZNQA 4DK7A 4NY9A 3IMYA 3EYBA 2G5OA 3F5CB 4ITEA 5IAWA 2LBDA 3FC6B 3V9TA 2PIWA 5DV3A 1U3RA 1YIMA 3CS6A 3AZ3A 2AA5A 3VJTA 1ZDTA 2O4JA 5E7VA 4JYHA 2NPAA 3NSPA 1S0XA 4JYGA 5FQSA 4KZMA 4OGHA 4RAKA 1I7IA 4QE6A 5ACCA 5DXGA 1Y0SA 2ACLA 2ZK0A 5FQVA 1QKTA 2BJ4B 2QTUA 3FUGA 3UP0A 2GWXA 3H0AD 1T7MA 3X31A 3AZ1A 2P7AA 1H9UA 3ADTA 2OZ7A 3GN8A 1G1UA 4ZJWA 5AYGA 2I0JA 2IOKA 3AN4A 4OZTU 3HZFA 5DVVA 3IPSA 4CI4A 1GWRA 1KNUA 3OKHA 3G8OA 1FD0A 4OZRU 3RY9A 1T7RA 4RMDA 4ZN7A 2ZLAA 3WJ5A 5IXKA 4JL4A 5M96A 3TX7B 3FURA 5AAVB 1ERRA 1S9PA 1XLSE 1XLSA 2ZL9A 3HO0A 3OLFA 4K6IA 2AO6A 5AZVA 2PINA 1PDUA 3GYTA 5DZIA 5KYAA 2ZNOA 3CTBA 3OLSA 1I38A 5E1CA 4IVYA 2Q6RA 3OLLA 3WJ4A 2PIOA 2QABA 3G9EA 2ZK4A 4QJRA 3R8IA 5LWPA 4POJA 1RK3A 5I4VA 3KWYA 1NQ2A 3A40X 2F4BA 3R5NA 1S19A 2HWQA 4OK1A 1NQ0A 2B1VA 3AUQA 3CS4A 3OMPA 4LTWA 4R06A 2ZK2A 4ZOMA 2QZOA 5G43A 2Q5PA 3F7DA 3SZ1A 2PIUA 3W0JA 4OC7A 3ZRAA 4E4KA 1SQNA 5FQPA 4IV2A 4PWLA 5JY3A 2P1TA 3OS8A 4OH5A 3V3QA 4BCRA 2ZK6A 3WFFA 5HJPA 3VJIA 3OSAA 4OIUA 1UPVA 5KRIA 5LGAA 4FN9A 1Z5XE 3L3XA 3OS9A 3A9EA 1YOKA 3Q95A 3VSPA 2JJ3A 3VT4A 5DZ3A 1HJ1A 1NRLA 1OVLB 3M7RA 2ZNPA 4M8HA 2AA6A 4X1FA 4OEAA 3FEJA 1R6GA 5DVSA 1T74A 4JAZA 2YLPA 5APKA 3VHVA 3L0LA 3D5FA 3KBAA 4G1DA 4PP5A 2R40D 5KR9A 5GT4A 4S14A 1R1KD 2Q70A 2QNVA 3VRWA 2V7CA 2Q3YA 3AFRA 3U9QA 4L96A 4CI5A 5L7EA 5DLRA 4WPFA 1PQCA 5AZTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OZ0 A;  4PP6 A;  1U3Q A;  4MG6 A;  3D6D A;  5DX3 B;  1P8D A;  4MGB A;  4UDA A;  3KPZ A;  5KRA A;  3L3Z A;  3OZJ A;  2AX7 A;  2FVJ A;  3H52 A;  1N83 A;  5DIG A;  1Y0X X;  5L7G A;  5FQT A;  3FAL B;  5DU5 A;  1I37 A;  3ERT A;  3O1E A;  3D90 A;  1ZKY A;  3KMG A;  1OSV A;  2BAW A;  3W5Q A;  4A2J A;  3UUA A;  3E7C A;  2ZXM A;  3IPQ A;  4F9M A;  2VV4 B;  1R20 D;  1M7W A;  1XDK B;  5G5W A;  1T7F A;  2PKL A;  2XYW A;  5KRH A;  3OAP A;  4FNE A;  2POG A;  5DUE A;  2HFP A;  1NQ7 A;  1T79 A;  1M2Z A;  2Q7I A;  3CJW A;  4DM8 A;  1GS4 A;  1FCX A;  3DCU A;  3DZU D;  2QPY A;  2W8Y A;  2AX9 A;  2Q6S A;  5DXB B;  3UUC A;  3H0A A;  4WVD A;  3OSI A;  1UHL B;  2G0G A;  5G3J A;  3D57 A;  3W0A A;  4QM0 A;  4ZNH A;  4XTA A;  2ZK3 A;  5DWL A;  1T73 A;  3G0W A;  3B65 A;  3N00 A;  5DRJ A;  4POH A;  1NQ1 A;  2VV0 A;  4J5X C;  4OKW A;  5KRK A;  4MGA A;  4IWC A;  4TUZ A;  5KCT A;  4RME A;  2O9I A;  4B7W A;  2ZVT A;  4G2I A;  4OH6 A;  1YOW A;  3HLV A;  4XHD A;  2REW A;  5DZ0 A;  4MDD A;  5KRL A;  1NDE A;  2I4J A;  1ZDU A;  4IV4 A;  3WT5 A;  3DCT A;  4Q0A C;  2JFA B;  4PPP A;  1U9E A;  3L1B A;  2YJD A;  3V9Y A;  3GBK A;  5DID A;  4DQM A;  2XHS A;  4IA7 A;  2G44 A;  2YFE A;  3GWS X;  3BQD A;  2VV2 A;  1XNX A;  4MG7 A;  4CSJ A;  3GZ9 A;  2HAS A;  5KCC A;  5AK2 A;  4OEY A;  3W5P A;  4JGV A;  2QA8 A;  1X7E A;  3VHU A;  2E2R A;  2QE4 A;  1L2J A;  4KZI A;  4ZO1 X;  1MVC A;  3UU7 B;  5DRM A;  4DK8 A;  4R2U A;  5DVC A;  3SP6 A;  3WTQ A;  1A52 A;  2QA6 A;  3K6P A;  4K7A A;  3VRU A;  2YHD A;  4REF A;  3W5T A;  3IA6 A;  4RUP A;  2AAX A;  3UUD A;  3VN2 A;  2I4Z A;  1PQ6 A;  3HOD A;  3KDT A;  4PP3 A;  3VT7 A;  4YT1 A;  4XI3 A;  3ADX A;  4FGY A;  5AWK A;  2Q61 A;  1PRG A;  1SR7 A;  1X76 A;  2Z4B A;  3OKI A;  4MG9 A;  2QH6 A;  2B23 A;  1GWX A;  2Q59 A;  1XB7 A;  4PLE A;  4IQR A;  4LSJ A;  5DKG A;  1XNN A;  3A2J A;  3UVV B;  5DP0 A;  2PIP L;  3KMZ A;  1YUC A;  2B1Z A;  2OVH A;  2NV7 A;  1G50 A;  1K74 D;  1XJ7 A;  2R40 A;  4OZT E;  4PPS A;  4PXM A;  4NUF A;  1R1K A;  3T03 A;  1NAX A;  1FM6 D;  1R5K A;  5G44 A;  4DOS A;  4OZR E;  5C4U A;  4E2J A;  5DTV A;  1E3G A;  4RZE A;  2ABI A;  2Q6J A;  2QGW A;  4N8R A;  5C4S A;  3WT7 A;  5F9B A;  1T7T A;  2OVM A;  2AX8 A;  3VTC A;  5DWG A;  1XV9 B;  3VT9 A;  4PLD A;  3ADS A;  5HJS A;  1DKF A;  2GPU A;  1YYE A;  2AM9 A;  5KD9 A;  5L11 A;  3PBA A;  5DK9 A;  3B68 A;  4HEE X;  5AWJ A;  3JZC A;  4OAR A;  2AYR A;  5DWE A;  3E00 A;  4MGD A;  1YY4 A;  1XVP A;  2VSR A;  3CS8 A;  4OJ4 A;  4RUJ A;  3WGP A;  3R2A A;  1X78 A;  3ET3 