5KCCA

Crystal structure of the er-alpha ligand-binding domain (y537s) in complex with oxabicyclic heptene sulfonamide (obhs-n)
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
244
structure length
237
Chain Sequence
SLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLSDLLLEMLDAHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Estrogen receptor
publication title Full antagonism of the estrogen receptor without a prototypical ligand side chain.
pubmed doi rcsb
source organism Homo sapiens
total genus 81
structure length 237
sequence length 244
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 5kccA00
4XAOA 2OZ7A 3TY0A 2A3IA 1PQ9A 5KYJA 2REWA 1OSHA 3ADUA 3B0TA 5EHJA 1XNNA 4RFWA 5HJPB 4PF3A 2GL8A 3F5CA 3WMHA 5G42A 1A28A 2VV1B 1ZAFA 5JI0D 3VRVA 2QTUA 3K8SA 3OMOA 5IXKA 1IE8A 1SKXA 4E2JA 2ZVTA 1PQ6A 1R5KA 4IQRA 1KV6A 2ZKCA 3A2HA 3OMQA 2PKLA 3GWSX 1N83A 1I7GA 4MGAA 1K74D 5DXBB 5DXQA 3AURA 5DY8A 2OUZA 3W5RA 3AZ2A 3KMGA 3D6DA 4Y29A 2Q5SA 2G5OA 5E0XA 5KRCA 3AN4A 3W0HA 3V9YA 2QABA 4POJA 1X76A 1PRGA 5KCUA 5C4TA 5GIEA 2BJ4B 3ERTA 2PIQA 4WPFA 1RK3A 2P7GA 2Q59A 3E00D 3PCUA 4MG8B 5AWJA 5C4UA 1UPVA 4OKTA 1I37A 3VSOA 5I4VA 5KCWA 2HCDA 4JYGA 2IHQA 3GD2A 4XHDA 4A4WA 2AMBA 3B3KA 3P89A 3GYUA 3R5MA 3HVLA 4ZO1X 3M7RA 4J5XC 5H1EA 3D90A 1UPWA 1KKQA 1XVPA 2J7XA 2AA2A 1XP6A 3B0RA 4OZTU 2XYJA 1L2IA 2Q7KA 3WT7A 3BQDA 4LBDA 2P15A 4DMAA 2R40D 4DM8A 1OSVA 2ZK2A 1XDKB 1YMTA 1BSXA 2ZNPA 3GBKA 4KZMA 4OJBA 5L7EA 4PLEA 5FQRA 2B50A 3MNEA 4MG7A 4S0TA 3KPZA 4HEEX 4M8HA 3WGPA 2NXXE 3H0AD 5APHA 5DI7A 1OVLA 5DXRA 2GP7A 3S9SA 1G2NA 1S9PA 4J5XA 3RLJA 1XB7A 3H52A 2ZK3A 3CLDA 2Q60A 2E2RA 4IA2A 5GT4A 4IA1A 3VRTA 5DX3A 3W0AA 2Q5GA 2XYXA 3ADXA 3VRWA 4OLMA 2AX8A 3ADTA 4N8RA 4JGVA 3VN2A 3OOKA 2YFEA 1PQCA 2YJDA 3VT9A 2ZXMA 3CDPA 2B1ZA 4J24A 4P6WA 2HB7A 5DZ3A 4OARA 2AM9A 5AYGA 3RUTA 4APUA 2YLQA 2XHSA 4CI5A 1RKGA 4ZNHA 2HWRA 5JJMA 4KZJA 3DCTA 3OS9A 4S15A 1X7EA 3HO0A 3UVVB 5HJPA 1S0XA 3W0IA 4OZRE 3BC5A 4PP3A 2J4AA 4TV1B 5E15A 2JJ3A 2VV1A 3W5TA 3CQVA 2AX6A 4YT1A 5KR9A 2Q5PA 1U3RA 3ILZA 4IV4A 4OZRU 4ITFA 5DMFA 3K23A 1Z5XE 5DUEA 3AZ1A 2ZBSA 4OIUA 4QM0A 5E0WA 1Z5XU 4WHGA 3ZQTA 1TFCA 5KCDA 3ERDA 5F9BA 1VJBA 1M13A 4MG5A 3AZ3A 2ZMJA 5DWEA 1N4HA 2PIOA 5AVLA 4G21A 1FM6D 4MGDB 1NRLA 2AA7A 4OEAA 4DORA 5DXBA 1XAPA 1PCGA 2P7AA 2ZLCA 3VSPA 1Y0SA 4UDAA 1N46A 1NHZA 5KCTA 2Q6JA 3L03A 4JYIA 4S0SA 3UP0A 3FXVA 3W5QA 4Q13A 4MGCA 3OMMA 2BJ4A 2AO6A 2O4JA 4G1ZA 5DZ0A 4UDBA 3A78A 1YJEA 1K74A 2GWXA 3KYTA 1Y0XX 1T7FA 5IAWA 3WFGA 2YLOA 4MG8A 4FNEA 3R8IA 2QA8B 2AA5A 4MG6A 2NV7A 3VT3A 5FQTA 2I0GA 3AX8A 3RY9A 5DIGA 2R6YA 1FM9D 3B66A 3PRGA 4POHA 4RZEA 1E3GA 5HYRA 2OAXA 1XPCA 1NDEA 5G43A 1X7JA 3E00A 2XKWA 3NOAA 3VTBA 2P1UA 2VV4B 4PVUA 3F7DA 3B5RA 2QXSA 1S0ZA 1UHLB 4XT9A 2AMAA 1XNXA 2HVCA 5DKSA 3JZBA 1IE9A 4OKWA 2LBDA 4NY9A 2VV0A 1XDKA 2HAMA 2PJLA 3FEJA 5DIDA 3Q95B 3FS1A 4REEA 2HWQA 3OZJA 1MVCA 1NUOA 4PRGA 5C4SA 3VT6A 3VT5A 2W8YA 4ZJWA 3TKMA 3R29A 1QKUA 2I4ZA 2R40A 4G2HA 3G9EA 3OZ0A 4K7AA 4OK1A 2QSEA 3ET0A 4Q50A 5K13A 2VSRA 3DT3A 5KCCA 3OKIA 3PLZA 4X1FA 1NQ7A 3L3XA 3E7CA 4JL4A 5G3JA 3H0AA 5KCFA 3HLVA 3PBAA 3NSQA 3CS4A 4EM9A 3CDSA 5DTVA 3V3EA 2JFAB 4OFRA 4WLBA 1RDTD 1U3QA 1YIMA 4ZN7A 4ZNTA 3G8IA 2ZLAA 1ZKYA 3L0LA 3VTCA 1ILHA 3L0JA 4ZJRA 2ZK5A 5E19A 1S9QA 3BEJA 5EC9A 4ZOMA 5CJ6A 3U9QA 3VJIA 4NUFA 4IW8A 4ZNWA 3VHWA 5DXEA 4CSJA 2GPOA 3B65A 4KZIA 5EI1A 3UUCA 1KNUA 1T7TA 2VV3A 3IA6A 5KYAA 1T7MA 2P7ZA 2Q1HA 3RUUA 4OZTE 3GZ9A 4RZGA 2FAIA 3V9VA 3IPSA 5HYKA 3B0WA 5FQSA 5FQVA 3UVVA 3TKCA 2YJAB 3ZRAA 2HB8A 5C4OA 4TV1A 3A9EB 2OVMA 5DZHA 2VV2A 5JJMB 1LV2A 3HC5A 4P6XA 1FCXA 1R20D 3NSPA 3K22A 1EXXA 5LWPA 5A86A 2PITA 4N1YA 5G46A 1U3SA 1OT7A 4L98A 3AN3A 2PIUA 1YINA 3WJ5A 2AX9A 1PDUA 5E7VA 1XOWA 4MGDA 1P8DA 5KRIA 1R6GA 3L3ZA 3DR1A 2F4BA 1ZH7A 1SQNA 2GTKA 4UDDA 4ZN9A 4N5GA 4OEZA 4DM6A 1T76A 2PINA 2AAXA 4DK8A 5HCVA 1FM6A 5DZIA 4HLWA 4FHHA 2BAWA 4S14A 5EGVA 1NAXA 3T03A 3WT6A 2P54A 1XV9B 3G8OA 3KDUA 3CS6A 4OGHA 5HJSA 1P93A 1TXIA 2IOKA 2J14A 2QA8A 2ZNNA 4JYHA 5DXGA 3W0GA 4ZI1A 2Z4BA 3W0CA 5DWJA 3WTQA 3W0YA 2QE4A 3EYBA 3FLIA 5KD9A 2HARA 3P88A 4OHAA 4UDCA 3A40X 4RMEA 3R8AA 2GPPA 2VV4A 3IXPD 1R1KD 2GPUA 2P4YA 4F9MA 3OS8C 3GWXA 2PIRA 3KBAA 3R5NA 1FM9A 1UHLA 5DKGA 2ZFXA 1DB1A 5DSHA 2PRGA 4X1GA 3UUAB 4G1DA 4REFA 5AK2A 5AAUA 1G50A 3WWRA 1RKHA 4ZNUA 1YOWA 3Q95A 4RMDA 4YPQA 5APKA 4RUPA 5AVIA 2GPVA 3CWDA 2OM9A 1FCZA 2QXMA 5DUHA 5DXKA 3UU7B 3MNPA 3E94A 3A2JA 2ZASA 3ADSA 3HODA 4A2JA 2IOGA 5DV6A 3FEIA 3B68A 3FURA 4R2UA 2H79A 3OS8A 5M96A 1ZEOA 2HFPA 2ZK4A 2YATA 4LSJA 4RWVA 3G0WA 2ABIA 2JFAA 2JF9A 3N00A 1YP0A 4QK4A 1ZGYA 2Q7LA 2V7CA 4YNKA 1QKMA 3VHUA 1ILGA 5L11A 2NW4A 3CS8A 4LTWA 5IZ0A 1E3KA 1DKFB 2Q8SA 4IVWA 4XLDA 2YHDA 3O1EA 3VT8A 2P1TA 5DYDA 5G45A 3VTDA 4PPSA 2QNVA 4YMQA 2ACLB 3KMZA 1GWQA 3OLSA 4MGBB 5FQPA 5LGAA 5ETHA 3ET3A 2Q7IA 3PO9A 2QR9A 3A2IA 3VJTA 1MV9A 1XLSA 5ACCA 1T5ZA 2PIWA 5DRMA 1G1UA 3GYTA 3GN8A 1M7WA 4IVYA 3A9EA 4E4KA 1PZLA 4BCRA 2ZNQA 2ZXZA 1A52A 1ZDTA 3OMKA 4XTAA 3X1HA 3X36A 2ZL9A 2O4RA 3HQ5A 4J5WC 4OKBA 3X31A 4OC7A 1T7RA 4G2IA 2Q6SA 3AFRA 4IS8A 1ERRA 2AYRA 4K6IA 5AAVB 3WFFA 3OKHA 5DIEA 2POBA 2Q3YA 2B1VA 1FD0A 3KMRA 4ZNSA 4PLDA 3OLFA 5AWKA 5AZVA 2POGA 2QPYA 5DYBA 4QL8A 5E14A 3DZYD 2G0HA 4DQMA 1ZDUA 5KRMA 2FSZA 5DRJA 5DWGA 2ZMIA 2QZOB 4OIVA 2XYWA 5DKEA 3WJ4A 4EMAA 4NIEA 3B0QA 3RLLA 2AXAA 4O8FA 1XV9A 4J5WA 5DVSA 3HM1A 4OJ4A 3DZUD 4IUIA 5DXMA 2QA6A 4DK7A 3OLLA 4B7WA 4IW6A 2PIVA 3TX7B 4LNWA 1YOKA 3WT5A 2I4JA 3ADWA 5DKBA 3VJSA 4DOSA 5L7GA 5KRLA 4XI3A 4WHFA 1NQ1A 1XQ3A 3JZCA 4ITEA 5DLRA 3V4AA 4PPPA 5DXPA 4IU7A 1UOMA 5EJVA 2R6WA 5B41A 2H77A 2PIPL 4XUMA 4RUJA 3UUAA 1G5YA 3V49A 1YY4A 3IXPA 4OH5A 1R1KA 2QGWA 4NB6A 3RVFA 3FC6B 3A3ZX 3X1IA 1YYEA 4OEYA 3FUGA 1YUCA 3UU7A 2ATHA 4ZO1B 1WM0X 1T65A 4E4QA 4MG9B 4IV2A 5DWLA 2AB2A 1HG4A 4TUZB 1X78A 5DMCA 1K7LA 5DZ1A 3LBDA 3KWYA 2OCFA 2PIXA 2ZMHA 3CTBA 1XJ7A 3IMYA 1ZUCA 1Q4XA 4IA7A 4PP6A 3VT4A 5KRKA 2AWHA 3OAPA 3LMPA 3OOFA 2Q7JA 1T73A 1X7BA 3UUDB 2ZY0A 5DUGA 4JAZA 1DKFA 1K4WA 3B1MA 3FALB 5JY3A 1X7RA 5B5BA 4RZFA 1YA3A 4OKXA 3IPQA 4QE6A 5KRJA 2ACLA 3ET1A 4OJ9A 1SR7A 5GIDA 3R8DA 1GS4A 3F5CB 4MGBA 5ICKA 1EXAA 5DVVA 2G44A 3AUNA 4R6SA 2ZXNA 4RAKA 5EITA 2OVHA 5KCEA 4ZNVA 1LBDA 3K6PA 2ZNOA 1PK5A 4FGYA 3HC6A 3OSAA 3V9TA 1NQ0A 3D5FA 5GICA 2Z4JA 4IWCA 1GWXA 4CI4A 2HBHA 1M2ZA 1T79A 2Q70A 3PEQA 3ZR7A 4MGAB 5APJA 2HC4A 3R2AA 2G0GA 4RMCA 5L7HA 2VSTA 4OILA 5AZTA 3CJWA 4QJRA 4A4VA 5G5WA 2B23A 3UP3A 5DU5A 5AAVA 4NQAB 4FN9A 2YLPA 1XLSE 1MZNA 4Q0AC 4M8EA 3DY6A 2Q59B 4R06A 2HASA 2I0JA 3AUQA 4QE8A 5DP0A 3VI8A 3ZRBA 2AA6A 2QMVA 2ZK0A 1XQCA 1QKNA 1S19A 5DV8A 5DK9A 1XP9A 2QGTA 3HZFA 2Q61A 1XIUA 2QZOA 1L2JA 4FHIA 1T74A 5SYZA 3IPUA 2NXXA 3ADVA 5KROA 4G1YA 3DZYA 4LNXA 1NAVA 5HZCA 1XVPB 4PP5A 3OMPA 3D57A 3OSIA 3P0UA 3VRUA 3W5PA 2NPAA 4RE8A 2QW4A 3O1DA 3DCUA 4N73A 3SP9A 3L0EA 4PXMA 3OGTA 3SZ1A 1H9UA 2QH6A 5DWIA 1RDTA 4K4JA 4WVDA 5G44A 1FCYA 5KRFA 3DZUA 1NQ2A 3D24A 3W0JA 2I4PA 4IWFA 3MNOA 4MG7B 5KRHA 1GWRA 2GIUA 1NYXA 1OVLB 4OFUA 4ONIA 3SP6A 4J26A 2V0VA 1T63A 1SJ0A 3VT7A 3P8XA 1Z95A 1HJ1A 3FC6A 1I38A 3V3QA 4PWLA 2AX7A 5DV3A 4IA3A 2ZK6A 2YLYA 4G20A 3ET2A 5KRAA 4OH6A 1FBYA 4L96A 1QKTA 1U9EA 2O9IA 2EWPA 5DX3B 3VJHA 4XUHA 2Q1VA 1RJKA 4MG9A 3OSWA 4WQPA 2J7YA 4TUZA 5DVCA 3B67A 3L1BA 3VHVA 1R20A 3KFCA 1XZXX 1XP1A 1Y9RA 3QT0A 2P1VA 2Q6RA 4OEDA 1EREA 2FVJA 2PNUA 3UUDA 2ZK1A 5DL4A 1I7IA 3KDTA 5E1CA 4RUOX 3FALA 4MDDA
