5KCDA

Crystal structure of the er-alpha ligand-binding domain (y537s) in complex with an n-methyl substituted obhs-n derivative
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
244
structure length
231
Chain Sequence
SLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLSDLLLEMLDAHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Estrogen receptor
publication title Full antagonism of the estrogen receptor without a prototypical ligand side chain.
pubmed doi rcsb
source organism Homo sapiens
total genus 92
structure length 231
sequence length 244
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 5kcdA00
4RZEA 2HB8A 2POGA 1S9PA 4OJ9A 4IA1A 1X7BA 5KCCA 3PLZA 4ZNSA 2AYRA 4EM9A 5KD9A 3W5PA 2VV4B 2GPUA 2V0VA 1R5KA 4FHHA 3RLLA 1YA3A 2O4RA 3ET3A 5DL4A 2ZLAA 5EHJA 4OJ4A 2HAMA 4X1GA 1RKGA 3GWXA 4IVWA 3L03A 3V4AA 3VTCA 3VTDA 5DIEA 3B5RA 2ACLA 4KZIA 3KMGA 2P1VA 2ATHA 4REEA 4NIEA 1OSHA 3L0LA 1LV2A 3TKCA 3W5TA 3KMRA 3AN3A 1XOWA 2ZK6A 5FQVA 5G3JA 3W0GA 1H9UA 3IMYA 4J5XA 4MG7A 1SR7A 2I0JA 5DKEA 5C4SA 2QE4A 5GIDA 2NXXA 1FM6D 1RDTA 4Y29A 3AFRA 4RMCA 2ZK2A 4R06A 1TXIA 4ZO1X 5DXKA 2P54A 2ZXZA 4S14A 4JL4A 2AXAA 3VHUA 5KRMA 4OZRE 3QT0A 5DYDA 1T74A 2I0GA 2H77A 4WHFA 5DUHA 2QMVA 3PRGA 1N83A 1FM9D 3KDUA 2GTKA 3E94A 3A2HA 2BJ4B 2Q7KA 4N8RA 1XNXA 1ILGA 4POJA 2XYXA 1YMTA 2VSRA 3CJWA 3OZJA 4QE8A 1HG4A 5DWGA 3UP3A 1S0ZA 1XQ3A 4YMQA 4OH6A 3WT5A 5FQPA 4DQMA 3GZ9A 1YY4A 3R8DA 3M7RA 4LTWA 5AYGA 2Q60A 5HCVA 3UVVB 5KRIA 3DCTA 3B0RA 5E0XA 5KRAA 5AAVA 1FCXA 3B66A 2Q5SA 4APUA 1G5YA 4UDDA 2G0HA 3TX7B 3P88A 1QKMA 4IV4A 4ZI1A 5ICKA 2QTUA 1U3RA 5ETHA 1MVCA 5KCUA 5AWKA 5KCWA 2PIPL 4OEYA 1NAVA 2R40D 5DVVA 3MNPA 5DX3A 1U9EA 5DP0A 3A9EA 4Q50A 2AA6A 2GIUA 5JJMA 1ZUCA 3KDTA 2Q8SA 4OKXA 4RZGA 3B65A 5DV6A 2JFAB 2XYJA 3OS8C 4RMEA 1T7TA 1ZGYA 5EJVA 3ERDA 4POHA 5AVLA 1XNNA 1PQ6A 1OT7A 5KRFA 4FGYA 4E4KA 3UUAA 1ZAFA 2PJLA 4FN9A 1K7LA 2QZOA 1YINA 1IE9A 3FURA 2QABA 3HC6A 2YLOA 4G2IA 5DIGA 3ZRAA 1R1KD 5HJPA 3PCUA 3ILZA 5DLRA 4PP6A 3V3EA 4OZRU 4PLDA 4J5WA 3VRWA 3HO0A 4PWLA 3E00D 2ZXMA 3ADUA 2HWRA 5GIEA 3OMKA 3OMMA 2O9IA 3DCUA 4MGDA 4OC7A 3VRTA 3VSPA 3SZ1A 4A2JA 3DR1A 3OZ0A 2OM9A 2Q5PA 4OIUA 1E3KA 1XAPA 5DIDA 4ZNTA 4R2UA 4UDCA 1NQ2A 2Q6JA 3OKHA 4LNWA 5KROA 4DM6A 4M8EA 2AA5A 3K22A 4BCRA 