A;  4OEZ A;  1VJB A;  3ADW A;  4DOR A;  4XLD A;  2HB7 A;  3DZY D;  1RDT A;  1I7G A;  2QW4 A;  1P93 A;  1ZH7 A;  4ZNW A;  1Z5X U;  1S0Z A;  4MGC A;  4PF3 A;  5DZH A;  3IXP D;  2R6Y A;  3B0Q A;  2HCD A;  3KFC A;  4XUH A;  2B50 A;  1M13 A;  3CDS A;  2FSZ A;  4J26 A;  1X7R A;  4L98 A;  5AAU A;  1K4W A;  2ACL B;  3O1D A;  2Q5G A;  4IUI A;  1R20 A;  1IE9 A;  3IPU A;  5DY8 A;  1FCY A;  2VV1 A;  2QA8 B;  2HWR A;  2P4Y A;  5C4T A;  2H77 A;  2HAM A;  5JI0 D;  5JJM A;  2HAR A;  2QXM A;  5CJ6 A;  1LBD A;  4N73 A;  5IZ0 A;  4DMA A;  1LV2 A;  2QR9 A;  4MG5 A;  1IE8 A;  1KKQ A;  4Y29 A;  5DIE A;  3P88 A;  4IA2 A;  4MG8 A;  2ZMJ A;  1EXA A;  2GL8 A;  3LMP A;  4TV1 A;  4NIE A;  5DYB A;  2PIR A;  2QXS A;  4ZNU A;  2R6W A;  3PLZ A;  3R8A A;  5HCV A;  2ZXN A;  4OJ9 A;  4S15 A;  1T5Z A;  1PCG A;  2P1U A;  4XT9 A;  5EC9 A;  2G0H A;  3B0W A;  3B3K A;  2PJL A;  3F5C A;  1Q4X A;  3DY6 A;  1FM9 D;  3MNO A;  3FC6 A;  4ONI A;  2YLO A;  4WLB A;  3A2H A;  5A86 A;  1WM0 X;  2Z4J A;  3L0E A;  1YIN A;  3CQV A;  3P0U A;  4IU7 A;  4OHA A;  4M8E A;  4J5X A;  2POB A;  2GPP A;  1SJ0 A;  1N4H A;  1SKX A;  3OGT A;  5DXM A;  2QZO B;  1L2I A;  2NW4 A;  2ZMI A;  3B0T A;  5ETH A;  3DT3 A;  1QKM A;  1PQ9 A;  3ET2 A;  1PK5 A;  1Z95 A;  2BJ4 A;  4OKB A;  3S9S A;  2ZMH A;  3G8I A;  4RMC A;  3V49 A;  5HYK A;  4IWF A;  3W0Y A;  2Q7K A;  2GPO A;  4YNK A;  1XP1 A;  3OMM A;  5HJP B;  3PCU A;  5DYD A;  4UDD A;  3HM1 A;  4ZN9 A;  2YJA B;  2AMB A;  4OFU A;  3A9E B;  3Q95 B;  1UOM A;  3PRG A;  3B67 A;  1KV6 A;  3VTB A;  3RUT A;  1N46 A;  4P6W A;  5C4O A;  3A3Z X;  3RLJ A;  5FQR A;  1YP0 A;  1UPW A;  5AAV A;  2OM9 A;  2ZAS A;  2OUZ A;  5HYR A;  2PIX A;  3RVF A;  1TFC A;  2Q5S A;  1U3S A;  2P54 A;  3KYT A;  5KRO A;  4IVW A;  3B66 A;  3VTD A;  5DI7 A;  2J7X A;  4N5G A;  4LNX A;  3HC5 A;  4RWV A;  4NQA B;  3OMK A;  5SYZ A;  1K74 A;  3L03 A;  4EMA A;  3OOF A;  1NUO A;  2EWP A;  5DXE A;  2GIU A;  1K7L A;  1FM6 A;  2AA2 A;  4REE A;  4J5W C;  3K22 A;  4IS8 A;  1FCZ A;  5DKE A;  2Q7L A;  5DV6 A;  5DXR A;  5KRF A;  4ZJR A;  4MGB B;  3WMH A;  2HVC A;  3X1I A;  5GIE A;  5G45 A;  5E19 A;  1ILG A;  2ZXZ A;  3ADV A;  3VT3 A;  3ZRB A;  2ATH A;  2AX6 A;  3ET1 A;  4APU A;  3R29 A;  4XAO A;  3X1H A;  5KCU A;  5H1E A;  5KCD A;  2Q1V A;  2QSE A;  2HC4 A;  2V0V A;  1YJE A;  2YAT A;  3A2I A;  2VV3 A;  4IA3 A;  3TY0 A;  2O4R A;  4OKX A;  2HBH A;  4E4Q A;  1ERE A;  3CLD A;  5EHJ A;  3UUA B;  1XZX X;  3W0I A;  3PO9 A;  4KZJ A;  3AUR A;  1OVL A;  4RZG A;  1Y9R A;  2YLQ A;  3DZY A;  1TXI A;  3GYU A;  4ZI1 A;  5KRC A;  2IHQ A;  4FHI A;  5B5B A;  4DM6 A;  3IXP A;  4FHH A;  1NHZ A;  2J14 A;  3VSO A;  2PNU A;  3DR1 A;  1G2N A;  2QMV A;  3OMO A;  1HG4 A;  3V3E A;  5KRM A;  4NB6 A;  3OSW A;  4G20 A;  4G1Y A;  3UP3 A;  4WHF A;  5KYJ A;  3B0R A;  2PIQ A;  2AMA A;  1T63 A;  4P6X A;  2IOG A;  5E0W A;  4MGA B;  2I4P A;  4TUZ B;  2XYX A;  1XQ3 A;  4PVU A;  5E0X A;  4Q50 A;  5DX3 A;  3ZQT A;  5DXK A;  5KRJ A;  1QKN A;  3OMQ A;  1S9Q A;  1NYX A;  3ADU A;  5DKS A;  5E15 A;  4QE8 A;  3OOK A;  5APJ A;  2HB8 A;  4UDC A;  2Q1H A;  2P7G A;  1X7B A;  3FAL A;  3ZR7 A;  3VT5 A;  4QK4 A;  3FXV A;  3NOA A;  2Q60 A;  2ZK5 A;  5APH A;  1XOW A;  4YPQ A;  1OSH A;  2FAI A;  3HVL A;  1BSX A;  3E94 A;  4G2H A;  1FM9 A;  4EM9 A;  4OKT A;  1YMT A;  3ERD A;  3WWR A;  2VV4 A;  4IA1 A;  3VI8 A;  4RZF A;  1XDK A;  2ZBS A;  4MG7 B;  1G5Y A;  4OJB A;  3B1M A;  5ICK A;  1RKH A;  3P89 A;  5K13 A;  3CDP A;  5DZ1 A;  5GIC A;  1XQC A;  3W5R A;  3TKC A;  3K8S A;  2I0G A;  2OAX A;  3K23 A;  3KDU A;  3PEQ A;  2P1V A;  3JZB A;  1ILH A;  5DMC A;  1ZEO A;  3AZ2 A;  4HLW A;  5DUH A;  2PRG A;  5KCE A;  1X7J A;  4LNW A;  5DXB A;  3DZU A;  4UDB A;  1E3K A;  5DV8 A;  1UHL A;  1MZN A;  4Q13 A;  2NXX E;  3GWX A;  3UUD B;  2NXX A;  2YLY A;  5EI1 A;  3NSQ A;  4OFR A;  4RE8 A;  5EJV A;  5G46 A;  4MG9 B;  2PIV A;  5EGV A;  2Q59 B;  1ZUC A;  4S0T A;  2VST A;  5DMF A;  5E14 A;  