chains in the Genus database with same CATH superfamily
4XAOA 2OZ7A 3TY0A 2A3IA 1PQ9A 5KYJA 2REWA 1OSHA 3ADUA 3B0TA 5EHJA 1XNNA 4RFWA 5HJPB 4PF3A 2GL8A 3F5CA 3WMHA 5G42A 1A28A 2VV1B 1ZAFA 5JI0D 3VRVA 2QTUA 3K8SA 3OMOA 5IXKA 1IE8A 1SKXA 4E2JA 2ZVTA 1PQ6A 1R5KA 4IQRA 1KV6A 2ZKCA 3A2HA 3OMQA 2PKLA 3GWSX 1N83A 1I7GA 4MGAA 1K74D 5DXBB 5DXQA 3AURA 5DY8A 2OUZA 3W5RA 3AZ2A 3KMGA 3D6DA 4Y29A 2Q5SA 2G5OA 5E0XA 5KRCA 3AN4A 3W0HA 3V9YA 2QABA 4POJA 1X76A 1PRGA 5KCUA 5C4TA 5GIEA 2BJ4B 3ERTA 2PIQA 4WPFA 1RK3A 2P7GA 2Q59A 3E00D 3PCUA 4MG8B 5AWJA 5C4UA 1UPVA 4OKTA 1I37A 3VSOA 5I4VA 5KCWA 2HCDA 4JYGA 2IHQA 3GD2A 4XHDA 4A4WA 2AMBA 3B3KA 3P89A 3GYUA 3R5MA 3HVLA 4ZO1X 3M7RA 4J5XC 5H1EA 3D90A 1UPWA 1KKQA 1XVPA 2J7XA 2AA2A 1XP6A 3B0RA 4OZTU 2XYJA 1L2IA 2Q7KA 3WT7A 3BQDA 4LBDA 2P15A 4DMAA 2R40D 4DM8A 1OSVA 2ZK2A 1XDKB 1YMTA 1BSXA 2ZNPA 3GBKA 4KZMA 4OJBA 5L7EA 4PLEA 5FQRA 2B50A 3MNEA 4MG7A 4S0TA 3KPZA 4HEEX 4M8HA 3WGPA 2NXXE 3H0AD 5APHA 5DI7A 1OVLA 5DXRA 2GP7A 3S9SA 1G2NA 1S9PA 4J5XA 3RLJA 1XB7A 3H52A 2ZK3A 3CLDA 2Q60A 2E2RA 4IA2A 5GT4A 4IA1A 3VRTA 5DX3A 3W0AA 2Q5GA 2XYXA 3ADXA 3VRWA 4OLMA 2AX8A 3ADTA 4N8RA 4JGVA 3VN2A 3OOKA 2YFEA 1PQCA 2YJDA 3VT9A 2ZXMA 3CDPA 2B1ZA 4J24A 4P6WA 2HB7A 5DZ3A 4OARA 2AM9A 5AYGA 3RUTA 4APUA 2YLQA 2XHSA 4CI5A 1RKGA 4ZNHA 2HWRA 5JJMA 4KZJA 3DCTA 3OS9A 4S15A 1X7EA 3HO0A 3UVVB 5HJPA 1S0XA 3W0IA 4OZRE 3BC5A 4PP3A 2J4AA 4TV1B 5E15A 2JJ3A 2VV1A 3W5TA 3CQVA 2AX6A 4YT1A 5KR9A 2Q5PA 1U3RA 3ILZA 4IV4A 4OZRU 4ITFA 5DMFA 3K23A 1Z5XE 5DUEA 3AZ1A 2ZBSA 4OIUA 4QM0A 5E0WA 1Z5XU 4WHGA 3ZQTA 1TFCA 5KCDA 3ERDA 5F9BA 1VJBA 1M13A 4MG5A 3AZ3A 2ZMJA 5DWEA 1N4HA 2PIOA 5AVLA 4G21A 1FM6D 4MGDB 1NRLA 2AA7A 4OEAA 4DORA 5DXBA 1XAPA 1PCGA 2P7AA 2ZLCA 3VSPA 1Y0SA 4UDAA 1N46A 1NHZA 5KCTA 2Q6JA 3L03A 4JYIA 4S0SA 3UP0A 3FXVA 3W5QA 4Q13A 4MGCA 3OMMA 2BJ4A 2AO6A 2O4JA 4G1ZA 5DZ0A 4UDBA 3A78A 1YJEA 1K74A 2GWXA 3KYTA 1Y0XX 1T7FA 5IAWA 3WFGA 2YLOA 4MG8A 4FNEA 3R8IA 2QA8B 2AA5A 4MG6A 2NV7A 3VT3A 5FQTA 2I0GA 3AX8A 3RY9A 5DIGA 2R6YA 1FM9D 3B66A 3PRGA 4POHA 4RZEA 1E3GA 5HYRA 2OAXA 1XPCA 1NDEA 5G43A 1X7JA 3E00A 2XKWA 3NOAA 3VTBA 2P1UA 2VV4B 4PVUA 3F7DA 3B5RA 2QXSA 1S0ZA 1UHLB 4XT9A 2AMAA 1XNXA 2HVCA 5DKSA 3JZBA 1IE9A 4OKWA 2LBDA 4NY9A 2VV0A 1XDKA 2HAMA 2PJLA 3FEJA 5DIDA 3Q95B 3FS1A 4REEA 2HWQA 3OZJA 1MVCA 1NUOA 4PRGA 5C4SA 3VT6A 3VT5A 2W8YA 4ZJWA 3TKMA 3R29A 1QKUA 2I4ZA 2R40A 4G2HA 3G9EA 3OZ0A 4K7AA 4OK1A 2QSEA 3ET0A 4Q50A 5K13A 2VSRA 3DT3A 5KCCA 3OKIA 3PLZA 4X1FA 1NQ7A 3L3XA 3E7CA 4JL4A 5G3JA 3H0AA 5KCFA 3HLVA 3PBAA 3NSQA 3CS4A 4EM9A 3CDSA 5DTVA 3V3EA 2JFAB 4OFRA 4WLBA 1RDTD 1U3QA 1YIMA 4ZN7A 4ZNTA 3G8IA 2ZLAA 1ZKYA 3L0LA 3VTCA 1ILHA 3L0JA 4ZJRA 2ZK5A 5E19A 1S9QA 3BEJA 5EC9A 4ZOMA 5CJ6A 3U9QA 3VJIA 4NUFA 4IW8A 4ZNWA 3VHWA 5DXEA 4CSJA 2GPOA 3B65A 4KZIA 5EI1A 3UUCA 1KNUA 1T7TA 2VV3A 3IA6A 5KYAA 1T7MA 2P7ZA 2Q1HA 3RUUA 4OZTE 3GZ9A 4RZGA 2FAIA 3V9VA 3IPSA 5HYKA 3B0WA 5FQSA 5FQVA 3UVVA 3TKCA 2YJAB 3ZRAA 2HB8A 5C4OA 4TV1A 3A9EB 2OVMA 5DZHA 2VV2A 5JJMB 1LV2A 3HC5A 4P6XA 1FCXA 1R20D 3NSPA 3K22A 1EXXA 5LWPA 5A86A 2PITA 4N1YA 5G46A 1U3SA 1OT7A 4L98A 3AN3A 2PIUA 1YINA 3WJ5A 2AX9A 1PDUA 5E7VA 1XOWA 4MGDA 1P8DA 5KRIA 1R6GA 3L3ZA 3DR1A 2F4BA 1ZH7A 1SQNA 2GTKA 4UDDA 4ZN9A 4N5GA 4OEZA 4DM6A 1T76A 2PINA 2AAXA 4DK8A 5HCVA 1FM6A 5DZIA 4HLWA 4FHHA 2BAWA 4S14A 5EGVA 1NAXA 3T03A 3WT6A 2P54A 1XV9B 3G8OA 3KDUA 3CS6A 4OGHA 5HJSA 1P93A 1TXIA 2IOKA 2J14A 2QA8A 2ZNNA 4JYHA 5DXGA 3W0GA 4ZI1A 2Z4BA 3W0CA 5DWJA 3WTQA 3W0YA 2QE4A 3EYBA 3FLIA 5KD9A 2HARA 3P88A 4OHAA 4UDCA 3A40X 4RMEA 3R8AA 2GPPA 2VV4A 3IXPD 1R1KD 2GPUA 2P4YA 4F9MA 3OS8C 3GWXA 2PIRA 3KBAA 3R5NA 1FM9A 1UHLA 5DKGA 2ZFXA 1DB1A 5DSHA 2PRGA 4X1GA 3UUAB 4G1DA 4REFA 5AK2A 5AAUA 1G50A 3WWRA 1RKHA 4ZNUA 1YOWA 3Q95A 4RMDA 4YPQA 5APKA 4RUPA 5AVIA 2GPVA 3CWDA 2OM9A 1FCZA 2QXMA 5DUHA 5DXKA 3UU7B 3MNPA 3E94A 3A2JA 2ZASA 3ADSA 3HODA 4A2JA 2IOGA 5DV6A 3FEIA 3B68A 3FURA 4R2UA 2H79A 3OS8A 5M96A 1ZEOA 2HFPA 2ZK4A 2YATA 4LSJA 4RWVA 3G0WA 2ABIA 2JFAA 2JF9A 3N00A 1YP0A 4QK4A 1ZGYA 2Q7LA 2V7CA 4YNKA 1QKMA 3VHUA 1ILGA 5L11A 2NW4A 3CS8A 4LTWA 5IZ0A 1E3KA 1DKFB 2Q8SA 4IVWA 4XLDA 2YHDA 3O1EA 3VT8A 2P1TA 5DYDA 5G45A 3VTDA 4PPSA 2QNVA 4YMQA 2ACLB 3KMZA 1GWQA 3OLSA 4MGBB 5FQPA 5LGAA 5ETHA 3ET3A 2Q7IA 3PO9A 2QR9A 3A2IA 3VJTA 1MV9A 1XLSA 5ACCA 1T5ZA 2PIWA 5DRMA 1G1UA 3GYTA 3GN8A 1M7WA 4IVYA 3A9EA 4E4KA 1PZLA 4BCRA 2ZNQA 2ZXZA 1A52A 1ZDTA 3OMKA 4XTAA 3X1HA 3X36A 2ZL9A 2O4RA 3HQ5A 4J5WC 4OKBA 3X31A 4OC7A 1T7RA 4G2IA 2Q6SA 3AFRA 4IS8A 1ERRA 2AYRA 4K6IA 5AAVB 3WFFA 3OKHA 5DIEA 2POBA 2Q3YA 2B1VA 1FD0A 3KMRA 4ZNSA 4PLDA 3OLFA 5AWKA 5AZVA 2POGA 2QPYA 5DYBA 4QL8A 5E14A 3DZYD 2G0HA 4DQMA 1ZDUA 5KRMA 2FSZA 5DRJA 5DWGA 2ZMIA 2QZOB 4OIVA 2XYWA 5DKEA 3WJ4A 4EMAA 4NIEA 3B0QA 3RLLA 2AXAA 4O8FA 1XV9A 4J5WA 5DVSA 3HM1A 4OJ4A 3DZUD 4IUIA 5DXMA 2QA6A 4DK7A 3OLLA 4B7WA 4IW6A 2PIVA 3TX7B 4LNWA 1YOKA 3WT5A 2I4JA 3ADWA 5DKBA 3VJSA 4DOSA 5L7GA 5KRLA 4XI3A 4WHFA 1NQ1A 1XQ3A 3JZCA 4ITEA 5DLRA 3V4AA 4PPPA 5DXPA 4IU7A 1UOMA 5EJVA 2R6WA 5B41A 2H77A 2PIPL 4XUMA 4RUJA 3UUAA 1G5YA 3V49A 1YY4A 3IXPA 4OH5A 1R1KA 2QGWA 4NB6A 3RVFA 3FC6B 3A3ZX 3X1IA 1YYEA 4OEYA 3FUGA 1YUCA 3UU7A 2ATHA 4ZO1B 1WM0X 1T65A 4E4QA 4MG9B 4IV2A 5DWLA 2AB2A 1HG4A 4TUZB 1X78A 5DMCA 1K7LA 5DZ1A 3LBDA 3KWYA 2OCFA 2PIXA 2ZMHA 3CTBA 1XJ7A 3IMYA 1ZUCA 1Q4XA 4IA7A 4PP6A 3VT4A 5KRKA 2AWHA 3OAPA 3LMPA 3OOFA 2Q7JA 1T73A 1X7BA 3UUDB 2ZY0A 5DUGA 4JAZA 1DKFA 1K4WA 3B1MA 3FALB 5JY3A 1X7RA 5B5BA 4RZFA 1YA3A 4OKXA 3IPQA 4QE6A 5KRJA 2ACLA 3ET1A 