2PIQA 3ADVA 5G45A 5HYKA 2NV7A 1UPWA 2OVMA 1EREA 3ZRBA 3X1IA 5A86A 1NDEA 1X78A 3WTQA 4UDAA 2QR9A 5AK2A 1DKFA 3B0TA 4RWVA 1NRLA 3K6PA 1ZKYA 3OLSA 1GWRA 1R20D 4FHIA 1E3GA 2ACLB 2AAXA 4PVUA 1NQ7A 3MNOA 3D57A 3KYTA 2GL8A 5M96A 2P1TA 3AURA 4WLBA 2H79A 1MV9A 1XJ7A 2G5OA 2QNVA 3A2IA 4IS8A 3OS9A 4MG7B 1SKXA 2YFEA 3ET0A 2OZ7A 2AX9A 1NYXA 1K74A 2AA7A 3AN4A 1PQCA 1G50A 1I7IA 1I37A 5DKSA 5KRKA 5EGVA 1UHLA 1XP1A 4S0TA 4WQPA 3LMPA 2P15A 3AZ3A 3R2AA 2Q59B 3FEJA 4UDBA 3TY0A 1K4WA 2QW4A 5KCEA 1OVLA 1OSVA 4ZNVA 5DYBA 3OMOA 3OOKA 3R8AA 3CS8A 2AWHA 2J7XA 3VJTA 3H0AA 5G46A 3FXVA 2IOGA 4TUZA 4IWFA 3R5NA 1KV6A 2AO6A 4EMAA 5APJA 3CWDA 5AAUA 1Z95A 2P1UA 4G20A 4PP5A 2R6WA 3G8OA 2HC4A 5H1EA 4IA2A 5L11A 1T7FA 3FC6A 5E19A 1ERRA 3VT7A 4OKWA 4MG9A 4QK4A 2OAXA 2ZMJA 5JI0D 5FQTA 3B0QA 5AAVB 5DXGA 1U3SA 5AWJA 5KCDA 2Q6SA 4IA7A 2NW4A 4N1YA 4IQRA 1FCYA 4Q0AC 1FBYA 3VT6A 2VV1A 2ZBSA 3OOFA 5G42A 2Q61A 2QA6A 5DWEA 5DX3B 3A9EB 2REWA 3FS1A 2ABIA 2Q5GA 5JJMB 1L2JA 2HBHA 1YUCA 5DUGA 2J14A 4OFUA 2Q59A 4ZNUA 1XDKA 3UUAB 2QZOB 1LBDA 3X1HA 2B23A 1YOWA 3ADSA 3B68A 1UPVA 1X7JA 5DTVA 5DVSA 1DB1A 2QGWA 3AUQA 3CS6A 2AMAA 3GYUA 4OILA 5HJPB 3NSPA 5KRHA 5KCTA 4R6SA 3DY6A 3EYBA 3NSQA 1T63A 2PIWA 4MGCA 1M7WA 5KRJA 2R6YA 3VSOA 1HJ1A 2B1VA 2I4PA 4MGDB 3WJ4A 1X76A 5LWPA 4IU7A 3UUDB 1S0XA 4IW6A 5DUEA 3DT3A 2HCDA 5L7EA 1ILHA 1NUOA 3ZQTA 4XTAA 4MG6A 3VJHA 2OVHA 5DRJA 3VN2A 4DMAA 5IAWA 2HFPA 4P6WA 2J7YA 4J26A 1I7GA 3CQVA 3VT5A 1XV9A 2ZNOA 2HVCA 3KPZA 3W0IA 3W0JA 4RAKA 2FSZA 1DKFB 2I4JA 1XLSA 2QH6A 2NPAA 1NAXA 3IPSA 5FQSA 1XQCA 3VI8A 2NXXE 4JYHA 5DXMA 4QM0A 2PIOA 4ZNWA 5DWIA 3DZUA 4WVDA 3ET2A 2ZASA 3A2JA 1QKTA 3FALA 4WPFA 4XUMA 4TV1A 5DU5A 3VT3A 3R8IA 3PBAA 1IE8A 3RLJA 4DM8A 5DWLA 3KWYA 3RUUA 4J24A 1ZH7A 1RK3A 2QGTA 4ONIA 2I4ZA 4XAOA 5E14A 2EWPA 1UOMA 5DWJA 3OKIA 1T7RA 2XKWA 3OLFA 1UHLB 1T65A 2AA2A 5C4OA 2Q7IA 5DZIA 4E2JA 4YT1A 3E00A 2YLYA 2G44A 3UUDA 2Q7LA 1U3QA 4IWCA 5DZ0A 3HM1A 1OVLB 4N73A 4G2HA 5DKGA 5L7GA 2GPPA 3LBDA 2GPOA 3WGPA 4E4QA 3P89A 2ZFXA 3FEIA 3L0JA 4TUZB 3RUTA 3UU7A 5G44A 1XVPA 3S9SA 5HJSA 2YJAB 3P8XA 4OJBA 3DZYA 4IVYA 2AM9A 4LNXA 3FC6B 1GWXA 4MG5A 4CI4A 5DXBA 4MG8A 3GD2A 3R29A 4MG9B 4MGBA 3AZ1A 4RUOX 1T7MA 5ACCA 5KCFA 2A3IA 5K13A 5E7VA 2QXMA 4OH5A 2QXSA 5DVCA 3V49A 4HEEX 4OEZA 4PPPA 3D6DA 