3WT6 A;  3FS1 A;  3GD2 A;  4WQP A;  2GTK A;  1EXX A;  2XYJ A;  4J24 A;  2ZKC A;  3AN3 A;  4JYI A;  5DWJ A;  5DXP A;  3OS8 C;  2Q7J A;  3W0H A;  5KCF A;  3R5M A;  5DWI A;  1FBY A;  3D24 A;  3RUU A;  1T76 A;  2JFA A;  3RLL A;  1ZGY A;  2J7Y A;  4G1Z A;  5EIT A;  1PZL A;  2ZY0 A;  4ZNT A;  5DL4 A;  1OT7 A;  1NAV A;  3MNP A;  3LBD A;  4K4J A;  3VRV A;  2A3I A;  5B41 A;  4A4W A;  1MV9 A;  4PRG A;  1DKF B;  2AWH A;  3SP9 A;  3E00 D;  3W0G A;  1YA3 A;  5G42 A;  3BEJ A;  3A78 A;  1ZAF A;  3QT0 A;  3W0C A;  5DXQ A;  2AB2 A;  1A28 A;  2AA7 A;  4MGD B;  4N1Y A;  1XVP B;  4R6S A;  5AVI A;  3ILZ A;  3UU7 A;  2OCF A;  1RDT D;  3FLI A;  1QKU A;  2JF9 A;  4WHG A;  2H79 A;  5AVL A;  2ZK1 A;  2Q8S A;  2AXA A;  2P15 A;  4QL8 A;  2QGT A;  2XKW A;  1GWQ A;  4J5W A;  3AX8 A;  3R8D A;  3VHW A;  3WFG A;  2J4A A;  2ZFX A;  4IW8 A;  3X36 A;  1XP6 A;  4IW6 A;  3V4A A;  4RFW A;  4ZO1 B;  2ZLC A;  1DB1 A;  4OIV A;  5L7H A;  4XUM A;  2VV1 B;  3VRT A;  4OLM A;  3TKM A;  3CWD A;  4OED A;  3P8X A;  4X1G A;  3UVV A;  3BC5 A;  5DUG A;  2PIT A;  2ZNN A;  5KCW A;  1T65 A;  3AUN A;  1XAP A;  5JJM B;  2GP7 A;  4ITF A;  5HZC A;  4A4V A;  3HC6 A;  4LBD A;  3VT6 A;  1RJK A;  1XPC A;  2GPV A;  4ZNV A;  3V9V A;  3MNE A;  3VT8 A;  4ZNS A;  3FEI A;  3VJS A;  4MG8 B;  4TV1 B;  3HQ5 A;  3L0J A;  5DSH A;  4RUO X;  3VJH A;  1XV9 A;  3B5R A;  4G21 A;  1XIU A;  1RKG A;  4YMQ A;  5GID A;  1XP9 A;  4O8F A;  4OIL A;  3ET0 A;  4S0S A;  5DKB A;  3KMR A;  2P7Z A;  2ZNQ A;  4DK7 A;  4NY9 A;  3IMY A;  3EYB A;  2G5O A;  3F5C B;  4ITE A;  5IAW A;  2LBD A;  3FC6 B;  3V9T A;  2PIW A;  5DV3 A;  1U3R A;  1YIM A;  3CS6 A;  3AZ3 A;  2AA5 A;  3VJT A;  1ZDT A;  2O4J A;  5E7V A;  4JYH A;  2NPA A;  3NSP A;  1S0X A;  4JYG A;  5FQS A;  4KZM A;  4OGH A;  4RAK A;  1I7I A;  4QE6 A;  5ACC A;  5DXG A;  1Y0S A;  2ACL A;  2ZK0 A;  5FQV A;  1QKT A;  2BJ4 B;  2QTU A;  3FUG A;  3UP0 A;  2GWX A;  3H0A D;  1T7M A;  3X31 A;  3AZ1 A;  2P7A A;  1H9U A;  3ADT A;  2OZ7 A;  3GN8 A;  1G1U A;  4ZJW A;  5AYG A;  2I0J A;  2IOK A;  3AN4 A;  4OZT U;  3HZF A;  5DVV A;  3IPS A;  4CI4 A;  1GWR A;  1KNU A;  3OKH A;  3G8O A;  1FD0 A;  4OZR U;  3RY9 A;  1T7R A;  4RMD A;  4ZN7 A;  2ZLA A;  3WJ5 A;  5IXK A;  4JL4 A;  5M96 A;  3TX7 B;  3FUR A;  5AAV B;  1ERR A;  1S9P A;  1XLS E;  1XLS A;  2ZL9 A;  3HO0 A;  3OLF A;  4K6I A;  2AO6 A;  5AZV A;  2PIN A;  1PDU A;  3GYT A;  5DZI A;  5KYA A;  2ZNO A;  3CTB A;  3OLS A;  1I38 A;  5E1C A;  4IVY A;  2Q6R A;  3OLL A;  3WJ4 A;  2PIO A;  2QAB A;  3G9E A;  2ZK4 A;  4QJR A;  3R8I A;  5LWP A;  4POJ A;  1RK3 A;  5I4V A;  3KWY A;  1NQ2 A;  3A40 X;  2F4B A;  3R5N A;  1S19 A;  2HWQ A;  4OK1 A;  1NQ0 A;  2B1V A;  3AUQ A;  3CS4 A;  3OMP A;  4LTW A;  4R06 A;  2ZK2 A;  4ZOM A;  2QZO A;  5G43 A;  2Q5P A;  3F7D A;  3SZ1 A;  2PIU A;  3W0J A;  4OC7 A;  3ZRA A;  4E4K A;  1SQN A;  5FQP A;  4IV2 A;  4PWL A;  5JY3 A;  2P1T A;  3OS8 A;  4OH5 A;  3V3Q A;  4BCR A;  2ZK6 A;  3WFF A;  5HJP A;  3VJI A;  3OSA A;  4OIU A;  1UPV A;  5KRI A;  5LGA A;  4FN9 A;  1Z5X E;  3L3X A;  3OS9 A;  3A9E A;  1YOK A;  3Q95 A;  3VSP A;  2JJ3 A;  3VT4 A;  5DZ3 A;  1HJ1 A;  1NRL A;  1OVL B;  3M7R A;  2ZNP A;  4M8H A;  2AA6 A;  4X1F A;  4OEA A;  3FEJ A;  1R6G A;  5DVS A;  1T74 A;  4JAZ A;  2YLP A;  5APK A;  3VHV A;  3L0L A;  3D5F A;  3KBA A;  4G1D A;  4PP5 A;  2R40 D;  5KR9 A;  5GT4 A;  4S14 A;  1R1K D;  2Q70 A;  2QNV A;  3VRW A;  2V7C A;  2Q3Y A;  3AFR A;  3U9Q A;  4L96 A;  4CI5 A;  5L7E A;  5DLR A;  4WPF A;  1PQC A;  5AZT A; 
#chains in the Genus database with same CATH topology