4OJ9A 1SR7A 5GIDA 3R8DA 1GS4A 3F5CB 4MGBA 5ICKA 1EXAA 5DVVA 2G44A 3AUNA 4R6SA 2ZXNA 4RAKA 5EITA 2OVHA 5KCEA 4ZNVA 1LBDA 3K6PA 2ZNOA 1PK5A 4FGYA 3HC6A 3OSAA 3V9TA 1NQ0A 3D5FA 5GICA 2Z4JA 4IWCA 1GWXA 4CI4A 2HBHA 1M2ZA 1T79A 2Q70A 3PEQA 3ZR7A 4MGAB 5APJA 2HC4A 3R2AA 2G0GA 4RMCA 5L7HA 2VSTA 4OILA 5AZTA 3CJWA 4QJRA 4A4VA 5G5WA 2B23A 3UP3A 5DU5A 5AAVA 4NQAB 4FN9A 2YLPA 1XLSE 1MZNA 4Q0AC 4M8EA 3DY6A 2Q59B 4R06A 2HASA 2I0JA 3AUQA 4QE8A 5DP0A 3VI8A 3ZRBA 2AA6A 2QMVA 2ZK0A 1XQCA 1QKNA 1S19A 5DV8A 5DK9A 1XP9A 2QGTA 3HZFA 2Q61A 1XIUA 2QZOA 1L2JA 4FHIA 1T74A 5SYZA 3IPUA 2NXXA 3ADVA 5KROA 4G1YA 3DZYA 4LNXA 1NAVA 5HZCA 1XVPB 4PP5A 3OMPA 3D57A 3OSIA 3P0UA 3VRUA 3W5PA 2NPAA 4RE8A 2QW4A 3O1DA 3DCUA 4N73A 3SP9A 3L0EA 4PXMA 3OGTA 3SZ1A 1H9UA 2QH6A 5DWIA 1RDTA 4K4JA 4WVDA 5G44A 1FCYA 5KRFA 3DZUA 1NQ2A 3D24A 3W0JA 2I4PA 4IWFA 3MNOA 4MG7B 5KRHA 1GWRA 2GIUA 1NYXA 1OVLB 4OFUA 4ONIA 3SP6A 4J26A 2V0VA 1T63A 1SJ0A 3VT7A 3P8XA 1Z95A 1HJ1A 3FC6A 1I38A 3V3QA 4PWLA 2AX7A 5DV3A 4IA3A 2ZK6A 2YLYA 4G20A 3ET2A 5KRAA 4OH6A 1FBYA 4L96A 1QKTA 1U9EA 2O9IA 2EWPA 5DX3B 3VJHA 4XUHA 2Q1VA 1RJKA 4MG9A 3OSWA 4WQPA 2J7YA 4TUZA 5DVCA 3B67A 3L1BA 3VHVA 1R20A 3KFCA 1XZXX 1XP1A 1Y9RA 3QT0A 2P1VA 2Q6RA 4OEDA 1EREA 2FVJA 2PNUA 3UUDA 2ZK1A 5DL4A 1I7IA 3KDTA 5E1CA 4RUOX 3FALA 4MDDA
chains in the Genus database with same CATH topology
4XAOA 2OZ7A 3TY0A 2A3IA 1PQ9A 5KYJA 2REWA 1OSHA 3ADUA 3B0TA 5EHJA 1XNNA 4RFWA 5HJPB 4PF3A 2GL8A 3F5CA 3WMHA 5G42A 1A28A 2VV1B 1ZAFA 5JI0D 3VRVA 2QTUA 3K8SA 3OMOA 5IXKA 1IE8A 1SKXA 4E2JA 2ZVTA 1PQ6A 1R5KA 4IQRA 1KV6A 2ZKCA 3A2HA 3OMQA 2PKLA 3GWSX 1N83A 1I7GA 4MGAA 1K74D 5DXBB 5DXQA 3AURA 5DY8A 2OUZA 3W5RA 3AZ2A 3KMGA 3D6DA 4Y29A 2Q5SA 2G5OA 5E0XA 5KRCA 3AN4A 3W0HA 3V9YA 2QABA 4POJA 1X76A 1PRGA 5KCUA 5C4TA 5GIEA 2BJ4B 3ERTA 2PIQA 4WPFA 1RK3A 2P7GA 2Q59A 3E00D 3PCUA 4MG8B 5AWJA 5C4UA 1UPVA 4OKTA 1I37A 3VSOA 5I4VA 5KCWA 2HCDA 4JYGA 2IHQA 3GD2A 4XHDA 4A4WA 2AMBA 3B3KA 3P89A 3GYUA 3R5MA 3HVLA 4ZO1X 3M7RA 4J5XC 5H1EA 3D90A 1UPWA 1KKQA 1XVPA 2J7XA 2AA2A 1XP6A 3B0RA 4OZTU 2XYJA 1L2IA 2Q7KA 3WT7A 3BQDA 4LBDA 2P15A 4DMAA 2R40D 4DM8A 1OSVA 2ZK2A 1XDKB 1YMTA 1BSXA 2ZNPA 3GBKA 4KZMA 4OJBA 5L7EA 4PLEA 5FQRA 2B50A 3MNEA 4MG7A 4S0TA 3KPZA 4HEEX 4M8HA 3WGPA 2NXXE 3H0AD 5APHA 5DI7A 1OVLA 5DXRA 2GP7A 3S9SA 1G2NA 1S9PA 4J5XA 3RLJA 1XB7A 3H52A 2ZK3A 3CLDA 2Q60A 2E2RA 4IA2A 5GT4A 4IA1A 3VRTA 5DX3A 3W0AA 2Q5GA 2XYXA 3ADXA 3VRWA 4OLMA 2AX8A 3ADTA 4N8RA 4JGVA 3VN2A 3OOKA 2YFEA 1PQCA 2YJDA 3VT9A 2ZXMA 3CDPA 2B1ZA 4J24A 4P6WA 2HB7A 5DZ3A 4OARA 2AM9A 5AYGA 3RUTA 4APUA 2YLQA 2XHSA 4CI5A 1RKGA 4ZNHA 2HWRA 5JJMA 4KZJA 3DCTA 3OS9A 4S15A 1X7EA 3HO0A 3UVVB 5HJPA 1S0XA 3W0IA 4OZRE 3BC5A 4PP3A 2J4AA 4TV1B 5E15A 2JJ3A 2VV1A 3W5TA 3CQVA 2AX6A 4YT1A 5KR9A 2Q5PA 1U3RA 3ILZA 4IV4A 4OZRU 4ITFA 5DMFA 3K23A 1Z5XE 5DUEA 3AZ1A 2ZBSA 4OIUA 4QM0A 5E0WA 1Z5XU 4WHGA 3ZQTA 1TFCA 5KCDA 3ERDA 5F9BA 1VJBA 1M13A 4MG5A 3AZ3A 2ZMJA 5DWEA 1N4HA 2PIOA 5AVLA 4G21A 1FM6D 4MGDB 1NRLA 2AA7A 4OEAA 4DORA 5DXBA 1XAPA 1PCGA 2P7AA 2ZLCA 3VSPA 1Y0SA 4UDAA 1N46A 1NHZA 5KCTA 2Q6JA 3L03A 4JYIA 4S0SA 3UP0A 3FXVA 3W5QA 4Q13A 4MGCA 3OMMA 2BJ4A 2AO6A 2O4JA 4G1ZA 5DZ0A 4UDBA 3A78A 1YJEA 1K74A 2GWXA 3KYTA 1Y0XX 1T7FA 5IAWA 3WFGA 2YLOA 4MG8A 4FNEA 3R8IA 2QA8B 2AA5A 4MG6A 2NV7A 3VT3A 5FQTA 2I0GA 3AX8A 3RY9A 5DIGA 2R6YA 1FM9D 3B66A 3PRGA 4POHA 4RZEA 1E3GA 5HYRA 2OAXA 1XPCA 1NDEA 5G43A 1X7JA 3E00A 2XKWA 3NOAA 3VTBA 2P1UA 2VV4B 4PVUA 3F7DA 3B5RA 2QXSA 1S0ZA 1UHLB 4XT9A 2AMAA 1XNXA 2HVCA 5DKSA 3JZBA 1IE9A 4OKWA 2LBDA 4NY9A 2VV0A 1XDKA 2HAMA 2PJLA 3FEJA 5DIDA 3Q95B 3FS1A 4REEA 2HWQA 3OZJA 1MVCA 1NUOA 4PRGA 5C4SA 3VT6A 3VT5A 2W8YA 4ZJWA 3TKMA 3R29A 1QKUA 2I4ZA 2R40A 4G2HA 3G9EA 3OZ0A 4K7AA 4OK1A 2QSEA 3ET0A 4Q50A 5K13A 2VSRA 3DT3A 5KCCA 3OKIA 3PLZA 4X1FA 1NQ7A 3L3XA 3E7CA 4JL4A 5G3JA 3H0AA 5KCFA 3HLVA 3PBAA 3NSQA 3CS4A 4EM9A 3CDSA 5DTVA 3V3EA 2JFAB 4OFRA 4WLBA 1RDTD 1U3QA 1YIMA 4ZN7A 4ZNTA 3G8IA 2ZLAA 1ZKYA 3L0LA 3VTCA 1ILHA 3L0JA 4ZJRA 2ZK5A 5E19A 1S9QA 3BEJA 5EC9A 4ZOMA 5CJ6A 3U9QA 3VJIA 4NUFA 4IW8A 4ZNWA 3VHWA 5DXEA 4CSJA 2GPOA 3B65A 4KZIA 5EI1A 3UUCA 1KNUA 1T7TA 2VV3A 3IA6A 5KYAA 1T7MA 2P7ZA 2Q1HA 3RUUA 4OZTE 3GZ9A 4RZGA 2FAIA 3V9VA 3IPSA 5HYKA 3B0WA 5FQSA 5FQVA 3UVVA 3TKCA 2YJAB 3ZRAA 2HB8A 5C4OA 4TV1A 3A9EB 2OVMA 5DZHA 2VV2A 5JJMB 1LV2A 3HC5A 4P6XA 1FCXA 1R20D 3NSPA 3K22A 1EXXA 5LWPA 5A86A 2PITA 4N1YA 5G46A 1U3SA 1OT7A 4L98A 3AN3A 2PIUA 1YINA 3WJ5A 2AX9A 1PDUA 5E7VA 1XOWA 4MGDA 1P8DA 5KRIA 1R6GA 3L3ZA 3DR1A 2F4BA 1ZH7A 1SQNA 2GTKA 4UDDA 4ZN9A 4N5GA 4OEZA 4DM6A 1T76A 2PINA 2AAXA 4DK8A 5HCVA 1FM6A 5DZIA 4HLWA 4FHHA 2BAWA 4S14A 5EGVA 1NAXA 3T03A 3WT6A 2P54A 1XV9B 3G8OA 3KDUA 3CS6A 4OGHA 5HJSA 1P93A 1TXIA 2IOKA 2J14A 2QA8A 2ZNNA 4JYHA 5DXGA 3W0GA 4ZI1A 2Z4BA 3W0CA 5DWJA 3WTQA 3W0YA 2QE4A 3EYBA 3FLIA 5KD9A 2HARA 3P88A 4OHAA 4UDCA 3A40X 4RMEA 3R8AA 2GPPA 2VV4A 3IXPD 1R1KD 2GPUA 2P4YA 4F9MA 3OS8C 3GWXA 2PIRA 3KBAA 3R5NA 1FM9A 1UHLA 5DKGA 2ZFXA 1DB1A 5DSHA 2PRGA 4X1GA 3UUAB 4G1DA 4REFA 5AK2A 5AAUA 1G50A 3WWRA 1RKHA 4ZNUA 1YOWA 3Q95A 4RMDA 4YPQA 5APKA 4RUPA 5AVIA 2GPVA 3CWDA 2OM9A 1FCZA 2QXMA 5DUHA 5DXKA 3UU7B 3MNPA 3E94A 3A2JA 2ZASA 3ADSA 3HODA 4A2JA 2IOGA 5DV6A 3FEIA 3B68A 3FURA 4R2UA 2H79A 3OS8A 5M96A 1ZEOA 2HFPA 2ZK4A 2YATA 4LSJA 4RWVA 3G0WA 2ABIA 2JFAA 2JF9A 3N00A 1YP0A 4QK4A 1ZGYA 2Q7LA 2V7CA 4YNKA 1QKMA 3VHUA 1ILGA 5L11A 2NW4A 3CS8A 4LTWA 5IZ0A 1E3KA 1DKFB 2Q8SA 4IVWA 4XLDA 2YHDA 3O1EA 3VT8A 2P1TA 5DYDA 5G45A 3VTDA 4PPSA 2QNVA 4YMQA 2ACLB 3KMZA 1GWQA 3OLSA 4MGBB 5FQPA 5LGAA 5ETHA 3ET3A 2Q7IA 3PO9A 2QR9A 3A2IA 3VJTA 1MV9A 1XLSA 5ACCA 1T5ZA 2PIWA 5DRMA 1G1UA 3GYTA 3GN8A 1M7WA 4IVYA 3A9EA 4E4KA 1PZLA 4BCRA 2ZNQA 2ZXZA 1A52A 1ZDTA 3OMKA 4XTAA 3X1HA 3X36A 2ZL9A 2O4RA 3HQ5A 4J5WC 4OKBA 3X31A 4OC7A 1T7RA 4G2IA 2Q6SA 3AFRA 4IS8A 1ERRA 2AYRA 4K6IA 5AAVB 3WFFA 3OKHA 5DIEA 2POBA 2Q3YA 2B1VA 1FD0A 3KMRA 4ZNSA 4PLDA 3OLFA 5AWKA 5AZVA 2POGA 2QPYA 5DYBA 4QL8A 5E14A 3DZYD 2G0HA 4DQMA 1ZDUA 5KRMA 2FSZA 5DRJA 5DWGA 2ZMIA 2QZOB 4OIVA 2XYWA 5DKEA 3WJ4A 4EMAA 4NIEA 3B0QA 3RLLA 2AXAA 4O8FA 1XV9A 4J5WA 5DVSA 3HM1A 4OJ4A 3DZUD 4IUIA 5DXMA 2QA6A 4DK7A 3OLLA 4B7WA 4IW6A 2PIVA 3TX7B 4LNWA 1YOKA 3WT5A 2I4JA 3ADWA 5DKBA 3VJSA 4DOSA 5L7GA 5KRLA 4XI3A 4WHFA 1NQ1A 1XQ3A 3JZCA 4ITEA 5DLRA 3V4AA 4PPPA 5DXPA 4IU7A 1UOMA 5EJVA 2R6WA 5B41A 2H77A 2PIPL 4XUMA 4RUJA 3UUAA 1G5YA 3V49A 1YY4A 3IXPA 4OH5A 1R1KA 2QGWA 4NB6A 3RVFA 3FC6B 3A3ZX 3X1IA 1YYEA 4OEYA 3FUGA 1YUCA 