3VRUA 2Q3YA 2VV1B 3X31A 1RJKA 1T5ZA 3GN8A 3R5MA 3WT7A 5DKBA 4F9MA 4JAZA 3WMHA 2PITA 2YATA 3CTBA 4B7WA 1WM0X 1ZDTA 1T76A 1Z5XE 4HLWA 2GP7A 2G0GA 5IZ0A 3N00A 5I4VA 3IXPA 1XDKB 1BSXA 2POBA 3TKMA 3V3QA 3G8IA 1A52A 1X7RA 2O4JA 5GT4A 2F4BA 2XYWA 3RY9A 4L96A 3VJSA 1K74D 4REFA 1XPCA 4YNKA 5KYAA 3OMQA 2B1ZA 3OMPA 2YLQA 4DORA 3OSAA 5APHA 2PIRA 1XP6A 4L98A 1YYEA 3RVFA 2ZNNA 4OHAA 1NQ0A 4ZN9A 2BAWA 4XHDA 1Y0SA 2ZK3A 3VT9A 3VJIA 4IW8A 4A4VA 4QE6A 4KZJA 4ITFA 2ZNPA 1N46A 4WHGA 3HVLA 4IUIA 4OGHA 3BQDA 1PK5A 2XHSA 1QKUA 2JF9A 2Q70A 3L3ZA 3OLLA 3OAPA 4ZOMA 2OUZA 1XV9B 4OEAA 3BEJA 4ITEA 4X1FA 4S0SA 4DK8A 4Q13A 4RE8A 3W0YA 1T73A 2ZMHA 3F5CA 3HC5A 4ZN7A 2QPYA 3D24A 4O8FA 5DXQA 2P7AA 3A3ZX 1FM6A 1GS4A 2QA8A 3HLVA 4MGAA 1S9QA 3KMZA 3T03A 5IXKA 5DXEA 4ZO1B 5DZ3A 3OS8A 4OK1A 1Y9RA 1SQNA 3CDPA 3FALB 4LBDA 1NQ1A 4TV1B 5JY3A 4OIVA 5E15A 5KR9A 3WT6A 1Y0XX 4NQAB 4XT9A 1QKNA 2V7CA 4OZTE 1FM9A 2PIXA 2ZK4A 3L0EA 3FLIA 1RDTD 1Z5XU 4M8HA 2LBDA 3VHVA 3ET1A 5DZ1A 5KRLA 5G43A 1XZXX 3ADWA 3NOAA 1P8DA 5C4UA 3VT8A 3WJ5A 4MDDA 1A28A 4G21A 2B50A 5F9BA 2GWXA 1T79A 2PIVA 4XI3A 3CLDA 2AMBA 3Q95A 3PO9A 4G1YA 2IOKA 5GICA 3V9TA 1YJEA 4NUFA 3U9QA 5B5BA 2P7ZA 3L1BA 3UU7B 3W0HA 5DXRA 1XVPB 4JYIA 3SP9A 2Q1HA 4OKBA 5DV3A 2YLPA 4PF3A 2PKLA 4OFRA 5G5WA 5DXBB 5HZCA 2PNUA 3GYTA 2ZXNA 4MG8B 4OEDA 1G1UA 4MGBB 1Q4XA 1PDUA 2HASA 2HARA 1XP9A 2R40A 2VV4A 3B0WA 3H52A 3F7DA 4OLMA 1L2IA 5DMFA 3VRVA 3G9EA 3GWSX 5L7HA 3D90A 1ZDUA 3K8SA 4RZFA 5DI7A 5EITA 3UUCA 1FD0A 4DOSA 5DRMA 3L3XA 4S15A 1ZEOA 4J5XC 3O1DA 3AZ2A 3AX8A 4OARA 1R1KA 4CI5A 3JZCA 5FQRA 4G1DA 2P7GA 3HODA 2Q6RA 3B3KA 2VV0A 3W0AA 5HYRA 5AZVA 2AB2A 1TFCA 5APKA 3DZUD 4JYGA 4LSJA 4PP3A 4K7AA 4OZTU 4XLDA 3VHWA 1PZLA 4K4JA 2VV2A 4OKTA 4QJRA 1YIMA 3KFCA 5E1CA 4ZJRA 3UP0A 3GBKA 4PPSA 4RFWA 5DY8A 3X36A 3JZBA 3OSWA 3MNEA 4FNEA 4PRGA 2BJ4A 3W5RA 3WFFA 4ZNHA 1GWQA 2E2RA 1KNUA 4G1ZA 2Q7JA 3B1MA 3WWRA 5CJ6A 2VSTA 3OGTA 4JGVA 3W0CA 1VJBA 2Z4JA 5LGAA 4PLEA 1PCGA 1YOKA 3E7CA 1PRGA 3O1EA 1XLSE 1SJ0A 5AZTA 3HZFA 5DZHA 2OCFA 4PXMA 1R20A 1XIUA 2ZMIA 3UVVA 3PEQA 5KYJA 3G0WA 1PQ9A 4YPQA 2ZNQA 2Z4BA 2P4YA 3DZYD 5E0WA 5EI1A 4RUJA 3ADTA 3VT4A 1M2ZA 3F5CB 5KRCA 4RUPA 1XB7A 2PRGA 3CDSA 2QA8B 4K6IA 3D5FA 3IPQA 4MGAB 4ZJWA 2ZY0A 2VV3A 1YP0A 3FUGA 3V9VA 1FCZA 1S19A 3IA6A 3K23A 