 3OZ0 A;  4PP6 A;  1U3Q A;  4MG6 A;  3D6D A;  5DX3 B;  1P8D A;  4MGB A;  4UDA A;  3KPZ A;  5KRA A;  3L3Z A;  3OZJ A;  2AX7 A;  2FVJ A;  3H52 A;  1N83 A;  5DIG A;  1Y0X X;  5L7G A;  5FQT A;  3FAL B;  5DU5 A;  1I37 A;  3ERT A;  3O1E A;  3D90 A;  1ZKY A;  3KMG A;  1OSV A;  2BAW A;  3W5Q A;  4A2J A;  3UUA A;  3E7C A;  2ZXM A;  3IPQ A;  4F9M A;  2VV4 B;  1R20 D;  1M7W A;  1XDK B;  5G5W A;  1T7F A;  2PKL A;  2XYW A;  5KRH A;  3OAP A;  4FNE A;  2POG A;  5DUE A;  2HFP A;  1NQ7 A;  1T79 A;  1M2Z A;  2Q7I A;  3CJW A;  4DM8 A;  1GS4 A;  1FCX A;  3DCU A;  3DZU D;  2QPY A;  2W8Y A;  2AX9 A;  2Q6S A;  5DXB B;  3UUC A;  3H0A A;  4WVD A;  3OSI A;  1UHL B;  2G0G A;  5G3J A;  3D57 A;  3W0A A;  4QM0 A;  4ZNH A;  4XTA A;  2ZK3 A;  5DWL A;  1T73 A;  3G0W A;  3B65 A;  3N00 A;  5DRJ A;  4POH A;  1NQ1 A;  2VV0 A;  4J5X C;  4OKW A;  5KRK A;  4MGA A;  4IWC A;  4TUZ A;  5KCT A;  4RME A;  2O9I A;  4B7W A;  2ZVT A;  4G2I A;  4OH6 A;  1YOW A;  3HLV A;  4XHD A;  2REW A;  5DZ0 A;  4MDD A;  5KRL A;  1NDE A;  2I4J A;  1ZDU A;  4IV4 A;  3WT5 A;  3DCT A;  4Q0A C;  2JFA B;  4PPP A;  1U9E A;  3L1B A;  2YJD A;  3V9Y A;  3GBK A;  5DID A;  4DQM A;  2XHS A;  4IA7 A;  2G44 A;  2YFE A;  3GWS X;  3BQD A;  2VV2 A;  1XNX A;  4MG7 A;  4CSJ A;  3GZ9 A;  2HAS A;  5KCC A;  5AK2 A;  4OEY A;  3W5P A;  4JGV A;  2QA8 A;  1X7E A;  3VHU A;  2E2R A;  2QE4 A;  1L2J A;  4KZI A;  4ZO1 X;  1MVC A;  3UU7 B;  5DRM A;  4DK8 A;  4R2U A;  5DVC A;  3SP6 A;  3WTQ A;  1A52 A;  2QA6 A;  3K6P A;  4K7A A;  3VRU A;  2YHD A;  4REF A;  3W5T A;  3IA6 A;  4RUP A;  2AAX A;  3UUD A;  3VN2 A;  2I4Z A;  1PQ6 A;  3HOD A;  3KDT A;  4PP3 A;  3VT7 A;  4YT1 A;  4XI3 A;  3ADX A;  4FGY A;  5AWK A;  2Q61 A;  1PRG A;  1SR7 A;  1X76 A;  2Z4B A;  3OKI A;  4MG9 A;  2QH6 A;  2B23 A;  1GWX A;  2Q59 A;  1XB7 A;  4PLE A;  4IQR A;  4LSJ A;  5DKG A;  1XNN A;  3A2J A;  3UVV B;  5DP0 A;  2PIP L;  3KMZ A;  1YUC A;  2B1Z A;  2OVH A;  2NV7 A;  1G50 A;  1K74 D;  1XJ7 A;  2R40 A;  4OZT E;  4PPS A;  4PXM A;  4NUF A;  1R1K A;  3T03 A;  1NAX A;  1FM6 D;  1R5K A;  5G44 A;  4DOS A;  4OZR E;  5C4U A;  4E2J A;  5DTV A;  1E3G A;  4RZE A;  2ABI A;  2Q6J A;  2QGW A;  4N8R A;  5C4S A;  3WT7 A;  5F9B A;  1T7T A;  2OVM A;  2AX8 A;  3VTC A;  5DWG A;  1XV9 B;  3VT9 A;  4PLD A;  3ADS A;  5HJS A;  1DKF A;  2GPU A;  1YYE A;  2AM9 A;  5KD9 A;  5L11 A;  3PBA A;  5DK9 A;  3B68 A;  4HEE X;  5AWJ A;  3JZC A;  4OAR A;  2AYR A;  5DWE A;  3E00 A;  4MGD A;  1YY4 A;  1XVP A;  2VSR A;  3CS8 A;  4OJ4 A;  4RUJ A;  3WGP A;  3R2A A;  1X78 A;  3ET3 A;  4OEZ A;  1VJB A;  3ADW A;  4DOR A;  4XLD A;  2HB7 A;  3DZY D;  1RDT A;  1I7G A;  2QW4 A;  1P93 A;  1ZH7 A;  4ZNW A;  1Z5X U;  1S0Z A;  4MGC A;  4PF3 A;  5DZH A;  3IXP D;  2R6Y A;  3B0Q A;  2HCD A;  3KFC A;  4XUH A;  2B50 A;  1M13 A;  3CDS A;  2FSZ A;  4J26 A;  1X7R A;  4L98 A;  5AAU A;  1K4W A;  2ACL B;  3O1D A;  2Q5G A;  4IUI A;  1R20 A;  1IE9 A;  3IPU A;  5DY8 A;  1FCY A;  2VV1 A;  2QA8 B;  2HWR A;  2P4Y A;  5C4T A;  2H77 A;  2HAM A;  5JI0 D;  5JJM A;  2HAR A;  2QXM A;  5CJ6 A;  1LBD A;  4N73 A;  5IZ0 A;  4DMA A;  1LV2 A;  2QR9 A;  4MG5 A;  1IE8 A;  1KKQ A;  4Y29 A;  5DIE A;  3P88 A;  4IA2 A;  4MG8 A;  2ZMJ A;  1EXA A;  2GL8 A;  3LMP A;  4TV1 A;  4NIE A;  5DYB A;  2PIR A;  2QXS A;  4ZNU A;  2R6W A;  3PLZ A;  3R8A A;  5HCV A;  2ZXN A;  4OJ9 A;  4S15 A;  1T5Z A;  1PCG A;  2P1U A;  4XT9 A;  5EC9 A;  2G0H A;  3B0W A;  3B3K A;  2PJL A;  3F5C A;  1Q4X A;  3DY6 A;  1FM9 D;  3MNO A;  3FC6 A;  4ONI A;  2YLO A;  4WLB A;  3A2H A;  5A86 A;  1WM0 X;  2Z4J A;  3L0E A;  1YIN A;  3CQV A;  3P0U A;  4IU7 A;  4OHA A;  4M8E A;  4J5X A;  2POB A;  2GPP A;  1SJ0 A;  1N4H A;  1SKX A;  3OGT A;  5DXM A;  2QZO B;  1L2I A;  2NW4 A;  2ZMI A;  3B0T A;  5ETH A;  3DT3 A;  1QKM A;  1PQ9 A;  3ET2 A;  1PK5 A;  1Z95 A;  2BJ4 A;  4OKB A;  3S9S A;  2ZMH A;  3G8I A;  4RMC A;  3V49 A;  5HYK A;  4IWF A;  3W0Y A;  2Q7K A;  2GPO A;  4YNK A;  1XP1 A;  3OMM A;  5HJP B;  3PCU A;  5DYD A;  4UDD A;  3HM1 A;  4ZN9 A;  2YJA B;  2AMB A;  4OFU A;  3A9E B;  3Q95 B;  1UOM A;  3PRG A;  3B67 A;  1KV6 A;  3VTB A;  3RUT A;  1N46 A;  4P6W A;  5C4O A;  3A3Z X;  3RLJ A;  5FQR A;  1YP0 A;  1UPW A;  5AAV A;  2OM9 A;  2ZAS A;  2OUZ A;  5HYR A;  2PIX A;  3RVF A;  1TFC A;  2Q5S A;  1U3S A;  2P54 A;  3KYT A;  5KRO A;  4IVW A;  3B66 A;  3VTD A;  