3UU7A 2ATHA 4ZO1B 1WM0X 1T65A 4E4QA 4MG9B 4IV2A 5DWLA 2AB2A 1HG4A 4TUZB 1X78A 5DMCA 1K7LA 5DZ1A 3LBDA 3KWYA 2OCFA 2PIXA 2ZMHA 3CTBA 1XJ7A 3IMYA 1ZUCA 1Q4XA 4IA7A 4PP6A 3VT4A 5KRKA 2AWHA 3OAPA 3LMPA 3OOFA 2Q7JA 1T73A 1X7BA 3UUDB 2ZY0A 5DUGA 4JAZA 1DKFA 1K4WA 3B1MA 3FALB 5JY3A 1X7RA 5B5BA 4RZFA 1YA3A 4OKXA 3IPQA 4QE6A 5KRJA 2ACLA 3ET1A 4OJ9A 1SR7A 5GIDA 3R8DA 1GS4A 3F5CB 4MGBA 5ICKA 1EXAA 5DVVA 2G44A 3AUNA 4R6SA 2ZXNA 4RAKA 5EITA 2OVHA 5KCEA 4ZNVA 1LBDA 3K6PA 2ZNOA 1PK5A 4FGYA 3HC6A 3OSAA 3V9TA 1NQ0A 3D5FA 5GICA 2Z4JA 4IWCA 1GWXA 4CI4A 2HBHA 1M2ZA 1T79A 2Q70A 3PEQA 3ZR7A 4MGAB 5APJA 2HC4A 3R2AA 2G0GA 4RMCA 5L7HA 2VSTA 4OILA 5AZTA 3CJWA 4QJRA 4A4VA 5G5WA 2B23A 3UP3A 5DU5A 5AAVA 4NQAB 4FN9A 2YLPA 1XLSE 1MZNA 4Q0AC 4M8EA 3DY6A 2Q59B 4R06A 2HASA 2I0JA 3AUQA 4QE8A 5DP0A 3VI8A 3ZRBA 2AA6A 2QMVA 2ZK0A 1XQCA 1QKNA 1S19A 5DV8A 5DK9A 1XP9A 2QGTA 3HZFA 2Q61A 1XIUA 2QZOA 1L2JA 4FHIA 1T74A 5SYZA 3IPUA 2NXXA 3ADVA 5KROA 4G1YA 3DZYA 4LNXA 1NAVA 5HZCA 1XVPB 4PP5A 3OMPA 3D57A 3OSIA 3P0UA 3VRUA 3W5PA 2NPAA 4RE8A 2QW4A 3O1DA 3DCUA 4N73A 3SP9A 3L0EA 4PXMA 3OGTA 3SZ1A 1H9UA 2QH6A 5DWIA 1RDTA 4K4JA 4WVDA 5G44A 1FCYA 5KRFA 3DZUA 1NQ2A 3D24A 3W0JA 2I4PA 4IWFA 3MNOA 4MG7B 5KRHA 1GWRA 2GIUA 1NYXA 1OVLB 4OFUA 4ONIA 3SP6A 4J26A 2V0VA 1T63A 1SJ0A 3VT7A 3P8XA 1Z95A 1HJ1A 3FC6A 1I38A 3V3QA 4PWLA 2AX7A 5DV3A 4IA3A 2ZK6A 2YLYA 4G20A 3ET2A 5KRAA 4OH6A 1FBYA 4L96A 1QKTA 1U9EA 2O9IA 2EWPA 5DX3B 3VJHA 4XUHA 2Q1VA 1RJKA 4MG9A 3OSWA 4WQPA 2J7YA 4TUZA 5DVCA 3B67A 3L1BA 3VHVA 1R20A 3KFCA 1XZXX 1XP1A 1Y9RA 3QT0A 2P1VA 2Q6RA 4OEDA 1EREA 2FVJA 2PNUA 3UUDA 2ZK1A 5DL4A 1I7IA 3KDTA 5E1CA 4RUOX 3FALA 4MDDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XAO A;  2OZ7 A;  3TY0 A;  2A3I A;  1PQ9 A;  5KYJ A;  2REW A;  1OSH A;  3ADU A;  3B0T A;  5EHJ A;  1XNN A;  4RFW A;  5HJP B;  4PF3 A;  2GL8 A;  3F5C A;  3WMH A;  5G42 A;  1A28 A;  2VV1 B;  1ZAF A;  5JI0 D;  3VRV A;  2QTU A;  3K8S A;  3OMO A;  5IXK A;  1IE8 A;  1SKX A;  4E2J A;  2ZVT A;  1PQ6 A;  1R5K A;  4IQR A;  1KV6 A;  2ZKC A;  3A2H A;  3OMQ A;  2PKL A;  3GWS X;  1N83 A;  1I7G A;  4MGA A;  1K74 D;  5DXB B;  5DXQ A;  3AUR A;  5DY8 A;  2OUZ A;  3W5R A;  3AZ2 A;  3KMG A;  3D6D A;  4Y29 A;  2Q5S A;  2G5O A;  5E0X A;  5KRC A;  3AN4 A;  3W0H A;  3V9Y A;  2QAB A;  4POJ A;  1X76 A;  1PRG A;  5KCU A;  5C4T A;  5GIE A;  2BJ4 B;  3ERT A;  2PIQ A;  4WPF A;  1RK3 A;  2P7G A;  2Q59 A;  3E00 D;  3PCU A;  4MG8 B;  5AWJ A;  5C4U A;  1UPV A;  4OKT A;  1I37 A;  3VSO A;  5I4V A;  5KCW A;  2HCD A;  4JYG A;  2IHQ A;  3GD2 A;  4XHD A;  4A4W A;  2AMB A;  3B3K A;  3P89 A;  3GYU A;  3R5M A;  3HVL A;  4ZO1 X;  3M7R A;  4J5X C;  5H1E A;  3D90 A;  1UPW A;  1KKQ A;  1XVP A;  2J7X A;  2AA2 A;  1XP6 A;  3B0R A;  4OZT U;  2XYJ A;  1L2I A;  2Q7K A;  3WT7 A;  3BQD A;  4LBD A;  2P15 A;  4DMA A;  2R40 D;  4DM8 A;  1OSV A;  2ZK2 A;  1XDK B;  1YMT A;  1BSX A;  2ZNP A;  3GBK A;  4KZM A;  4OJB A;  5L7E A;  4PLE A;  5FQR A;  2B50 A;  3MNE A;  4MG7 A;  4S0T A;  3KPZ A;  4HEE X;  4M8H A;  3WGP A;  2NXX E;  3H0A D;  5APH A;  5DI7 A;  1OVL A;  5DXR A;  2GP7 A;  3S9S A;  1G2N A;  1S9P A;  4J5X A;  3RLJ A;  1XB7 A;  3H52 A;  2ZK3 A;  3CLD A;  2Q60 A;  2E2R A;  4IA2 A;  5GT4 A;  4IA1 A;  3VRT A;  5DX3 A;  3W0A A;  2Q5G A;  2XYX A;  3ADX A;  3VRW A;  4OLM A;  2AX8 A;  3ADT A;  4N8R A;  4JGV A;  3VN2 A;  3OOK A;  2YFE A;  1PQC A;  2YJD A;  3VT9 A;  2ZXM A;  3CDP A;  2B1Z A;  4J24 A;  4P6W A;  2HB7 A;  5DZ3 A;  4OAR A;  2AM9 A;  5AYG A;  3RUT A;  4APU A;  2YLQ A;  2XHS A;  4CI5 A;  1RKG A;  4ZNH A;  2HWR A;  5JJM A;  4KZJ A;  3DCT A;  3OS9 A;  4S15 A;  1X7E A;  3HO0 A;  3UVV B;  5HJP A;  1S0X A;  3W0I A;  4OZR E;  3BC5 A;  4PP3 A;  2J4A A;  4TV1 B;  5E15 A;  2JJ3 A;  2VV1 A;  3W5T A;  3CQV A;  2AX6 A;  4YT1 A;  5KR9 A;  2Q5P A;  1U3R A;  3ILZ A;  4IV4 A;  4OZR U;  4ITF A;  5DMF A;  3K23 A;  1Z5X E;  5DUE A;  3AZ1 A;  2ZBS A;  4OIU A;  4QM0 A;  5E0W A;  1Z5X U;  4WHG A;  3ZQT A;  1TFC A;  5KCD A;  3ERD A;  5F9B A;  1VJB A;  1M13 A;  4MG5 A;  3AZ3 A;  2ZMJ A;  5DWE A;  1N4H A;  2PIO A;  5AVL A;  4G21 A;  1FM6 D;  4MGD B;  1NRL A;  2AA7 A;  4OEA A;  4DOR A;  5DXB A;  1XAP A;  1PCG A;  2P7A A;  2ZLC A;  3VSP A;  1Y0S A;  4UDA A;  1N46 A;  1NHZ A;  5KCT A;  2Q6J A;  3L03 A;  4JYI A;  4S0S A;  3UP0 A;  3FXV A;  3W5Q A;  4Q13 A;  4MGC A;  3OMM A;  2BJ4 A;  2AO6 A;  2O4J A;  4G1Z A;  5DZ0 A;  4UDB A;  3A78 A;  1YJE A;  1K74 A;  2GWX A;  3KYT A;  1Y0X X;  1T7F A;  5IAW A;  3WFG A;  2YLO A;  4MG8 A;  4FNE A;  3R8I A;  2QA8 B;  2AA5 A;  4MG6 A;  2NV7 A;  3VT3 A;  5FQT A;  2I0G A;  3AX8 A;  3RY9 A;  5DIG A;  2R6Y A;  1FM9 D;  3B66 A;  3PRG A;  4POH A;  4RZE A;  1E3G A;  5HYR A;  2OAX A;  1XPC A;  1NDE A;  5G43 A;  1X7J A;  3E00 A;  2XKW A;  3NOA A;  3VTB A;  2P1U A;  2VV4 B;  4PVU A;  3F7D A;  3B5R A;  2QXS A;  1S0Z A;  1UHL B;  4XT9 A;  2AMA A;  1XNX A;  2HVC A;  5DKS A;  3JZB A;  1IE9 A;  4OKW A;  2LBD A;  4NY9 A;  2VV0 A;  1XDK A;  2HAM A;  2PJL A;  3FEJ A;  5DID A;  3Q95 B;  3FS1 A;  4REE A;  2HWQ A;  3OZJ A;  1MVC A;  1NUO A;  4PRG A;  5C4S A;  3VT6 A;  3VT5 A;  2W8Y A;  4ZJW A;  3TKM A;  3R29 A;  1QKU A;  2I4Z A;  2R40 A;  4G2H A;  3G9E A;  3OZ0 A;  4K7A A;  4OK1 A;  2QSE A;  3ET0 A;  4Q50 A;  5K13 A;  2VSR A;  3DT3 A;  5KCC A;  3OKI A;  3PLZ A;  4X1F A;  1NQ7 A;  3L3X A;  3E7C A;  4JL4 A;  5G3J A;  3H0A A;  5KCF A;  3HLV A;  3PBA A;  3NSQ A;  3CS4 A;  4EM9 A;  3CDS A;  5DTV A;  3V3E A;  2JFA B;  4OFR A;  4WLB A;  1RDT D;  1U3Q A;  1YIM A;  4ZN7 A;  4ZNT A;  3G8I A;  2ZLA A;  1ZKY A;  3L0L A;  3VTC A;  1ILH A;  3L0J A;  4ZJR A;  2ZK5 A;  5E19 A;  1S9Q A;  3BEJ A;  5EC9 A;  4ZOM A;  5CJ6 A;  3U9Q A;  3VJI A;  4NUF A;  4IW8 A;  4ZNW A;  3VHW A;  5DXE A;  4CSJ A;  2GPO A;  3B65 A;  4KZI A;  5EI1 A;  3UUC A;  1KNU A;  1T7T A;  2VV3 A;  3IA6 A;  5KYA A;  1T7M A;  2P7Z A;  2Q1H A;  3RUU A;  4OZT E;  3GZ9 A;  4RZG A;  2FAI A;  3V9V A;  3IPS A;  5HYK A;  3B0W A;  5FQS A;  5FQV A;  3UVV A;  3TKC A;  2YJA B;  3ZRA A;  2HB8 A;  5C4O A;  4TV1 A;  3A9E B;  2OVM A;  5DZH A;  2VV2 A;  5JJM B;  1LV2 A;  3HC5 A;  4P6X A;  1FCX A;  1R20 D;  3NSP A;  3K22 A;  1EXX A;  5LWP A;  5A86 A;  2PIT A;  4N1Y A;  5G46 A;  1U3S A;  1OT7 A;  4L98 A;  3AN3 A;  2PIU A;  1YIN A;  3WJ5 A;  2AX9 A;  1PDU A;  5E7V A;  1XOW A;  4MGD A;  1P8D A;  5KRI A;  1R6G A;  3L3Z A;  3DR1 A;  2F4B A;  1ZH7 A;  1SQN A;  2GTK