4IA3A 2ZL9A 2HWQA 2ZVTA 3A40X 3ADXA 5SYZA 4DK7A 4QL8A 3HQ5A 3VTBA 2PINA 2JFAA 5B41A 2QSEA 2ZK1A 1I38A 2FAIA 4N5GA 5EC9A 4CSJA 3ZR7A 4A4WA 3A78A 3V9YA 4NY9A 3IPUA 4KZMA 2YJDA 2ZK0A 2IHQA 2AX8A 2ZK5A 1EXXA 1NHZA 2Q1VA 3CS4A 5DV8A 2HB7A 4J5WC 1R6GA 3P0UA 3ERTA 1KKQA 1G2NA 2W8YA 5DK9A 3AUNA 1EXAA 2J4AA 3WFGA 2ZKCA 3B67A 3IXPD 2ZLCA 5C4TA 1P93A 4P6XA 5DXPA 1RKHA 3KBAA 4XUHA 3Q95B 4NB6A 2AX6A 5AVIA 4IV2A 4RMDA 2GPVA 3H0AD 2JJ3A 2FVJA 2YHDA 5DMCA 5DSHA 3SP6A 1N4HA 2PIUA 1MZNA 1M13A 3BC5A 3OSIA 3W5QA 2AX7A 1X7EA
chains in the Genus database with same CATH superfamily
4RZEA 2HB8A 2POGA 1S9PA 4OJ9A 4IA1A 1X7BA 5KCCA 3PLZA 4ZNSA 2AYRA 4EM9A 5KD9A 3W5PA 2VV4B 2GPUA 2V0VA 1R5KA 4FHHA 3RLLA 1YA3A 2O4RA 3ET3A 5DL4A 2ZLAA 5EHJA 4OJ4A 2HAMA 4X1GA 1RKGA 3GWXA 4IVWA 3L03A 3V4AA 3VTCA 3VTDA 5DIEA 3B5RA 2ACLA 4KZIA 3KMGA 2P1VA 2ATHA 4REEA 4NIEA 1OSHA 3L0LA 1LV2A 3TKCA 3W5TA 3KMRA 3AN3A 1XOWA 2ZK6A 5FQVA 5G3JA 3W0GA 1H9UA 3IMYA 4J5XA 4MG7A 1SR7A 2I0JA 5DKEA 5C4SA 2QE4A 5GIDA 2NXXA 1FM6D 1RDTA 4Y29A 3AFRA 4RMCA 2ZK2A 4R06A 1TXIA 4ZO1X 5DXKA 2P54A 2ZXZA 4S14A 4JL4A 2AXAA 3VHUA 5KRMA 4OZRE 3QT0A 5DYDA 1T74A 2I0GA 2H77A 4WHFA 5DUHA 2QMVA 3PRGA 1N83A 1FM9D 3KDUA 2GTKA 3E94A 3A2HA 2BJ4B 2Q7KA 4N8RA 1XNXA 1ILGA 4POJA 2XYXA 1YMTA 2VSRA 3CJWA 3OZJA 4QE8A 1HG4A 5DWGA 3UP3A 1S0ZA 1XQ3A 4YMQA 4OH6A 3WT5A 5FQPA 4DQMA 3GZ9A 1YY4A 3R8DA 3M7RA 4LTWA 5AYGA 2Q60A 5HCVA 3UVVB 5KRIA 3DCTA 3B0RA 5E0XA 5KRAA 5AAVA 1FCXA 3B66A 2Q5SA 4APUA 1G5YA 4UDDA 2G0HA 3TX7B 3P88A 1QKMA 4IV4A 4ZI1A 5ICKA 2QTUA 1U3RA 5ETHA 1MVCA 5KCUA 5AWKA 5KCWA 2PIPL 4OEYA 1NAVA 2R40D 5DVVA 3MNPA 5DX3A 1U9EA 5DP0A 3A9EA 4Q50A 2AA6A 2GIUA 5JJMA 1ZUCA 3KDTA 2Q8SA 4OKXA 4RZGA 3B65A 5DV6A 2JFAB 2XYJA 3OS8C 4RMEA 1T7TA 1ZGYA 5EJVA 3ERDA 4POHA 5AVLA 1XNNA 1PQ6A 1OT7A 5KRFA 4FGYA 4E4KA 3UUAA 1ZAFA 2PJLA 4FN9A 1K7LA 2QZOA 1YINA 1IE9A 3FURA 2QABA 3HC6A 2YLOA 4G2IA 5DIGA 3ZRAA 1R1KD 5HJPA 3PCUA 3ILZA 5DLRA 4PP6A 3V3EA 4OZRU 4PLDA 4J5WA 3VRWA 3HO0A 4PWLA 3E00D 2ZXMA 3ADUA 2HWRA 5GIEA 3OMKA 3OMMA 2O9IA 3DCUA 4MGDA 4OC7A 3VRTA 3VSPA 3SZ1A 4A2JA 3DR1A 3OZ0A 2OM9A 2Q5PA 4OIUA 1E3KA 1XAPA 5DIDA 4ZNTA 4R2UA 4UDCA 1NQ2A 2Q6JA 3OKHA 4LNWA 5KROA 4DM6A 4M8EA 2AA5A 3K22A 4BCRA 2PIQA 3ADVA 5G45A 5HYKA 2NV7A 1UPWA 2OVMA 1EREA 3ZRBA 