5DI7 A;  2J7X A;  4N5G A;  4LNX A;  3HC5 A;  4RWV A;  4NQA B;  3OMK A;  5SYZ A;  1K74 A;  3L03 A;  4EMA A;  3OOF A;  1NUO A;  2EWP A;  5DXE A;  2GIU A;  1K7L A;  1FM6 A;  2AA2 A;  4REE A;  4J5W C;  3K22 A;  4IS8 A;  1FCZ A;  5DKE A;  2Q7L A;  5DV6 A;  5DXR A;  5KRF A;  4ZJR A;  4MGB B;  3WMH A;  2HVC A;  3X1I A;  5GIE A;  5G45 A;  5E19 A;  1ILG A;  2ZXZ A;  3ADV A;  3VT3 A;  3ZRB A;  2ATH A;  2AX6 A;  3ET1 A;  4APU A;  3R29 A;  4XAO A;  3X1H A;  5KCU A;  5H1E A;  5KCD A;  2Q1V A;  2QSE A;  2HC4 A;  2V0V A;  1YJE A;  2YAT A;  3A2I A;  2VV3 A;  4IA3 A;  3TY0 A;  2O4R A;  4OKX A;  2HBH A;  4E4Q A;  1ERE A;  3CLD A;  5EHJ A;  3UUA B;  1XZX X;  3W0I A;  3PO9 A;  4KZJ A;  3AUR A;  1OVL A;  4RZG A;  1Y9R A;  2YLQ A;  3DZY A;  1TXI A;  3GYU A;  4ZI1 A;  5KRC A;  2IHQ A;  4FHI A;  5B5B A;  4DM6 A;  3IXP A;  4FHH A;  1NHZ A;  2J14 A;  3VSO A;  2PNU A;  3DR1 A;  1G2N A;  2QMV A;  3OMO A;  1HG4 A;  3V3E A;  5KRM A;  4NB6 A;  3OSW A;  4G20 A;  4G1Y A;  3UP3 A;  4WHF A;  5KYJ A;  3B0R A;  2PIQ A;  2AMA A;  1T63 A;  4P6X A;  2IOG A;  5E0W A;  4MGA B;  2I4P A;  4TUZ B;  2XYX A;  1XQ3 A;  4PVU A;  5E0X A;  4Q50 A;  5DX3 A;  3ZQT A;  5DXK A;  5KRJ A;  1QKN A;  3OMQ A;  1S9Q A;  1NYX A;  3ADU A;  5DKS A;  5E15 A;  4QE8 A;  3OOK A;  5APJ A;  2HB8 A;  4UDC A;  2Q1H A;  2P7G A;  1X7B A;  3FAL A;  3ZR7 A;  3VT5 A;  4QK4 A;  3FXV A;  3NOA A;  2Q60 A;  2ZK5 A;  5APH A;  1XOW A;  4YPQ A;  1OSH A;  2FAI A;  3HVL A;  1BSX A;  3E94 A;  4G2H A;  1FM9 A;  4EM9 A;  4OKT A;  1YMT A;  3ERD A;  3WWR A;  2VV4 A;  4IA1 A;  3VI8 A;  4RZF A;  1XDK A;  2ZBS A;  4MG7 B;  1G5Y A;  4OJB A;  3B1M A;  5ICK A;  1RKH A;  3P89 A;  5K13 A;  3CDP A;  5DZ1 A;  5GIC A;  1XQC A;  3W5R A;  3TKC A;  3K8S A;  2I0G A;  2OAX A;  3K23 A;  3KDU A;  3PEQ A;  2P1V A;  3JZB A;  1ILH A;  5DMC A;  1ZEO A;  3AZ2 A;  4HLW A;  5DUH A;  2PRG A;  5KCE A;  1X7J A;  4LNW A;  5DXB A;  3DZU A;  4UDB A;  1E3K A;  5DV8 A;  1UHL A;  1MZN A;  4Q13 A;  2NXX E;  3GWX A;  3UUD B;  2NXX A;  2YLY A;  5EI1 A;  3NSQ A;  4OFR A;  4RE8 A;  5EJV A;  5G46 A;  4MG9 B;  2PIV A;  5EGV A;  2Q59 B;  1ZUC A;  4S0T A;  2VST A;  5DMF A;  5E14 A;  3WT6 A;  3FS1 A;  3GD2 A;  4WQP A;  2GTK A;  1EXX A;  2XYJ A;  4J24 A;  2ZKC A;  3AN3 A;  4JYI A;  5DWJ A;  5DXP A;  3OS8 C;  2Q7J A;  3W0H A;  5KCF A;  3R5M A;  5DWI A;  1FBY A;  3D24 A;  3RUU A;  1T76 A;  2JFA A;  3RLL A;  1ZGY A;  2J7Y A;  4G1Z A;  5EIT A;  1PZL A;  2ZY0 A;  4ZNT A;  5DL4 A;  1OT7 A;  1NAV A;  3MNP A;  3LBD A;  4K4J A;  3VRV A;  2A3I A;  5B41 A;  4A4W A;  1MV9 A;  4PRG A;  1DKF B;  2AWH A;  3SP9 A;  3E00 D;  3W0G A;  1YA3 A;  5G42 A;  3BEJ A;  3A78 A;  1ZAF A;  3QT0 A;  3W0C A;  5DXQ A;  2AB2 A;  1A28 A;  2AA7 A;  4MGD B;  4N1Y A;  1XVP B;  4R6S A;  5AVI A;  3ILZ A;  3UU7 A;  2OCF A;  1RDT D;  3FLI A;  1QKU A;  2JF9 A;  4WHG A;  2H79 A;  5AVL A;  2ZK1 A;  2Q8S A;  2AXA A;  2P15 A;  4QL8 A;  2QGT A;  2XKW A;  1GWQ A;  4J5W A;  3AX8 A;  3R8D A;  3VHW A;  3WFG A;  2J4A A;  2ZFX A;  4IW8 A;  3X36 A;  1XP6 A;  4IW6 A;  3V4A A;  4RFW A;  4ZO1 B;  2ZLC A;  1DB1 A;  4OIV A;  5L7H A;  4XUM A;  2VV1 B;  3VRT A;  4OLM A;  3TKM A;  3CWD A;  4OED A;  3P8X A;  4X1G A;  3UVV A;  3BC5 A;  5DUG A;  2PIT A;  2ZNN A;  5KCW A;  1T65 A;  3AUN A;  1XAP A;  5JJM B;  2GP7 A;  4ITF A;  5HZC A;  4A4V A;  3HC6 A;  4LBD A;  3VT6 A;  1RJK A;  1XPC A;  2GPV A;  4ZNV A;  3V9V A;  3MNE A;  3VT8 A;  4ZNS A;  3FEI A;  3VJS A;  4MG8 B;  4TV1 B;  3HQ5 A;  3L0J A;  5DSH A;  4RUO X;  3VJH A;  1XV9 A;  3B5R A;  4G21 A;  1XIU A;  1RKG A;  4YMQ A;  5GID A;  1XP9 A;  4O8F A;  4OIL A;  3ET0 A;  4S0S A;  5DKB A;  3KMR A;  2P7Z A;  2ZNQ A;  4DK7 A;  4NY9 A;  3IMY A;  3EYB A;  2G5O A;  3F5C B;  4ITE A;  5IAW A;  2LBD A;  3FC6 B;  3V9T A;  2PIW A;  5DV3 A;  1U3R A;  1YIM A;  3CS6 A;  3AZ3 A;  2AA5 A;  3VJT A;  1ZDT A;  2O4J A;  5E7V A;  4JYH A;  2NPA A;  3NSP A;  1S0X A;  4JYG A;  5FQS A;  4KZM A;  4OGH A;  