A;  4UDD A;  4ZN9 A;  4N5G A;  4OEZ A;  4DM6 A;  1T76 A;  2PIN A;  2AAX A;  4DK8 A;  5HCV A;  1FM6 A;  5DZI A;  4HLW A;  4FHH A;  2BAW A;  4S14 A;  5EGV A;  1NAX A;  3T03 A;  3WT6 A;  2P54 A;  1XV9 B;  3G8O A;  3KDU A;  3CS6 A;  4OGH A;  5HJS A;  1P93 A;  1TXI A;  2IOK A;  2J14 A;  2QA8 A;  2ZNN A;  4JYH A;  5DXG A;  3W0G A;  4ZI1 A;  2Z4B A;  3W0C A;  5DWJ A;  3WTQ A;  3W0Y A;  2QE4 A;  3EYB A;  3FLI A;  5KD9 A;  2HAR A;  3P88 A;  4OHA A;  4UDC A;  3A40 X;  4RME A;  3R8A A;  2GPP A;  2VV4 A;  3IXP D;  1R1K D;  2GPU A;  2P4Y A;  4F9M A;  3OS8 C;  3GWX A;  2PIR A;  3KBA A;  3R5N A;  1FM9 A;  1UHL A;  5DKG A;  2ZFX A;  1DB1 A;  5DSH A;  2PRG A;  4X1G A;  3UUA B;  4G1D A;  4REF A;  5AK2 A;  5AAU A;  1G50 A;  3WWR A;  1RKH A;  4ZNU A;  1YOW A;  3Q95 A;  4RMD A;  4YPQ A;  5APK A;  4RUP A;  5AVI A;  2GPV A;  3CWD A;  2OM9 A;  1FCZ A;  2QXM A;  5DUH A;  5DXK A;  3UU7 B;  3MNP A;  3E94 A;  3A2J A;  2ZAS A;  3ADS A;  3HOD A;  4A2J A;  2IOG A;  5DV6 A;  3FEI A;  3B68 A;  3FUR A;  4R2U A;  2H79 A;  3OS8 A;  5M96 A;  1ZEO A;  2HFP A;  2ZK4 A;  2YAT A;  4LSJ A;  4RWV A;  3G0W A;  2ABI A;  2JFA A;  2JF9 A;  3N00 A;  1YP0 A;  4QK4 A;  1ZGY A;  2Q7L A;  2V7C A;  4YNK A;  1QKM A;  3VHU A;  1ILG A;  5L11 A;  2NW4 A;  3CS8 A;  4LTW A;  5IZ0 A;  1E3K A;  1DKF B;  2Q8S A;  4IVW A;  4XLD A;  2YHD A;  3O1E A;  3VT8 A;  2P1T A;  5DYD A;  5G45 A;  3VTD A;  4PPS A;  2QNV A;  4YMQ A;  2ACL B;  3KMZ A;  1GWQ A;  3OLS A;  4MGB B;  5FQP A;  5LGA A;  5ETH A;  3ET3 A;  2Q7I A;  3PO9 A;  2QR9 A;  3A2I A;  3VJT A;  1MV9 A;  1XLS A;  5ACC A;  1T5Z A;  2PIW A;  5DRM A;  1G1U A;  3GYT A;  3GN8 A;  1M7W A;  4IVY A;  3A9E A;  4E4K A;  1PZL A;  4BCR A;  2ZNQ A;  2ZXZ A;  1A52 A;  1ZDT A;  3OMK A;  4XTA A;  3X1H A;  3X36 A;  2ZL9 A;  2O4R A;  3HQ5 A;  4J5W C;  4OKB A;  3X31 A;  4OC7 A;  1T7R A;  4G2I A;  2Q6S A;  3AFR A;  4IS8 A;  1ERR A;  2AYR A;  4K6I A;  5AAV B;  3WFF A;  3OKH A;  5DIE A;  2POB A;  2Q3Y A;  2B1V A;  1FD0 A;  3KMR A;  4ZNS A;  4PLD A;  3OLF A;  5AWK A;  5AZV A;  2POG A;  2QPY A;  5DYB A;  4QL8 A;  5E14 A;  3DZY D;  2G0H A;  4DQM A;  1ZDU A;  5KRM A;  2FSZ A;  5DRJ A;  5DWG A;  2ZMI A;  2QZO B;  4OIV A;  2XYW A;  5DKE A;  3WJ4 A;  4EMA A;  4NIE A;  3B0Q A;  3RLL A;  2AXA A;  4O8F A;  1XV9 A;  4J5W A;  5DVS A;  3HM1 A;  4OJ4 A;  3DZU D;  4IUI A;  5DXM A;  2QA6 A;  4DK7 A;  3OLL A;  4B7W A;  4IW6 A;  2PIV A;  3TX7 B;  4LNW A;  1YOK A;  3WT5 A;  2I4J A;  3ADW A;  5DKB A;  3VJS A;  4DOS A;  5L7G A;  5KRL A;  4XI3 A;  4WHF A;  1NQ1 A;  1XQ3 A;  3JZC A;  4ITE A;  5DLR A;  3V4A A;  4PPP A;  5DXP A;  4IU7 A;  1UOM A;  5EJV A;  2R6W A;  5B41 A;  2H77 A;  2PIP L;  4XUM A;  4RUJ A;  3UUA A;  1G5Y A;  3V49 A;  1YY4 A;  3IXP A;  4OH5 A;  1R1K A;  2QGW A;  4NB6 A;  3RVF A;  3FC6 B;  3A3Z X;  3X1I A;  1YYE A;  4OEY A;  3FUG A;  1YUC A;  3UU7 A;  2ATH A;  4ZO1 B;  1WM0 X;  1T65 A;  4E4Q A;  4MG9 B;  4IV2 A;  5DWL A;  2AB2 A;  1HG4 A;  4TUZ B;  1X78 A;  5DMC A;  1K7L A;  5DZ1 A;  3LBD A;  3KWY A;  2OCF A;  2PIX A;  2ZMH A;  3CTB A;  1XJ7 A;  3IMY A;  1ZUC A;  1Q4X A;  4IA7 A;  4PP6 A;  3VT4 A;  5KRK A;  2AWH A;  3OAP A;  3LMP A;  3OOF A;  2Q7J A;  1T73 A;  1X7B A;  3UUD B;  2ZY0 A;  5DUG A;  4JAZ A;  1DKF A;  1K4W A;  3B1M A;  3FAL B;  5JY3 A;  1X7R A;  5B5B A;  4RZF A;  1YA3 A;  4OKX A;  3IPQ A;  4QE6 A;  5KRJ A;  2ACL A;  3ET1 A;  4OJ9 A;  1SR7 A;  5GID A;  3R8D A;  1GS4 A;  3F5C B;  4MGB A;  5ICK A;  1EXA A;  5DVV A;  2G44 A;  3AUN A;  4R6S A;  2ZXN A;  4RAK A;  5EIT A;  2OVH A;  5KCE A;  4ZNV A;  1LBD A;  3K6P A;  2ZNO A;  1PK5 A;  4FGY A;  3HC6 A;  3OSA A;  3V9T A;  1NQ0 A;  3D5F A;  5GIC A;  2Z4J A;  4IWC A;  1GWX A;  4CI4 A;  2HBH A;  1M2Z A;  1T79 A;  2Q70 A;  3PEQ A;  3ZR7 A;  4MGA B;  5APJ A;  2HC4 A;  3R2A A;  2G0G A;  4RMC A;  5L7H A;  2VST A;  4OIL A;  5AZT A;  3CJW A;  4QJR A;  4A4V A;  5G5W A;  2B23 A;  3UP3 A;  5DU5 A;  5AAV A;  4NQA B;  4FN9 A;  2YLP A;  1XLS E;  1MZN A;  4Q0A C;  4M8E A;  3DY6 A;  2Q59 B;  4R06 A;  2HAS A;  2I0J A;  3AUQ A;  4QE8 A;  5DP0 A;  3VI8 A;  3ZRB A;  2AA6 A;  2QMV A;  2ZK0 A;  1XQC A;  1QKN A;  1S19 A;  5DV8 A;  5DK9 A;  1XP9 A;  2QGT A;  3HZF A;  2Q61 A;  1XIU A;  2QZO A;  1L2J A;  4FHI A;  1T74 A;  5SYZ A;  3IPU A;  2NXX A;  3ADV A;  5KRO A;  4G1Y A;  3DZY A;  4LNX A;  1NAV A;  5HZC A;  1XVP B;  4PP5 A;  3OMP A;  3D57 A;  3OSI A;  3P0U A;  3VRU A;  3W5P A;  2NPA A;  4RE8 A;  2QW4 A;  3O1D A;  3DCU A;  4N73 A;  3SP9 A;  3L0E A;  4PXM A;  3OGT A;  3SZ1 A;  1H9U A;  2QH6 A;  5DWI A;  1RDT A;  4K4J A;  4WVD A;  5G44 A;  1FCY A;  5KRF A;  3DZU A;  1NQ2 A;  3D24 A;  3W0J A;  2I4P A;  4IWF A;  3MNO A;  4MG7 B;  5KRH A;  1GWR A;  2GIU A;  1NYX A;  1OVL B;  4OFU A;  4ONI A;  3SP6 A;  4J26 A;  2V0V A;  1T63 A;  1SJ0 A;  3VT7 A;  3P8X A;  1Z95 A;  1HJ1 A;  3FC6 A;  1I38 A;  3V3Q A;  4PWL A;  2AX7 A;  5DV3 A;  4IA3 A;  2ZK6 A;  2YLY A;  4G20 A;  3ET2 A;  5KRA A;  4OH6 A;  1FBY A;  4L96 A;  1QKT A;  1U9E A;  2O9I A;  2EWP A;  5DX3 B;  3VJH A;  4XUH A;  2Q1V A;  1RJK A;  4MG9 A;  3OSW A;  4WQP A;  2J7Y A;  4TUZ A;  5DVC A;  3B67 A;  3L1B A;  3VHV A;  1R20 A;  3KFC A;  1XZX X;  1XP1 A;  1Y9R A;  3QT0 A;  2P1V A;  2Q6R A;  4OED A;  1ERE A;  2FVJ A;  2PNU A;  3UUD A;  2ZK1 A;  5DL4 A;  1I7I A;  3KDT A;  5E1C A;  4RUO X;  3FAL A;  4MDD A; 
#chains in the Genus database with same CATH topology
 4XAO A;  2OZ7 A;  3TY0 A;  2A3I A;  1PQ9 A;  5KYJ A;  2REW A;  1OSH A;  3ADU A;  3B0T A;  5EHJ A;  1XNN A;  4RFW A;  5HJP B;  4PF3 A;  2GL8 A;  3F5C A;  3WMH A;  5G42 A;  1A28 A;  2VV1 B;  1ZAF A;  5JI0 D;  3VRV A;  2QTU A;  3K8S A;  3OMO A;  5IXK A;  1IE8 A;  1SKX A;  4E2J A;  2ZVT A;  1PQ6 A;  1R5K A;  4IQR A;  1KV6 A;  2ZKC A;  3A2H A;  3OMQ A;  2PKL A;  3GWS X;  1N83 A;  1I7G A;  4MGA A;  1K74 D;  5DXB B;  5DXQ A;  3AUR A;  5DY8 A;  2OUZ A;  3W5R A;  3AZ2 A;  3KMG A;  3D6D A;  4Y29 A;  2Q5S A;  2G5O A;  5E0X A;  5KRC A;  3AN4 A;  3W0H A;  3V9Y A;  2QAB A;  4POJ A;  1X76 A;  1PRG A;  5KCU A;  5C4T A;  5GIE A;  2BJ4 B;  3ERT A;  2PIQ A;  4WPF A;  1RK3 A;  2P7G A;  2Q59 A;  3E00 D;  3PCU A;  4MG8 B;  5AWJ A;  5C4U A;  1UPV A;  4OKT A;  1I37 A;  3VSO A;  5I4V A;  5KCW A;  2HCD A;  4JYG A;  2IHQ A;  3GD2 A;  4XHD A;  4A4W A;  2AMB A;  3B3K A;  3P89 A;  3GYU A;  3R5M A;  3HVL A;  4ZO1 X;  3M7R A;  4J5X C;  5H1E A;  3D90 A;  1UPW A;  1KKQ A;  