3X1IA 5A86A 1NDEA 1X78A 3WTQA 4UDAA 2QR9A 5AK2A 1DKFA 3B0TA 4RWVA 1NRLA 3K6PA 1ZKYA 3OLSA 1GWRA 1R20D 4FHIA 1E3GA 2ACLB 2AAXA 4PVUA 1NQ7A 3MNOA 3D57A 3KYTA 2GL8A 5M96A 2P1TA 3AURA 4WLBA 2H79A 1MV9A 1XJ7A 2G5OA 2QNVA 3A2IA 4IS8A 3OS9A 4MG7B 1SKXA 2YFEA 3ET0A 2OZ7A 2AX9A 1NYXA 1K74A 2AA7A 3AN4A 1PQCA 1G50A 1I7IA 1I37A 5DKSA 5KRKA 5EGVA 1UHLA 1XP1A 4S0TA 4WQPA 3LMPA 2P15A 3AZ3A 3R2AA 2Q59B 3FEJA 4UDBA 3TY0A 1K4WA 2QW4A 5KCEA 1OVLA 1OSVA 4ZNVA 5DYBA 3OMOA 3OOKA 3R8AA 3CS8A 2AWHA 2J7XA 3VJTA 3H0AA 5G46A 3FXVA 2IOGA 4TUZA 4IWFA 3R5NA 1KV6A 2AO6A 4EMAA 5APJA 3CWDA 5AAUA 1Z95A 2P1UA 4G20A 4PP5A 2R6WA 3G8OA 2HC4A 5H1EA 4IA2A 5L11A 1T7FA 3FC6A 5E19A 1ERRA 3VT7A 4OKWA 4MG9A 4QK4A 2OAXA 2ZMJA 5JI0D 5FQTA 3B0QA 5AAVB 5DXGA 1U3SA 5AWJA 5KCDA 2Q6SA 4IA7A 2NW4A 4N1YA 4IQRA 1FCYA 4Q0AC 1FBYA 3VT6A 2VV1A 2ZBSA 3OOFA 5G42A 2Q61A 2QA6A 5DWEA 5DX3B 3A9EB 2REWA 3FS1A 2ABIA 2Q5GA 5JJMB 1L2JA 2HBHA 1YUCA 5DUGA 2J14A 4OFUA 2Q59A 4ZNUA 1XDKA 3UUAB 2QZOB 1LBDA 3X1HA 2B23A 1YOWA 3ADSA 3B68A 1UPVA 1X7JA 5DTVA 5DVSA 1DB1A 2QGWA 3AUQA 3CS6A 2AMAA 3GYUA 4OILA 5HJPB 3NSPA 5KRHA 5KCTA 4R6SA 3DY6A 3EYBA 3NSQA 1T63A 2PIWA 4MGCA 1M7WA 5KRJA 2R6YA 3VSOA 1HJ1A 2B1VA 2I4PA 4MGDB 3WJ4A 1X76A 5LWPA 4IU7A 3UUDB 1S0XA 4IW6A 5DUEA 3DT3A 2HCDA 5L7EA 1ILHA 1NUOA 3ZQTA 4XTAA 4MG6A 3VJHA 2OVHA 5DRJA 3VN2A 4DMAA 5IAWA 2HFPA 4P6WA 2J7YA 4J26A 1I7GA 3CQVA 3VT5A 1XV9A 2ZNOA 2HVCA 3KPZA 3W0IA 3W0JA 4RAKA 2FSZA 1DKFB 2I4JA 1XLSA 2QH6A 2NPAA 1NAXA 3IPSA 5FQSA 1XQCA 3VI8A 2NXXE 4JYHA 5DXMA 4QM0A 2PIOA 4ZNWA 5DWIA 3DZUA 4WVDA 3ET2A 2ZASA 3A2JA 1QKTA 3FALA 4WPFA 4XUMA 4TV1A 5DU5A 3VT3A 3R8IA 3PBAA 1IE8A 3RLJA 4DM8A 5DWLA 3KWYA 3RUUA 4J24A 1ZH7A 1RK3A 2QGTA 4ONIA 2I4ZA 4XAOA 5E14A 2EWPA 1UOMA 5DWJA 3OKIA 1T7RA 2XKWA 3OLFA 1UHLB 1T65A 2AA2A 5C4OA 2Q7IA 5DZIA 4E2JA 4YT1A 3E00A 2YLYA 2G44A 3UUDA 2Q7LA 1U3QA 4IWCA 5DZ0A 3HM1A 1OVLB 4N73A 4G2HA 5DKGA 5L7GA 2GPPA 3LBDA 2GPOA 3WGPA 4E4QA 3P89A 2ZFXA 3FEIA 3L0JA 4TUZB 3RUTA 3UU7A 5G44A 1XVPA 3S9SA 5HJSA 2YJAB 3P8XA 4OJBA 3DZYA 4IVYA 2AM9A 4LNXA 3FC6B 1GWXA 4MG5A 4CI4A 5DXBA 4MG8A 3GD2A 3R29A 4MG9B 4MGBA 3AZ1A 4RUOX 1T7MA 5ACCA 5KCFA 2A3IA 5K13A 5E7VA 2QXMA 4OH5A 2QXSA 5DVCA 3V49A 4HEEX 4OEZA 4PPPA 3D6DA 3VRUA 2Q3YA 2VV1B 3X31A 1RJKA 1T5ZA 3GN8A 3R5MA 3WT7A 