4RAK A;  1I7I A;  4QE6 A;  5ACC A;  5DXG A;  1Y0S A;  2ACL A;  2ZK0 A;  5FQV A;  1QKT A;  2BJ4 B;  2QTU A;  3FUG A;  3UP0 A;  2GWX A;  3H0A D;  1T7M A;  3X31 A;  3AZ1 A;  2P7A A;  1H9U A;  3ADT A;  2OZ7 A;  3GN8 A;  1G1U A;  4ZJW A;  5AYG A;  2I0J A;  2IOK A;  3AN4 A;  4OZT U;  3HZF A;  5DVV A;  3IPS A;  4CI4 A;  1GWR A;  1KNU A;  3OKH A;  3G8O A;  1FD0 A;  4OZR U;  3RY9 A;  1T7R A;  4RMD A;  4ZN7 A;  2ZLA A;  3WJ5 A;  5IXK A;  4JL4 A;  5M96 A;  3TX7 B;  3FUR A;  5AAV B;  1ERR A;  1S9P A;  1XLS E;  1XLS A;  2ZL9 A;  3HO0 A;  3OLF A;  4K6I A;  2AO6 A;  5AZV A;  2PIN A;  1PDU A;  3GYT A;  5DZI A;  5KYA A;  2ZNO A;  3CTB A;  3OLS A;  1I38 A;  5E1C A;  4IVY A;  2Q6R A;  3OLL A;  3WJ4 A;  2PIO A;  2QAB A;  3G9E A;  2ZK4 A;  4QJR A;  3R8I A;  5LWP A;  4POJ A;  1RK3 A;  5I4V A;  3KWY A;  1NQ2 A;  3A40 X;  2F4B A;  3R5N A;  1S19 A;  2HWQ A;  4OK1 A;  1NQ0 A;  2B1V A;  3AUQ A;  3CS4 A;  3OMP A;  4LTW A;  4R06 A;  2ZK2 A;  4ZOM A;  2QZO A;  5G43 A;  2Q5P A;  3F7D A;  3SZ1 A;  2PIU A;  3W0J A;  4OC7 A;  3ZRA A;  4E4K A;  1SQN A;  5FQP A;  4IV2 A;  4PWL A;  5JY3 A;  2P1T A;  3OS8 A;  4OH5 A;  3V3Q A;  4BCR A;  2ZK6 A;  3WFF A;  5HJP A;  3VJI A;  3OSA A;  4OIU A;  1UPV A;  5KRI A;  5LGA A;  4FN9 A;  1Z5X E;  3L3X A;  3OS9 A;  3A9E A;  1YOK A;  3Q95 A;  3VSP A;  2JJ3 A;  3VT4 A;  5DZ3 A;  1HJ1 A;  1NRL A;  1OVL B;  3M7R A;  2ZNP A;  4M8H A;  2AA6 A;  4X1F A;  4OEA A;  3FEJ A;  1R6G A;  5DVS A;  1T74 A;  4JAZ A;  2YLP A;  5APK A;  3VHV A;  3L0L A;  3D5F A;  3KBA A;  4G1D A;  4PP5 A;  2R40 D;  5KR9 A;  5GT4 A;  4S14 A;  1R1K D;  2Q70 A;  2QNV A;  3VRW A;  2V7C A;  2Q3Y A;  3AFR A;  3U9Q A;  4L96 A;  4CI5 A;  5L7E A;  5DLR A;  4WPF A;  1PQC A;  5AZT A; 
#chains in the Genus database with same CATH homology
 3OZ0 A;  4PP6 A;  1U3Q A;  4MG6 A;  3D6D A;  5DX3 B;  1P8D A;  4MGB A;  4UDA A;  3KPZ A;  5KRA A;  3L3Z A;  3OZJ A;  2AX7 A;  2FVJ A;  3H52 A;  1N83 A;  5DIG A;  1Y0X X;  5L7G A;  5FQT A;  3FAL B;  5DU5 A;  1I37 A;  3ERT A;  3O1E A;  3D90 A;  1ZKY A;  3KMG A;  1OSV A;  2BAW A;  3W5Q A;  4A2J A;  3UUA A;  3E7C A;  2ZXM A;  3IPQ A;  4F9M A;  2VV4 B;  1R20 D;  1M7W A;  1XDK B;  5G5W A;  1T7F A;  2PKL A;  2XYW A;  5KRH A;  3OAP A;  4FNE A;  2POG A;  5DUE A;  2HFP A;  1NQ7 A;  1T79 A;  1M2Z A;  2Q7I A;  3CJW A;  4DM8 A;  1GS4 A;  1FCX A;  3DCU A;  3DZU D;  2QPY A;  2W8Y A;  2AX9 A;  2Q6S A;  5DXB B;  3UUC A;  3H0A A;  4WVD A;  3OSI A;  1UHL B;  2G0G A;  5G3J A;  3D57 A;  3W0A A;  4QM0 A;  4ZNH A;  4XTA A;  2ZK3 A;  5DWL A;  1T73 A;  3G0W A;  3B65 A;  3N00 A;  5DRJ A;  4POH A;  1NQ1 A;  2VV0 A;  4J5X C;  4OKW A;  5KRK A;  4MGA A;  4IWC A;  4TUZ A;  5KCT A;  4RME A;  2O9I A;  4B7W A;  2ZVT A;  4G2I A;  4OH6 A;  1YOW A;  3HLV A;  4XHD A;  2REW A;  5DZ0 A;  4MDD A;  5KRL A;  1NDE A;  2I4J A;  1ZDU A;  4IV4 A;  3WT5 A;  3DCT A;  4Q0A C;  2JFA B;  4PPP A;  1U9E A;  3L1B A;  2YJD A;  3V9Y A;  3GBK A;  5DID A;  4DQM A;  2XHS A;  4IA7 A;  2G44 A;  2YFE A;  3GWS X;  3BQD A;  2VV2 A;  1XNX A;  4MG7 A;  4CSJ A;  3GZ9 A;  2HAS A;  5KCC A;  5AK2 A;  4OEY A;  3W5P A;  4JGV A;  2QA8 A;  1X7E A;  3VHU A;  2E2R A;  2QE4 A;  1L2J A;  4KZI A;  4ZO1 X;  1MVC A;  3UU7 B;  5DRM A;  4DK8 A;  4R2U A;  5DVC A;  3SP6 A;  3WTQ A;  1A52 A;  2QA6 A;  3K6P A;  4K7A A;  3VRU A;  2YHD A;  4REF A;  3W5T A;  3IA6 A;  4RUP A;  2AAX A;  3UUD A;  3VN2 A;  2I4Z A;  1PQ6 A;  3HOD A;  3KDT A;  4PP3 A;  3VT7 A;  4YT1 A;  4XI3 A;  3ADX A;  4FGY A;  5AWK A;  2Q61 A;  1PRG A;  1SR7 A;  1X76 A;  2Z4B A;  3OKI A;  4MG9 A;  2QH6 A;  2B23 A;  1GWX A;  2Q59 A;  1XB7 A;  4PLE A;  4IQR A;  4LSJ A;  5DKG A;  1XNN A;  3A2J A;  3UVV B;  5DP0 A;  2PIP L;  3KMZ A;  1YUC A;  2B1Z A;  2OVH A;  2NV7 A;  1G50 A;  1K74 D;  1XJ7 A;  2R40 A;  4OZT E;  4PPS A;  4PXM A;  4NUF A;  1R1K A;  3T03 A;  1NAX A;  1FM6 D;  1R5K A;  5G44 A;  4DOS A;  4OZR E;  5C4U A;  4E2J A;  5DTV A;  1E3G A;  4RZE A;  2ABI A;  2Q6J A;  2QGW