1XVP A;  2J7X A;  2AA2 A;  1XP6 A;  3B0R A;  4OZT U;  2XYJ A;  1L2I A;  2Q7K A;  3WT7 A;  3BQD A;  4LBD A;  2P15 A;  4DMA A;  2R40 D;  4DM8 A;  1OSV A;  2ZK2 A;  1XDK B;  1YMT A;  1BSX A;  2ZNP A;  3GBK A;  4KZM A;  4OJB A;  5L7E A;  4PLE A;  5FQR A;  2B50 A;  3MNE A;  4MG7 A;  4S0T A;  3KPZ A;  4HEE X;  4M8H A;  3WGP A;  2NXX E;  3H0A D;  5APH A;  5DI7 A;  1OVL A;  5DXR A;  2GP7 A;  3S9S A;  1G2N A;  1S9P A;  4J5X A;  3RLJ A;  1XB7 A;  3H52 A;  2ZK3 A;  3CLD A;  2Q60 A;  2E2R A;  4IA2 A;  5GT4 A;  4IA1 A;  3VRT A;  5DX3 A;  3W0A A;  2Q5G A;  2XYX A;  3ADX A;  3VRW A;  4OLM A;  2AX8 A;  3ADT A;  4N8R A;  4JGV A;  3VN2 A;  3OOK A;  2YFE A;  1PQC A;  2YJD A;  3VT9 A;  2ZXM A;  3CDP A;  2B1Z A;  4J24 A;  4P6W A;  2HB7 A;  5DZ3 A;  4OAR A;  2AM9 A;  5AYG A;  3RUT A;  4APU A;  2YLQ A;  2XHS A;  4CI5 A;  1RKG A;  4ZNH A;  2HWR A;  5JJM A;  4KZJ A;  3DCT A;  3OS9 A;  4S15 A;  1X7E A;  3HO0 A;  3UVV B;  5HJP A;  1S0X A;  3W0I A;  4OZR E;  3BC5 A;  4PP3 A;  2J4A A;  4TV1 B;  5E15 A;  2JJ3 A;  2VV1 A;  3W5T A;  3CQV A;  2AX6 A;  4YT1 A;  5KR9 A;  2Q5P A;  1U3R A;  3ILZ A;  4IV4 A;  4OZR U;  4ITF A;  5DMF A;  3K23 A;  1Z5X E;  5DUE A;  3AZ1 A;  2ZBS A;  4OIU A;  4QM0 A;  5E0W A;  1Z5X U;  4WHG A;  3ZQT A;  1TFC A;  5KCD A;  3ERD A;  5F9B A;  1VJB A;  1M13 A;  4MG5 A;  3AZ3 A;  2ZMJ A;  5DWE A;  1N4H A;  2PIO A;  5AVL A;  4G21 A;  1FM6 D;  4MGD B;  1NRL A;  2AA7 A;  4OEA A;  4DOR A;  5DXB A;  1XAP A;  1PCG A;  2P7A A;  2ZLC A;  3VSP A;  1Y0S A;  4UDA A;  1N46 A;  1NHZ A;  5KCT A;  2Q6J A;  3L03 A;  4JYI A;  4S0S A;  3UP0 A;  3FXV A;  3W5Q A;  4Q13 A;  4MGC A;  3OMM A;  2BJ4 A;  2AO6 A;  2O4J A;  4G1Z A;  5DZ0 A;  4UDB A;  3A78 A;  1YJE A;  1K74 A;  2GWX A;  3KYT A;  1Y0X X;  1T7F A;  5IAW A;  3WFG A;  2YLO A;  4MG8 A;  4FNE A;  3R8I A;  2QA8 B;  2AA5 A;  4MG6 A;  2NV7 A;  3VT3 A;  5FQT A;  2I0G A;  3AX8 A;  3RY9 A;  5DIG A;  2R6Y A;  1FM9 D;  3B66 A;  3PRG A;  4POH A;  4RZE A;  1E3G A;  5HYR A;  2OAX A;  1XPC A;  1NDE A;  5G43 A;  1X7J A;  3E00 A;  2XKW A;  3NOA A;  3VTB A;  2P1U A;  2VV4 B;  4PVU A;  3F7D A;  3B5R A;  2QXS A;  1S0Z A;  1UHL B;  4XT9 A;  2AMA A;  1XNX A;  2HVC A;  5DKS A;  3JZB A;  1IE9 A;  4OKW A;  2LBD A;  4NY9 A;  2VV0 A;  1XDK A;  2HAM A;  2PJL A;  3FEJ A;  5DID A;  3Q95 B;  3FS1 A;  4REE A;  2HWQ A;  3OZJ A;  1MVC A;  1NUO A;  4PRG A;  5C4S A;  3VT6 A;  3VT5 A;  2W8Y A;  4ZJW A;  3TKM A;  3R29 A;  1QKU A;  2I4Z A;  2R40 A;  4G2H A;  3G9E A;  3OZ0 A;  4K7A A;  4OK1 A;  2QSE A;  3ET0 A;  4Q50 A;  5K13 A;  2VSR A;  3DT3 A;  5KCC A;  3OKI A;  3PLZ A;  4X1F A;  1NQ7 A;  3L3X A;  3E7C A;  4JL4 A;  5G3J A;  3H0A A;  5KCF A;  3HLV A;  3PBA A;  3NSQ A;  3CS4 A;  4EM9 A;  3CDS A;  5DTV A;  3V3E A;  2JFA B;  4OFR A;  4WLB A;  1RDT D;  1U3Q A;  1YIM A;  4ZN7 A;  4ZNT A;  3G8I A;  2ZLA A;  1ZKY A;  3L0L A;  3VTC A;  1ILH A;  3L0J A;  4ZJR A;  2ZK5 A;  5E19 A;  1S9Q A;  3BEJ A;  5EC9 A;  4ZOM A;  5CJ6 A;  3U9Q A;  3VJI A;  4NUF A;  4IW8 A;  4ZNW A;  3VHW A;  5DXE A;  4CSJ A;  2GPO A;  3B65 A;  4KZI A;  5EI1 A;  3UUC A;  1KNU A;  1T7T A;  2VV3 A;  3IA6 A;  5KYA A;  1T7M A;  2P7Z A;  2Q1H A;  3RUU A;  4OZT E;  3GZ9 A;  4RZG A;  2FAI A;  3V9V A;  3IPS A;  5HYK A;  3B0W A;  5FQS A;  5FQV A;  3UVV A;  3TKC A;  2YJA B;  3ZRA A;  2HB8 A;  5C4O A;  4TV1 A;  3A9E B;  2OVM A;  5DZH A;  2VV2 A;  5JJM B;  1LV2 A;  3HC5 A;  4P6X A;  1FCX A;  1R20 D;  3NSP A;  3K22 A;  1EXX A;  5LWP A;  5A86 A;  2PIT A;  4N1Y A;  5G46 A;  1U3S A;  1OT7 A;  4L98 A;  3AN3 A;  2PIU A;  1YIN A;  3WJ5 A;  2AX9 A;  1PDU A;  5E7V A;  1XOW A;  4MGD A;  1P8D A;  5KRI A;  1R6G A;  3L3Z A;  3DR1 A;  2F4B A;  1ZH7 A;  1SQN A;  2GTK A;  4UDD A;  4ZN9 A;  4N5G A;  4OEZ A;  4DM6 A;  1T76 A;  2PIN A;  2AAX A;  4DK8 A;  5HCV A;  1FM6 A;  5DZI A;  4HLW A;  4FHH A;  2BAW A;  4S14 A;  5EGV A;  1NAX A;  3T03 A;  3WT6 A;  2P54 A;  1XV9 B;  3G8O A;  3KDU A;  3CS6 A;  4OGH A;  5HJS A;  1P93 A;  1TXI A;  2IOK A;  2J14 A;  2QA8 A;  2ZNN A;  4JYH A;  5DXG A;  3W0G A;  4ZI1 A;  2Z4B A;  3W0C A;  5DWJ A;  3WTQ A;  3W0Y A;  2QE4 A;  3EYB A;  3FLI A;  5KD9 A;  2HAR A;  3P88 A;  4OHA A;  4UDC A;  3A40 X;  4RME A;  3R8A A;  2GPP A;  2VV4 A;  3IXP D;  1R1K D;  2GPU A;  2P4Y A;  4F9M A;  3OS8 C;  3GWX A;  2PIR A;  3KBA A;  3R5N A;  1FM9 A;  1UHL A;  5DKG A;  2ZFX A;  1DB1 A;  5DSH A;  2PRG A;  4X1G A;  3UUA B;  4G1D A;  4REF A;  5AK2 A;  5AAU A;  1G50 A;  3WWR A;  1RKH A;  4ZNU A;  1YOW A;  3Q95 A;  4RMD A;  4YPQ A;  5APK A;  4RUP A;  5AVI A;  2GPV A;  3CWD A;  2OM9 A;  1FCZ A;  2QXM A;  5DUH A;  5DXK A;  3UU7 B;  3MNP A;  3E94 A;  3A2J A;  2ZAS A;  3ADS A;  3HOD A;  4A2J A;  2IOG A;  5DV6 A;  3FEI A;  3B68 A;  3FUR A;  4R2U A;  2H79 A;  3OS8 A;  5M96 A;  1ZEO A;  2HFP A;  2ZK4 A;  2YAT A;  4LSJ A;  4RWV A;  3G0W A;  2ABI A;  2JFA A;  2JF9 A;  3N00 A;  1YP0 A;  4QK4 A;  1ZGY A;  2Q7L A;  2V7C A;  4YNK A;  1QKM A;  3VHU A;  1ILG A;  5L11 A;  2NW4 A;  3CS8 A;  4LTW A;  5IZ0 A;  1E3K A;  1DKF B;  2Q8S A;  4IVW A;  4XLD A;  2YHD A;  3O1E A;  3VT8 A;  2P1T A;  5DYD A;  5G45 A;  3VTD A;  4PPS A;  2QNV A;  4YMQ A;  2ACL B;  3KMZ A;  1GWQ A;  3OLS A;  4MGB B;  5FQP A;  5LGA A;  5ETH A;  3ET3 A;  2Q7I A;  3PO9 A;  2QR9 A;  3A2I A;  3VJT A;  1MV9 A;  1XLS A;  5ACC A;  1T5Z A;  2PIW A;  5DRM A;  1G1U A;  3GYT A;  3GN8 A;  1M7W A;  4IVY A;  3A9E A;  4E4K A;  1PZL A;  4BCR A;  2ZNQ A;  2ZXZ A;  1A52 A;  1ZDT A;  3OMK A;  4XTA A;  3X1H A;  3X36 A;  2ZL9 A;  2O4R A;  3HQ5 A;  4J5W C;  4OKB A;  3X31 A;  4OC7 A;  1T7R A;  4G2I A;  2Q6S A;  3AFR A;  4IS8 A;  1ERR A;  2AYR A;  4K6I A;  5AAV B;  3WFF A;  3OKH A;  5DIE A;  2POB A;  2Q3Y A;  2B1V A;  1FD0 A;  3KMR A;  4ZNS A;  4PLD A;  3OLF A;  5AWK A;  5AZV A;  2POG A;  2QPY A;  5DYB A;  4QL8 A;  5E14 A;  3DZY D;  2G0H A;  4DQM A;  1ZDU A;  5KRM A;  2FSZ A;  5DRJ A;  5DWG A;  2ZMI A;  2QZO B;  4OIV A;  2XYW A;  5DKE A;  3WJ4 A;  4EMA A;  4NIE A;  3B0Q A;  3RLL A;  2AXA A;  4O8F A;  1XV9 A;  4J5W A;  5DVS A;  3HM1 A;  4OJ4 A;  3DZU D;  4IUI A;  5DXM A;  2QA6 A;  4DK7 A;  3OLL A;  4B7W A;  4IW6 A;  2PIV A;  3TX7 B;  4LNW A;  1YOK A;  3WT5 A;  2I4J A;  3ADW A;  5DKB A;  3VJS A;  4DOS A;  5L7G A;  5KRL A;  4XI3 A;  4WHF A;  1NQ1 A;  1XQ3 A;  3JZC A;  4ITE A;  5DLR A;  3V4A A;  4PPP A;  5DXP A;  4IU7 A;  1UOM A;  5EJV A;  2R6W A;  5B41 A;  2H77 A;  2PIP L;  4XUM A;  