5DKBA 4F9MA 4JAZA 3WMHA 2PITA 2YATA 3CTBA 4B7WA 1WM0X 1ZDTA 1T76A 1Z5XE 4HLWA 2GP7A 2G0GA 5IZ0A 3N00A 5I4VA 3IXPA 1XDKB 1BSXA 2POBA 3TKMA 3V3QA 3G8IA 1A52A 1X7RA 2O4JA 5GT4A 2F4BA 2XYWA 3RY9A 4L96A 3VJSA 1K74D 4REFA 1XPCA 4YNKA 5KYAA 3OMQA 2B1ZA 3OMPA 2YLQA 4DORA 3OSAA 5APHA 2PIRA 1XP6A 4L98A 1YYEA 3RVFA 2ZNNA 4OHAA 1NQ0A 4ZN9A 2BAWA 4XHDA 1Y0SA 2ZK3A 3VT9A 3VJIA 4IW8A 4A4VA 4QE6A 4KZJA 4ITFA 2ZNPA 1N46A 4WHGA 3HVLA 4IUIA 4OGHA 3BQDA 1PK5A 2XHSA 1QKUA 2JF9A 2Q70A 3L3ZA 3OLLA 3OAPA 4ZOMA 2OUZA 1XV9B 4OEAA 3BEJA 4ITEA 4X1FA 4S0SA 4DK8A 4Q13A 4RE8A 3W0YA 1T73A 2ZMHA 3F5CA 3HC5A 4ZN7A 2QPYA 3D24A 4O8FA 5DXQA 2P7AA 3A3ZX 1FM6A 1GS4A 2QA8A 3HLVA 4MGAA 1S9QA 3KMZA 3T03A 5IXKA 5DXEA 4ZO1B 5DZ3A 3OS8A 4OK1A 1Y9RA 1SQNA 3CDPA 3FALB 4LBDA 1NQ1A 4TV1B 5JY3A 4OIVA 5E15A 5KR9A 3WT6A 1Y0XX 4NQAB 4XT9A 1QKNA 2V7CA 4OZTE 1FM9A 2PIXA 2ZK4A 3L0EA 3FLIA 1RDTD 1Z5XU 4M8HA 2LBDA 3VHVA 3ET1A 5DZ1A 5KRLA 5G43A 1XZXX 3ADWA 3NOAA 1P8DA 5C4UA 3VT8A 3WJ5A 4MDDA 1A28A 4G21A 2B50A 5F9BA 2GWXA 1T79A 2PIVA 4XI3A 3CLDA 2AMBA 3Q95A 3PO9A 4G1YA 2IOKA 5GICA 3V9TA 1YJEA 4NUFA 3U9QA 5B5BA 2P7ZA 3L1BA 3UU7B 3W0HA 5DXRA 1XVPB 4JYIA 3SP9A 2Q1HA 4OKBA 5DV3A 2YLPA 4PF3A 2PKLA 4OFRA 5G5WA 5DXBB 5HZCA 2PNUA 3GYTA 2ZXNA 4MG8B 4OEDA 1G1UA 4MGBB 1Q4XA 1PDUA 2HASA 2HARA 1XP9A 2R40A 2VV4A 3B0WA 3H52A 3F7DA 4OLMA 1L2IA 5DMFA 3VRVA 3G9EA 3GWSX 5L7HA 3D90A 1ZDUA 3K8SA 4RZFA 5DI7A 5EITA 3UUCA 1FD0A 4DOSA 5DRMA 3L3XA 4S15A 1ZEOA 4J5XC 3O1DA 3AZ2A 3AX8A 4OARA 1R1KA 4CI5A 3JZCA 5FQRA 4G1DA 2P7GA 3HODA 2Q6RA 3B3KA 2VV0A 3W0AA 5HYRA 5AZVA 2AB2A 1TFCA 5APKA 3DZUD 4JYGA 4LSJA 4PP3A 4K7AA 4OZTU 4XLDA 3VHWA 1PZLA 4K4JA 2VV2A 4OKTA 4QJRA 1YIMA 3KFCA 5E1CA 4ZJRA 3UP0A 3GBKA 4PPSA 4RFWA 5DY8A 3X36A 3JZBA 3OSWA 3MNEA 4FNEA 4PRGA 2BJ4A 3W5RA 3WFFA 4ZNHA 1GWQA 2E2RA 1KNUA 4G1ZA 2Q7JA 3B1MA 3WWRA 5CJ6A 2VSTA 3OGTA 4JGVA 3W0CA 1VJBA 2Z4JA 5LGAA 4PLEA 1PCGA 1YOKA 3E7CA 1PRGA 3O1EA 1XLSE 1SJ0A 5AZTA 3HZFA 5DZHA 2OCFA 4PXMA 1R20A 1XIUA 2ZMIA 3UVVA 3PEQA 5KYJA 3G0WA 1PQ9A 4YPQA 2ZNQA 2Z4BA 2P4YA 3DZYD 5E0WA 5EI1A 4RUJA 3ADTA 3VT4A 1M2ZA 3F5CB 5KRCA 4RUPA 1XB7A 2PRGA 3CDSA 2QA8B 4K6IA 3D5FA 3IPQA 4MGAB 4ZJWA 2ZY0A 2VV3A 1YP0A 3FUGA 3V9VA 1FCZA 1S19A 3IA6A 3K23A 4IA3A 2ZL9A 2HWQA 2ZVTA 3A40X 3ADXA 5SYZA 4DK7A 4QL8A 