A;  4N8R A;  5C4S A;  3WT7 A;  5F9B A;  1T7T A;  2OVM A;  2AX8 A;  3VTC A;  5DWG A;  1XV9 B;  3VT9 A;  4PLD A;  3ADS A;  5HJS A;  1DKF A;  2GPU A;  1YYE A;  2AM9 A;  5KD9 A;  5L11 A;  3PBA A;  5DK9 A;  3B68 A;  4HEE X;  5AWJ A;  3JZC A;  4OAR A;  2AYR A;  5DWE A;  3E00 A;  4MGD A;  1YY4 A;  1XVP A;  2VSR A;  3CS8 A;  4OJ4 A;  4RUJ A;  3WGP A;  3R2A A;  1X78 A;  3ET3 A;  4OEZ A;  1VJB A;  3ADW A;  4DOR A;  4XLD A;  2HB7 A;  3DZY D;  1RDT A;  1I7G A;  2QW4 A;  1P93 A;  1ZH7 A;  4ZNW A;  1Z5X U;  1S0Z A;  4MGC A;  4PF3 A;  5DZH A;  3IXP D;  2R6Y A;  3B0Q A;  2HCD A;  3KFC A;  4XUH A;  2B50 A;  1M13 A;  3CDS A;  2FSZ A;  4J26 A;  1X7R A;  4L98 A;  5AAU A;  1K4W A;  2ACL B;  3O1D A;  2Q5G A;  4IUI A;  1R20 A;  1IE9 A;  3IPU A;  5DY8 A;  1FCY A;  2VV1 A;  2QA8 B;  2HWR A;  2P4Y A;  5C4T A;  2H77 A;  2HAM A;  5JI0 D;  5JJM A;  2HAR A;  2QXM A;  5CJ6 A;  1LBD A;  4N73 A;  5IZ0 A;  4DMA A;  1LV2 A;  2QR9 A;  4MG5 A;  1IE8 A;  1KKQ A;  4Y29 A;  5DIE A;  3P88 A;  4IA2 A;  4MG8 A;  2ZMJ A;  1EXA A;  2GL8 A;  3LMP A;  4TV1 A;  4NIE A;  5DYB A;  2PIR A;  2QXS A;  4ZNU A;  2R6W A;  3PLZ A;  3R8A A;  5HCV A;  2ZXN A;  4OJ9 A;  4S15 A;  1T5Z A;  1PCG A;  2P1U A;  4XT9 A;  5EC9 A;  2G0H A;  3B0W A;  3B3K A;  2PJL A;  3F5C A;  1Q4X A;  3DY6 A;  1FM9 D;  3MNO A;  3FC6 A;  4ONI A;  2YLO A;  4WLB A;  3A2H A;  5A86 A;  1WM0 X;  2Z4J A;  3L0E A;  1YIN A;  3CQV A;  3P0U A;  4IU7 A;  4OHA A;  4M8E A;  4J5X A;  2POB A;  2GPP A;  1SJ0 A;  1N4H A;  1SKX A;  3OGT A;  5DXM A;  2QZO B;  1L2I A;  2NW4 A;  2ZMI A;  3B0T A;  5ETH A;  3DT3 A;  1QKM A;  1PQ9 A;  3ET2 A;  1PK5 A;  1Z95 A;  2BJ4 A;  4OKB A;  3S9S A;  2ZMH A;  3G8I A;  4RMC A;  3V49 A;  5HYK A;  4IWF A;  3W0Y A;  2Q7K A;  2GPO A;  4YNK A;  1XP1 A;  3OMM A;  5HJP B;  3PCU A;  5DYD A;  4UDD A;  3HM1 A;  4ZN9 A;  2YJA B;  2AMB A;  4OFU A;  3A9E B;  3Q95 B;  1UOM A;  3PRG A;  3B67 A;  1KV6 A;  3VTB A;  3RUT A;  1N46 A;  4P6W A;  5C4O A;  3A3Z X;  3RLJ A;  5FQR A;  1YP0 A;  1UPW A;  5AAV A;  2OM9 A;  2ZAS A;  2OUZ A;  5HYR A;  2PIX A;  3RVF A;  1TFC A;  2Q5S A;  1U3S A;  2P54 A;  3KYT A;  5KRO A;  4IVW A;  3B66 A;  3VTD A;  5DI7 A;  2J7X A;  4N5G A;  4LNX A;  3HC5 A;  4RWV A;  4NQA B;  3OMK A;  5SYZ A;  1K74 A;  3L03 A;  4EMA A;  3OOF A;  1NUO A;  2EWP A;  5DXE A;  2GIU A;  1K7L A;  1FM6 A;  2AA2 A;  4REE A;  4J5W C;  3K22 A;  4IS8 A;  1FCZ A;  5DKE A;  2Q7L A;  5DV6 A;  5DXR A;  5KRF A;  4ZJR A;  4MGB B;  3WMH A;  2HVC A;  3X1I A;  5GIE A;  5G45 A;  5E19 A;  1ILG A;  2ZXZ A;  3ADV A;  3VT3 A;  3ZRB A;  2ATH A;  2AX6 A;  3ET1 A;  4APU A;  3R29 A;  4XAO A;  3X1H A;  5KCU A;  5H1E A;  5KCD A;  2Q1V A;  2QSE A;  2HC4 A;  2V0V A;  1YJE A;  2YAT A;  3A2I A;  2VV3 A;  4IA3 A;  3TY0 A;  2O4R A;  4OKX A;  2HBH A;  4E4Q A;  1ERE A;  3CLD A;  5EHJ A;  3UUA B;  1XZX X;  3W0I A;  3PO9 A;  4KZJ A;  3AUR A;  1OVL A;  4RZG A;  1Y9R A;  2YLQ A;  3DZY A;  1TXI A;  3GYU A;  4ZI1 A;  5KRC A;  2IHQ A;  4FHI A;  5B5B A;  4DM6 A;  3IXP A;  4FHH A;  1NHZ A;  2J14 A;  3VSO A;  2PNU A;  3DR1 A;  1G2N A;  2QMV A;  3OMO A;  1HG4 A;  3V3E A;  5KRM A;  4NB6 A;  3OSW A;  4G20 A;  4G1Y A;  3UP3 A;  4WHF A;  5KYJ A;  3B0R A;  2PIQ A;  2AMA A;  1T63 A;  4P6X A;  2IOG A;  5E0W A;  4MGA B;  2I4P A;  4TUZ B;  2XYX A;  1XQ3 A;  4PVU A;  5E0X A;  4Q50 A;  5DX3 A;  3ZQT A;  5DXK A;  5KRJ A;  1QKN A;  3OMQ A;  1S9Q A;  1NYX A;  3ADU A;  5DKS A;  5E15 A;  4QE8 A;  3OOK A;  5APJ A;  2HB8 A;  4UDC A;  2Q1H A;  2P7G A;  1X7B A;  3FAL A;  3ZR7 A;  3VT5 A;  4QK4 A;  3FXV A;  3NOA A;  2Q60 A;  2ZK5 A;  5APH A;  1XOW A;  4YPQ A;  1OSH A;  2FAI A;  3HVL A;  1BSX A;  3E94 A;  4G2H A;  1FM9 A;  4EM9 A;  4OKT A;  1YMT A;  3ERD A;  3WWR A;  2VV4 A;  4IA1 A;  3VI8 A;  4RZF A;  1XDK A;  2ZBS A;  4MG7 B;  1G5Y A;  4OJB A;  3B1M A;  5ICK A;  1RKH A;  3P89 A;  5K13 A;  3CDP A;  5DZ1 A;  5GIC A;  1XQC A;  3W5R A;  3TKC A;  3K8S A;  2I0G A;  2OAX A;  3K23 A;  3KDU