4RUJ A;  3UUA A;  1G5Y A;  3V49 A;  1YY4 A;  3IXP A;  4OH5 A;  1R1K A;  2QGW A;  4NB6 A;  3RVF A;  3FC6 B;  3A3Z X;  3X1I A;  1YYE A;  4OEY A;  3FUG A;  1YUC A;  3UU7 A;  2ATH A;  4ZO1 B;  1WM0 X;  1T65 A;  4E4Q A;  4MG9 B;  4IV2 A;  5DWL A;  2AB2 A;  1HG4 A;  4TUZ B;  1X78 A;  5DMC A;  1K7L A;  5DZ1 A;  3LBD A;  3KWY A;  2OCF A;  2PIX A;  2ZMH A;  3CTB A;  1XJ7 A;  3IMY A;  1ZUC A;  1Q4X A;  4IA7 A;  4PP6 A;  3VT4 A;  5KRK A;  2AWH A;  3OAP A;  3LMP A;  3OOF A;  2Q7J A;  1T73 A;  1X7B A;  3UUD B;  2ZY0 A;  5DUG A;  4JAZ A;  1DKF A;  1K4W A;  3B1M A;  3FAL B;  5JY3 A;  1X7R A;  5B5B A;  4RZF A;  1YA3 A;  4OKX A;  3IPQ A;  4QE6 A;  5KRJ A;  2ACL A;  3ET1 A;  4OJ9 A;  1SR7 A;  5GID A;  3R8D A;  1GS4 A;  3F5C B;  4MGB A;  5ICK A;  1EXA A;  5DVV A;  2G44 A;  3AUN A;  4R6S A;  2ZXN A;  4RAK A;  5EIT A;  2OVH A;  5KCE A;  4ZNV A;  1LBD A;  3K6P A;  2ZNO A;  1PK5 A;  4FGY A;  3HC6 A;  3OSA A;  3V9T A;  1NQ0 A;  3D5F A;  5GIC A;  2Z4J A;  4IWC A;  1GWX A;  4CI4 A;  2HBH A;  1M2Z A;  1T79 A;  2Q70 A;  3PEQ A;  3ZR7 A;  4MGA B;  5APJ A;  2HC4 A;  3R2A A;  2G0G A;  4RMC A;  5L7H A;  2VST A;  4OIL A;  5AZT A;  3CJW A;  4QJR A;  4A4V A;  5G5W A;  2B23 A;  3UP3 A;  5DU5 A;  5AAV A;  4NQA B;  4FN9 A;  2YLP A;  1XLS E;  1MZN A;  4Q0A C;  4M8E A;  3DY6 A;  2Q59 B;  4R06 A;  2HAS A;  2I0J A;  3AUQ A;  4QE8 A;  5DP0 A;  3VI8 A;  3ZRB A;  2AA6 A;  2QMV A;  2ZK0 A;  1XQC A;  1QKN A;  1S19 A;  5DV8 A;  5DK9 A;  1XP9 A;  2QGT A;  3HZF A;  2Q61 A;  1XIU A;  2QZO A;  1L2J A;  4FHI A;  1T74 A;  5SYZ A;  3IPU A;  2NXX A;  3ADV A;  5KRO A;  4G1Y A;  3DZY A;  4LNX A;  1NAV A;  5HZC A;  1XVP B;  4PP5 A;  3OMP A;  3D57 A;  3OSI A;  3P0U A;  3VRU A;  3W5P A;  2NPA A;  4RE8 A;  2QW4 A;  3O1D A;  3DCU A;  4N73 A;  3SP9 A;  3L0E A;  4PXM A;  3OGT A;  3SZ1 A;  1H9U A;  2QH6 A;  5DWI A;  1RDT A;  4K4J A;  4WVD A;  5G44 A;  1FCY A;  5KRF A;  3DZU A;  1NQ2 A;  3D24 A;  3W0J A;  2I4P A;  4IWF A;  3MNO A;  4MG7 B;  5KRH A;  1GWR A;  2GIU A;  1NYX A;  1OVL B;  4OFU A;  4ONI A;  3SP6 A;  4J26 A;  2V0V A;  1T63 A;  1SJ0 A;  3VT7 A;  3P8X A;  1Z95 A;  1HJ1 A;  3FC6 A;  1I38 A;  3V3Q A;  4PWL A;  2AX7 A;  5DV3 A;  4IA3 A;  2ZK6 A;  2YLY A;  4G20 A;  3ET2 A;  5KRA A;  4OH6 A;  1FBY A;  4L96 A;  1QKT A;  1U9E A;  2O9I A;  2EWP A;  5DX3 B;  3VJH A;  4XUH A;  2Q1V A;  1RJK A;  4MG9 A;  3OSW A;  4WQP A;  2J7Y A;  4TUZ A;  5DVC A;  3B67 A;  3L1B A;  3VHV A;  1R20 A;  3KFC A;  1XZX X;  1XP1 A;  1Y9R A;  3QT0 A;  2P1V A;  2Q6R A;  4OED A;  1ERE A;  2FVJ A;  2PNU A;  3UUD A;  2ZK1 A;  5DL4 A;  1I7I A;  3KDT A;  5E1C A;  4RUO X;  3FAL A;  4MDD A; 
#chains in the Genus database with same CATH homology
 4XAO A;  2OZ7 A;  3TY0 A;  2A3I A;  1PQ9 A;  5KYJ A;  2REW A;  1OSH A;  3ADU A;  3B0T A;  5EHJ A;  1XNN A;  4RFW A;  5HJP B;  4PF3 A;  2GL8 A;  3F5C A;  3WMH A;  5G42 A;  1A28 A;  2VV1 B;  1ZAF A;  5JI0 D;  3VRV A;  2QTU A;  3K8S A;  3OMO A;  5IXK A;  1IE8 A;  1SKX A;  4E2J A;  2ZVT A;  1PQ6 A;  1R5K A;  4IQR A;  1KV6 A;  2ZKC A;  3A2H A;  3OMQ A;  2PKL A;  3GWS X;  1N83 A;  1I7G A;  4MGA A;  1K74 D;  5DXB B;  5DXQ A;  3AUR A;  5DY8 A;  2OUZ A;  3W5R A;  3AZ2 A;  3KMG A;  3D6D A;  4Y29 A;  2Q5S A;  2G5O A;  5E0X A;  5KRC A;  3AN4 A;  3W0H A;  3V9Y A;  2QAB A;  4POJ A;  1X76 A;  1PRG A;  5KCU A;  5C4T A;  5GIE A;  2BJ4 B;  3ERT A;  2PIQ A;  4WPF A;  1RK3 A;  2P7G A;  2Q59 A;  3E00 D;  3PCU A;  4MG8 B;  5AWJ A;  5C4U A;  1UPV A;  4OKT A;  1I37 A;  3VSO A;  5I4V A;  5KCW A;  2HCD A;  4JYG A;  2IHQ A;  3GD2 A;  4XHD A;  4A4W A;  2AMB A;  3B3K A;  3P89 A;  3GYU A;  3R5M A;  3HVL A;  4ZO1 X;  3M7R A;  4J5X C;  5H1E A;  3D90 A;  1UPW A;  1KKQ A;  1XVP A;  2J7X A;  2AA2 A;  1XP6 A;  3B0R A;  4OZT U;  2XYJ A;  1L2I A;  2Q7K A;  3WT7 A;  3BQD A;  4LBD A;  2P15 A;  4DMA A;  2R40 D;  4DM8 A;  1OSV A;  2ZK2 A;  1XDK B;  1YMT A;  1BSX A;  2ZNP A;  3GBK A;  4KZM A;  4OJB A;  5L7E A;  4PLE A;  5FQR A;  2B50 A;  3MNE A;  4MG7 A;  4S0T A;  3KPZ A;  4HEE X;  4M8H A;  3WGP A;  2NXX E;  3H0A D;  5APH A;  5DI7 A;  1OVL A;  5DXR A;  2GP7 A;  3S9S A;  1G2N A;  1S9P A;  4J5X A;  3RLJ A;  1XB7 A;  3H52 A;  2ZK3 A;  3CLD A;  2Q60 A;  2E2R A;  4IA2 A;  5GT4 A;  4IA1 A;  3VRT A;  5DX3 A;  3W0A A;  2Q5G A;  2XYX A;  3ADX A;  3VRW A;  4OLM A;  2AX8 A;  3ADT A;  4N8R A;  4JGV A;  3VN2 A;  3OOK A;  2YFE A;  1PQC A;  2YJD A;  3VT9 A;  2ZXM A;  3CDP A;  2B1Z A;  4J24 A;  4P6W A;  2HB7 A;  5DZ3 A;  4OAR A;  2AM9 A;  5AYG A;  3RUT A;  4APU A;  2YLQ A;  2XHS A;  4CI5 A;  1RKG A;  4ZNH A;  2HWR A;  5JJM A;  4KZJ A;  3DCT A;  3OS9 A;  4S15 A;  1X7E A;  3HO0 A;  3UVV B;  5HJP A;  1S0X A;  3W0I A;  4OZR E;  3BC5 A;  4PP3 A;  2J4A A;  4TV1 B;  5E15 A;  2JJ3 A;  2VV1 A;  3W5T A;  3CQV A;  2AX6 A;  4YT1 A;  5KR9 A;  2Q5P A;  1U3R A;  3ILZ A;  4IV4 A;  4OZR U;  4ITF A;  5DMF A;  3K23 A;  1Z5X E;  5DUE A;  3AZ1 A;  2ZBS A;  4OIU A;  4QM0 A;  5E0W A;  1Z5X U;  4WHG A;  3ZQT A;  1TFC A;  5KCD A;  3ERD A;  5F9B A;  1VJB A;  1M13 A;  4MG5 A;  3AZ3 A;  2ZMJ A;  5DWE A;  1N4H A;  2PIO A;  5AVL A;  4G21 A;  1FM6 D;  4MGD B;  1NRL A;  2AA7 A;  4OEA A;  4DOR A;  5DXB A;  1XAP A;  1PCG A;  2P7A A;  2ZLC A;  3VSP A;  1Y0S A;  4UDA A;  1N46 A;  1NHZ A;  5KCT A;  2Q6J A;  3L03 A;  4JYI A;  4S0S A;  3UP0 A;  3FXV A;  3W5Q A;  4Q13 A;  4MGC A;  3OMM A;  2BJ4 A;  2AO6 A;  2O4J A;  4G1Z A;  5DZ0 A;  4UDB A;  3A78 A;  1YJE A;  1K74 A;  2GWX A;  3KYT A;  1Y0X X;  1T7F A;  5IAW A;  3WFG A;  2YLO A;  4MG8 A;  4FNE A;  3R8I A;  2QA8 B;  2AA5 A;  4MG6 A;  2NV7 A;  3VT3 A;  5FQT A;  2I0G A;  3AX8 A;  3RY9 A;  5DIG A;  2R6Y A;  1FM9 D;  3B66 A;  3PRG A;  4POH A;  4RZE A;  1E3G A;  5HYR A;  2OAX A;  1XPC A;  1NDE A;  5G43 A;  1X7J A;  3E00 A;  2XKW A;  3NOA A;  3VTB A;  2P1U A;  2VV4 B;  4PVU A;  3F7D A;  3B5R A;  2QXS A;  1S0Z A;  1UHL B;  4XT9 A;  2AMA A;  1XNX A;  2HVC A;  5DKS A;  3JZB A;  1IE9 A;  4OKW A;  2LBD A;  4NY9 A;  2VV0 A;  1XDK A;  2HAM A;  2PJL A;  3FEJ A;  5DID A;  3Q95 B;  3FS1 A;  4REE A;  2HWQ A;  3OZJ A;  1MVC A;  1NUO A;  4PRG A;  5C4S A;  3VT6 A;  3VT5 A;  2W8Y A;  4ZJW A;  3TKM A;  3R29 A;  1QKU A;  2I4Z A;  2R40 A;  4G2H A;  3G9E A;  3OZ0 A;  4K7A A;  4OK1 A;  2QSE A;  3ET0 A;  4Q50 A;  5K13 A;  2VSR A;  3DT3 A;  5KCC A;  3OKI A;  3PLZ A;  4X1F A;  1NQ7 A;  3L3X A;  3E7C A;  4JL4 A;  5G3J A;  3H0A A;  5KCF A;  3HLV A;  3PBA A;  