3HQ5A 3VTBA 2PINA 2JFAA 5B41A 2QSEA 2ZK1A 1I38A 2FAIA 4N5GA 5EC9A 4CSJA 3ZR7A 4A4WA 3A78A 3V9YA 4NY9A 3IPUA 4KZMA 2YJDA 2ZK0A 2IHQA 2AX8A 2ZK5A 1EXXA 1NHZA 2Q1VA 3CS4A 5DV8A 2HB7A 4J5WC 1R6GA 3P0UA 3ERTA 1KKQA 1G2NA 2W8YA 5DK9A 3AUNA 1EXAA 2J4AA 3WFGA 2ZKCA 3B67A 3IXPD 2ZLCA 5C4TA 1P93A 4P6XA 5DXPA 1RKHA 3KBAA 4XUHA 3Q95B 4NB6A 2AX6A 5AVIA 4IV2A 4RMDA 2GPVA 3H0AD 2JJ3A 2FVJA 2YHDA 5DMCA 5DSHA 3SP6A 1N4HA 2PIUA 1MZNA 1M13A 3BC5A 3OSIA 3W5QA 2AX7A 1X7EA
chains in the Genus database with same CATH topology
4RZEA 2HB8A 2POGA 1S9PA 4OJ9A 4IA1A 1X7BA 5KCCA 3PLZA 4ZNSA 2AYRA 4EM9A 5KD9A 3W5PA 2VV4B 2GPUA 2V0VA 1R5KA 4FHHA 3RLLA 1YA3A 2O4RA 3ET3A 5DL4A 2ZLAA 5EHJA 4OJ4A 2HAMA 4X1GA 1RKGA 3GWXA 4IVWA 3L03A 3V4AA 3VTCA 3VTDA 5DIEA 3B5RA 2ACLA 4KZIA 3KMGA 2P1VA 2ATHA 4REEA 4NIEA 1OSHA 3L0LA 1LV2A 3TKCA 3W5TA 3KMRA 3AN3A 1XOWA 2ZK6A 5FQVA 5G3JA 3W0GA 1H9UA 3IMYA 4J5XA 4MG7A 1SR7A 2I0JA 5DKEA 5C4SA 2QE4A 5GIDA 2NXXA 1FM6D 1RDTA 4Y29A 3AFRA 4RMCA 2ZK2A 4R06A 1TXIA 4ZO1X 5DXKA 2P54A 2ZXZA 4S14A 4JL4A 2AXAA 3VHUA 5KRMA 4OZRE 3QT0A 5DYDA 1T74A 2I0GA 2H77A 4WHFA 5DUHA 2QMVA 3PRGA 1N83A 1FM9D 3KDUA 2GTKA 3E94A 3A2HA 2BJ4B 2Q7KA 4N8RA 1XNXA 1ILGA 4POJA 2XYXA 1YMTA 2VSRA 3CJWA 3OZJA 4QE8A 1HG4A 5DWGA 3UP3A 1S0ZA 1XQ3A 4YMQA 4OH6A 3WT5A 5FQPA 4DQMA 3GZ9A 1YY4A 3R8DA 3M7RA 4LTWA 5AYGA 2Q60A 5HCVA 3UVVB 5KRIA 3DCTA 3B0RA 5E0XA 5KRAA 5AAVA 1FCXA 3B66A 2Q5SA 4APUA 1G5YA 4UDDA 2G0HA 3TX7B 3P88A 1QKMA 4IV4A 4ZI1A 5ICKA 2QTUA 1U3RA 5ETHA 1MVCA 5KCUA 5AWKA 5KCWA 2PIPL 4OEYA 1NAVA 2R40D 5DVVA 3MNPA 5DX3A 1U9EA 5DP0A 3A9EA 4Q50A 2AA6A 2GIUA 5JJMA 1ZUCA 3KDTA 2Q8SA 4OKXA 4RZGA 3B65A 5DV6A 2JFAB 2XYJA 3OS8C 4RMEA 1T7TA 1ZGYA 5EJVA 3ERDA 4POHA 5AVLA 1XNNA 1PQ6A 1OT7A 5KRFA 4FGYA 4E4KA 3UUAA 1ZAFA 2PJLA 4FN9A 1K7LA 2QZOA 1YINA 1IE9A 3FURA 2QABA 3HC6A 2YLOA 4G2IA 5DIGA 3ZRAA 1R1KD 5HJPA 3PCUA 3ILZA 5DLRA 4PP6A 3V3EA 4OZRU 4PLDA 4J5WA 3VRWA 3HO0A 4PWLA 3E00D 2ZXMA 3ADUA 2HWRA 5GIEA 3OMKA 3OMMA 2O9IA 3DCUA 4MGDA 4OC7A 3VRTA 3VSPA 3SZ1A 4A2JA 3DR1A 3OZ0A 2OM9A 2Q5PA 4OIUA 1E3KA 1XAPA 5DIDA 4ZNTA 4R2UA 4UDCA 1NQ2A 2Q6JA 3OKHA 4LNWA 5KROA 4DM6A 4M8EA 2AA5A 3K22A 4BCRA 2PIQA 3ADVA 5G45A 5HYKA 2NV7A 1UPWA 2OVMA 1EREA 3ZRBA 3X1IA 5A86A 1NDEA 1X78A 3WTQA 4UDAA 2QR9A 5AK2A 1DKFA 3B0TA 