A;  3PEQ A;  2P1V A;  3JZB A;  1ILH A;  5DMC A;  1ZEO A;  3AZ2 A;  4HLW A;  5DUH A;  2PRG A;  5KCE A;  1X7J A;  4LNW A;  5DXB A;  3DZU A;  4UDB A;  1E3K A;  5DV8 A;  1UHL A;  1MZN A;  4Q13 A;  2NXX E;  3GWX A;  3UUD B;  2NXX A;  2YLY A;  5EI1 A;  3NSQ A;  4OFR A;  4RE8 A;  5EJV A;  5G46 A;  4MG9 B;  2PIV A;  5EGV A;  2Q59 B;  1ZUC A;  4S0T A;  2VST A;  5DMF A;  5E14 A;  3WT6 A;  3FS1 A;  3GD2 A;  4WQP A;  2GTK A;  1EXX A;  2XYJ A;  4J24 A;  2ZKC A;  3AN3 A;  4JYI A;  5DWJ A;  5DXP A;  3OS8 C;  2Q7J A;  3W0H A;  5KCF A;  3R5M A;  5DWI A;  1FBY A;  3D24 A;  3RUU A;  1T76 A;  2JFA A;  3RLL A;  1ZGY A;  2J7Y A;  4G1Z A;  5EIT A;  1PZL A;  2ZY0 A;  4ZNT A;  5DL4 A;  1OT7 A;  1NAV A;  3MNP A;  3LBD A;  4K4J A;  3VRV A;  2A3I A;  5B41 A;  4A4W A;  1MV9 A;  4PRG A;  1DKF B;  2AWH A;  3SP9 A;  3E00 D;  3W0G A;  1YA3 A;  5G42 A;  3BEJ A;  3A78 A;  1ZAF A;  3QT0 A;  3W0C A;  5DXQ A;  2AB2 A;  1A28 A;  2AA7 A;  4MGD B;  4N1Y A;  1XVP B;  4R6S A;  5AVI A;  3ILZ A;  3UU7 A;  2OCF A;  1RDT D;  3FLI A;  1QKU A;  2JF9 A;  4WHG A;  2H79 A;  5AVL A;  2ZK1 A;  2Q8S A;  2AXA A;  2P15 A;  4QL8 A;  2QGT A;  2XKW A;  1GWQ A;  4J5W A;  3AX8 A;  3R8D A;  3VHW A;  3WFG A;  2J4A A;  2ZFX A;  4IW8 A;  3X36 A;  1XP6 A;  4IW6 A;  3V4A A;  4RFW A;  4ZO1 B;  2ZLC A;  1DB1 A;  4OIV A;  5L7H A;  4XUM A;  2VV1 B;  3VRT A;  4OLM A;  3TKM A;  3CWD A;  4OED A;  3P8X A;  4X1G A;  3UVV A;  3BC5 A;  5DUG A;  2PIT A;  2ZNN A;  5KCW A;  1T65 A;  3AUN A;  1XAP A;  5JJM B;  2GP7 A;  4ITF A;  5HZC A;  4A4V A;  3HC6 A;  4LBD A;  3VT6 A;  1RJK A;  1XPC A;  2GPV A;  4ZNV A;  3V9V A;  3MNE A;  3VT8 A;  4ZNS A;  3FEI A;  3VJS A;  4MG8 B;  4TV1 B;  3HQ5 A;  3L0J A;  5DSH A;  4RUO X;  3VJH A;  1XV9 A;  3B5R A;  4G21 A;  1XIU A;  1RKG A;  4YMQ A;  5GID A;  1XP9 A;  4O8F A;  4OIL A;  3ET0 A;  4S0S A;  5DKB A;  3KMR A;  2P7Z A;  2ZNQ A;  4DK7 A;  4NY9 A;  3IMY A;  3EYB A;  2G5O A;  3F5C B;  4ITE A;  5IAW A;  2LBD A;  3FC6 B;  3V9T A;  2PIW A;  5DV3 A;  1U3R A;  1YIM A;  3CS6 A;  3AZ3 A;  2AA5 A;  3VJT A;  1ZDT A;  2O4J A;  5E7V A;  4JYH A;  2NPA A;  3NSP A;  1S0X A;  4JYG A;  5FQS A;  4KZM A;  4OGH A;  4RAK A;  1I7I A;  4QE6 A;  5ACC A;  5DXG A;  1Y0S A;  2ACL A;  2ZK0 A;  5FQV A;  1QKT A;  2BJ4 B;  2QTU A;  3FUG A;  3UP0 A;  2GWX A;  3H0A D;  1T7M A;  3X31 A;  3AZ1 A;  2P7A A;  1H9U A;  3ADT A;  2OZ7 A;  3GN8 A;  1G1U A;  4ZJW A;  5AYG A;  2I0J A;  2IOK A;  3AN4 A;  4OZT U;  3HZF A;  5DVV A;  3IPS A;  4CI4 A;  1GWR A;  1KNU A;  3OKH A;  3G8O A;  1FD0 A;  4OZR U;  3RY9 A;  1T7R A;  4RMD A;  4ZN7 A;  2ZLA A;  3WJ5 A;  5IXK A;  4JL4 A;  5M96 A;  3TX7 B;  3FUR A;  5AAV B;  1ERR A;  1S9P A;  1XLS E;  1XLS A;  2ZL9 A;  3HO0 A;  3OLF A;  4K6I A;  2AO6 A;  5AZV A;  2PIN A;  1PDU A;  3GYT A;  5DZI A;  5KYA A;  2ZNO A;  3CTB A;  3OLS A;  1I38 A;  5E1C A;  4IVY A;  2Q6R A;  3OLL A;  3WJ4 A;  2PIO A;  2QAB A;  3G9E A;  2ZK4 A;  4QJR A;  3R8I A;  5LWP A;  4POJ A;  1RK3 A;  5I4V A;  3KWY A;  1NQ2 A;  3A40 X;  2F4B A;  3R5N A;  1S19 A;  2HWQ A;  4OK1 A;  1NQ0 A;  2B1V A;  3AUQ A;  3CS4 A;  3OMP A;  4LTW A;  4R06 A;  2ZK2 A;  4ZOM A;  2QZO A;  5G43 A;  2Q5P A;  3F7D A;  3SZ1 A;  2PIU A;  3W0J A;  4OC7 A;  3ZRA A;  4E4K A;  1SQN A;  5FQP A;  4IV2 A;  4PWL A;  5JY3 A;  2P1T A;  3OS8 A;  4OH5 A;  3V3Q A;  4BCR A;  2ZK6 A;  3WFF A;  5HJP A;  3VJI A;  3OSA A;  4OIU A;  1UPV A;  5KRI A;  5LGA A;  4FN9 A;  1Z5X E;  3L3X A;  3OS9 A;  3A9E A;  1YOK A;  3Q95 A;  3VSP A;  2JJ3 A;  3VT4 A;  5DZ3 A;  1HJ1 A;  1NRL A;  1OVL B;  3M7R A;  2ZNP A;  4M8H A;  2AA6 A;  4X1F A;  4OEA A;  3FEJ A;  1R6G A;  5DVS A;  1T74 A;  4JAZ A;  2YLP A;  5APK A;  3VHV A;  3L0L A;  3D5F A;  3KBA A;  4G1D A;  4PP5 A;  2R40 D;  5KR9 A;  5GT4 A;  4S14 A;  1R1K D;  2Q70 A;  2QNV A;  3VRW A;  2V7C A;  2Q3Y A;  3AFR A;  3U9Q A;  4L96 A;  4CI5 A;  5L7E A;  5DLR A;  4WPF A;  1PQC A;  5AZT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...