3NSQ A;  3CS4 A;  4EM9 A;  3CDS A;  5DTV A;  3V3E A;  2JFA B;  4OFR A;  4WLB A;  1RDT D;  1U3Q A;  1YIM A;  4ZN7 A;  4ZNT A;  3G8I A;  2ZLA A;  1ZKY A;  3L0L A;  3VTC A;  1ILH A;  3L0J A;  4ZJR A;  2ZK5 A;  5E19 A;  1S9Q A;  3BEJ A;  5EC9 A;  4ZOM A;  5CJ6 A;  3U9Q A;  3VJI A;  4NUF A;  4IW8 A;  4ZNW A;  3VHW A;  5DXE A;  4CSJ A;  2GPO A;  3B65 A;  4KZI A;  5EI1 A;  3UUC A;  1KNU A;  1T7T A;  2VV3 A;  3IA6 A;  5KYA A;  1T7M A;  2P7Z A;  2Q1H A;  3RUU A;  4OZT E;  3GZ9 A;  4RZG A;  2FAI A;  3V9V A;  3IPS A;  5HYK A;  3B0W A;  5FQS A;  5FQV A;  3UVV A;  3TKC A;  2YJA B;  3ZRA A;  2HB8 A;  5C4O A;  4TV1 A;  3A9E B;  2OVM A;  5DZH A;  2VV2 A;  5JJM B;  1LV2 A;  3HC5 A;  4P6X A;  1FCX A;  1R20 D;  3NSP A;  3K22 A;  1EXX A;  5LWP A;  5A86 A;  2PIT A;  4N1Y A;  5G46 A;  1U3S A;  1OT7 A;  4L98 A;  3AN3 A;  2PIU A;  1YIN A;  3WJ5 A;  2AX9 A;  1PDU A;  5E7V A;  1XOW A;  4MGD A;  1P8D A;  5KRI A;  1R6G A;  3L3Z A;  3DR1 A;  2F4B A;  1ZH7 A;  1SQN A;  2GTK A;  4UDD A;  4ZN9 A;  4N5G A;  4OEZ A;  4DM6 A;  1T76 A;  2PIN A;  2AAX A;  4DK8 A;  5HCV A;  1FM6 A;  5DZI A;  4HLW A;  4FHH A;  2BAW A;  4S14 A;  5EGV A;  1NAX A;  3T03 A;  3WT6 A;  2P54 A;  1XV9 B;  3G8O A;  3KDU A;  3CS6 A;  4OGH A;  5HJS A;  1P93 A;  1TXI A;  2IOK A;  2J14 A;  2QA8 A;  2ZNN A;  4JYH A;  5DXG A;  3W0G A;  4ZI1 A;  2Z4B A;  3W0C A;  5DWJ A;  3WTQ A;  3W0Y A;  2QE4 A;  3EYB A;  3FLI A;  5KD9 A;  2HAR A;  3P88 A;  4OHA A;  4UDC A;  3A40 X;  4RME A;  3R8A A;  2GPP A;  2VV4 A;  3IXP D;  1R1K D;  2GPU A;  2P4Y A;  4F9M A;  3OS8 C;  3GWX A;  2PIR A;  3KBA A;  3R5N A;  1FM9 A;  1UHL A;  5DKG A;  2ZFX A;  1DB1 A;  5DSH A;  2PRG A;  4X1G A;  3UUA B;  4G1D A;  4REF A;  5AK2 A;  5AAU A;  1G50 A;  3WWR A;  1RKH A;  4ZNU A;  1YOW A;  3Q95 A;  4RMD A;  4YPQ A;  5APK A;  4RUP A;  5AVI A;  2GPV A;  3CWD A;  2OM9 A;  1FCZ A;  2QXM A;  5DUH A;  5DXK A;  3UU7 B;  3MNP A;  3E94 A;  3A2J A;  2ZAS A;  3ADS A;  3HOD A;  4A2J A;  2IOG A;  5DV6 A;  3FEI A;  3B68 A;  3FUR A;  4R2U A;  2H79 A;  3OS8 A;  5M96 A;  1ZEO A;  2HFP A;  2ZK4 A;  2YAT A;  4LSJ A;  4RWV A;  3G0W A;  2ABI A;  2JFA A;  2JF9 A;  3N00 A;  1YP0 A;  4QK4 A;  1ZGY A;  2Q7L A;  2V7C A;  4YNK A;  1QKM A;  3VHU A;  1ILG A;  5L11 A;  2NW4 A;  3CS8 A;  4LTW A;  5IZ0 A;  1E3K A;  1DKF B;  2Q8S A;  4IVW A;  4XLD A;  2YHD A;  3O1E A;  3VT8 A;  2P1T A;  5DYD A;  5G45 A;  3VTD A;  4PPS A;  2QNV A;  4YMQ A;  2ACL B;  3KMZ A;  1GWQ A;  3OLS A;  4MGB B;  5FQP A;  5LGA A;  5ETH A;  3ET3 A;  2Q7I A;  3PO9 A;  2QR9 A;  3A2I A;  3VJT A;  1MV9 A;  1XLS A;  5ACC A;  1T5Z A;  2PIW A;  5DRM A;  1G1U A;  3GYT A;  3GN8 A;  1M7W A;  4IVY A;  3A9E A;  4E4K A;  1PZL A;  4BCR A;  2ZNQ A;  2ZXZ A;  1A52 A;  1ZDT A;  3OMK A;  4XTA A;  3X1H A;  3X36 A;  2ZL9 A;  2O4R A;  3HQ5 A;  4J5W C;  4OKB A;  3X31 A;  4OC7 A;  1T7R A;  4G2I A;  2Q6S A;  3AFR A;  4IS8 A;  1ERR A;  2AYR A;  4K6I A;  5AAV B;  3WFF A;  3OKH A;  5DIE A;  2POB A;  2Q3Y A;  2B1V A;  1FD0 A;  3KMR A;  4ZNS A;  4PLD A;  3OLF A;  5AWK A;  5AZV A;  2POG A;  2QPY A;  5DYB A;  4QL8 A;  5E14 A;  3DZY D;  2G0H A;  4DQM A;  1ZDU A;  5KRM A;  2FSZ A;  5DRJ A;  5DWG A;  2ZMI A;  2QZO B;  4OIV A;  2XYW A;  5DKE A;  3WJ4 A;  4EMA A;  4NIE A;  3B0Q A;  3RLL A;  2AXA A;  4O8F A;  1XV9 A;  4J5W A;  5DVS A;  3HM1 A;  4OJ4 A;  3DZU D;  4IUI A;  5DXM A;  2QA6 A;  4DK7 A;  3OLL A;  4B7W A;  4IW6 A;  2PIV A;  3TX7 B;  4LNW A;  1YOK A;  3WT5 A;  2I4J A;  3ADW A;  5DKB A;  3VJS A;  4DOS A;  5L7G A;  5KRL A;  4XI3 A;  4WHF A;  1NQ1 A;  1XQ3 A;  3JZC A;  4ITE A;  5DLR A;  3V4A A;  4PPP A;  5DXP A;  4IU7 A;  1UOM A;  5EJV A;  2R6W A;  5B41 A;  2H77 A;  2PIP L;  4XUM A;  4RUJ A;  3UUA A;  1G5Y A;  3V49 A;  1YY4 A;  3IXP A;  4OH5 A;  1R1K A;  2QGW A;  4NB6 A;  3RVF A;  3FC6 B;  3A3Z X;  3X1I A;  1YYE A;  4OEY A;  3FUG A;  1YUC A;  3UU7 A;  2ATH A;  4ZO1 B;  1WM0 X;  1T65 A;  4E4Q A;  4MG9 B;  4IV2 A;  5DWL A;  2AB2 A;  1HG4 A;  4TUZ B;  1X78 A;  5DMC A;  1K7L A;  5DZ1 A;  3LBD A;  3KWY A;  2OCF A;  2PIX A;  2ZMH A;  3CTB A;  1XJ7 A;  3IMY A;  1ZUC A;  1Q4X A;  4IA7 A;  4PP6 A;  3VT4 A;  5KRK A;  2AWH A;  3OAP A;  3LMP A;  3OOF A;  2Q7J A;  1T73 A;  1X7B A;  3UUD B;  2ZY0 A;  5DUG A;  4JAZ A;  1DKF A;  1K4W A;  3B1M A;  3FAL B;  5JY3 A;  1X7R A;  5B5B A;  4RZF A;  1YA3 A;  4OKX A;  3IPQ A;  4QE6 A;  5KRJ A;  2ACL A;  3ET1 A;  4OJ9 A;  1SR7 A;  5GID A;  3R8D A;  1GS4 A;  3F5C B;  4MGB A;  5ICK A;  1EXA A;  5DVV A;  2G44 A;  3AUN A;  4R6S A;  2ZXN A;  4RAK A;  5EIT A;  2OVH A;  5KCE A;  4ZNV A;  1LBD A;  3K6P A;  2ZNO A;  1PK5 A;  4FGY A;  3HC6 A;  3OSA A;  3V9T A;  1NQ0 A;  3D5F A;  5GIC A;  2Z4J A;  4IWC A;  1GWX A;  4CI4 A;  2HBH A;  1M2Z A;  1T79 A;  2Q70 A;  3PEQ A;  3ZR7 A;  4MGA B;  5APJ A;  2HC4 A;  3R2A A;  2G0G A;  4RMC A;  5L7H A;  2VST A;  4OIL A;  5AZT A;  3CJW A;  4QJR A;  4A4V A;  5G5W A;  2B23 A;  3UP3 A;  5DU5 A;  5AAV A;  4NQA B;  4FN9 A;  2YLP A;  1XLS E;  1MZN A;  4Q0A C;  4M8E A;  3DY6 A;  2Q59 B;  4R06 A;  2HAS A;  2I0J A;  3AUQ A;  4QE8 A;  5DP0 A;  3VI8 A;  3ZRB A;  2AA6 A;  2QMV A;  2ZK0 A;  1XQC A;  1QKN A;  1S19 A;  5DV8 A;  5DK9 A;  1XP9 A;  2QGT A;  3HZF A;  2Q61 A;  1XIU A;  2QZO A;  1L2J A;  4FHI A;  1T74 A;  5SYZ A;  3IPU A;  2NXX A;  3ADV A;  5KRO A;  4G1Y A;  3DZY A;  4LNX A;  1NAV A;  5HZC A;  1XVP B;  4PP5 A;  3OMP A;  3D57 A;  3OSI A;  3P0U A;  3VRU A;  3W5P A;  2NPA A;  4RE8 A;  2QW4 A;  3O1D A;  3DCU A;  4N73 A;  3SP9 A;  3L0E A;  4PXM A;  3OGT A;  3SZ1 A;  1H9U A;  2QH6 A;  5DWI A;  1RDT A;  4K4J A;  4WVD A;  5G44 A;  1FCY A;  5KRF A;  3DZU A;  1NQ2 A;  3D24 A;  3W0J A;  2I4P A;  4IWF A;  3MNO A;  4MG7 B;  5KRH A;  1GWR A;  2GIU A;  1NYX A;  1OVL B;  4OFU A;  4ONI A;  3SP6 A;  4J26 A;  2V0V A;  1T63 A;  1SJ0 A;  3VT7 A;  3P8X A;  1Z95 A;  1HJ1 A;  3FC6 A;  1I38 A;  3V3Q A;  4PWL A;  2AX7 A;  5DV3 A;  4IA3 A;  2ZK6 A;  2YLY A;  4G20 A;  3ET2 A;  5KRA A;  4OH6 A;  1FBY A;  4L96 A;  1QKT A;  1U9E A;  2O9I A;  2EWP A;  5DX3 B;  3VJH A;  4XUH A;  2Q1V A;  1RJK A;  4MG9 A;  3OSW A;  4WQP A;  2J7Y A;  4TUZ A;  5DVC A;  3B67 A;  3L1B A;  3VHV A;  1R20 A;  3KFC A;  1XZX X;  1XP1 A;  1Y9R A;  3QT0 A;  2P1V A;  2Q6R A;  4OED A;  1ERE A;  2FVJ A;  2PNU A;  3UUD A;  2ZK1 A;  5DL4 A;  1I7I A;  3KDT A;  5E1C A;  4RUO X;  3FAL A;  4MDD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...