4RWVA 1NRLA 3K6PA 1ZKYA 3OLSA 1GWRA 1R20D 4FHIA 1E3GA 2ACLB 2AAXA 4PVUA 1NQ7A 3MNOA 3D57A 3KYTA 2GL8A 5M96A 2P1TA 3AURA 4WLBA 2H79A 1MV9A 1XJ7A 2G5OA 2QNVA 3A2IA 4IS8A 3OS9A 4MG7B 1SKXA 2YFEA 3ET0A 2OZ7A 2AX9A 1NYXA 1K74A 2AA7A 3AN4A 1PQCA 1G50A 1I7IA 1I37A 5DKSA 5KRKA 5EGVA 1UHLA 1XP1A 4S0TA 4WQPA 3LMPA 2P15A 3AZ3A 3R2AA 2Q59B 3FEJA 4UDBA 3TY0A 1K4WA 2QW4A 5KCEA 1OVLA 1OSVA 4ZNVA 5DYBA 3OMOA 3OOKA 3R8AA 3CS8A 2AWHA 2J7XA 3VJTA 3H0AA 5G46A 3FXVA 2IOGA 4TUZA 4IWFA 3R5NA 1KV6A 2AO6A 4EMAA 5APJA 3CWDA 5AAUA 1Z95A 2P1UA 4G20A 4PP5A 2R6WA 3G8OA 2HC4A 5H1EA 4IA2A 5L11A 1T7FA 3FC6A 5E19A 1ERRA 3VT7A 4OKWA 4MG9A 4QK4A 2OAXA 2ZMJA 5JI0D 5FQTA 3B0QA 5AAVB 5DXGA 1U3SA 5AWJA 5KCDA 2Q6SA 4IA7A 2NW4A 4N1YA 4IQRA 1FCYA 4Q0AC 1FBYA 3VT6A 2VV1A 2ZBSA 3OOFA 5G42A 2Q61A 2QA6A 5DWEA 5DX3B 3A9EB 2REWA 3FS1A 2ABIA 2Q5GA 5JJMB 1L2JA 2HBHA 1YUCA 5DUGA 2J14A 4OFUA 2Q59A 4ZNUA 1XDKA 3UUAB 2QZOB 1LBDA 3X1HA 2B23A 1YOWA 3ADSA 3B68A 1UPVA 1X7JA 5DTVA 5DVSA 1DB1A 2QGWA 3AUQA 3CS6A 2AMAA 3GYUA 4OILA 5HJPB 3NSPA 5KRHA 5KCTA 4R6SA 3DY6A 3EYBA 3NSQA 1T63A 2PIWA 4MGCA 1M7WA 5KRJA 2R6YA 3VSOA 1HJ1A 2B1VA 2I4PA 4MGDB 3WJ4A 1X76A 5LWPA 4IU7A 3UUDB 1S0XA 4IW6A 5DUEA 3DT3A 2HCDA 5L7EA 1ILHA 1NUOA 3ZQTA 4XTAA 4MG6A 3VJHA 2OVHA 5DRJA 3VN2A 4DMAA 5IAWA 2HFPA 4P6WA 2J7YA 4J26A 1I7GA 3CQVA 3VT5A 1XV9A 2ZNOA 2HVCA 3KPZA 3W0IA 3W0JA 4RAKA 2FSZA 1DKFB 2I4JA 1XLSA 2QH6A 2NPAA 1NAXA 3IPSA 5FQSA 1XQCA 3VI8A 2NXXE 4JYHA 5DXMA 4QM0A 2PIOA 4ZNWA 5DWIA 3DZUA 4WVDA 3ET2A 2ZASA 3A2JA 1QKTA 3FALA 4WPFA 4XUMA 4TV1A 5DU5A 3VT3A 3R8IA 3PBAA 1IE8A 3RLJA 4DM8A 5DWLA 3KWYA 3RUUA 4J24A 1ZH7A 1RK3A 2QGTA 4ONIA 2I4ZA 4XAOA 5E14A 2EWPA 1UOMA 5DWJA 3OKIA 1T7RA 2XKWA 3OLFA 1UHLB 1T65A 2AA2A 5C4OA 2Q7IA 5DZIA 4E2JA 4YT1A 3E00A 2YLYA 2G44A 3UUDA 2Q7LA 1U3QA 4IWCA 5DZ0A 3HM1A 1OVLB 4N73A 4G2HA 5DKGA 5L7GA 2GPPA 3LBDA 2GPOA 3WGPA 4E4QA 3P89A 2ZFXA 3FEIA 3L0JA 4TUZB 3RUTA 3UU7A 5G44A 1XVPA 3S9SA 5HJSA 2YJAB 3P8XA 4OJBA 3DZYA 4IVYA 2AM9A 4LNXA 3FC6B 1GWXA 4MG5A 4CI4A 5DXBA 4MG8A 3GD2A 3R29A 4MG9B 4MGBA 3AZ1A 4RUOX 1T7MA 5ACCA 5KCFA 2A3IA 5K13A 5E7VA 2QXMA 4OH5A 2QXSA 5DVCA 3V49A 4HEEX 4OEZA 4PPPA 3D6DA 3VRUA 2Q3YA 2VV1B 3X31A 1RJKA 1T5ZA 3GN8A 3R5MA 3WT7A 5DKBA 4F9MA 4JAZA 3WMHA 2PITA 2YATA 3CTBA 4B7WA 1WM0X 1ZDTA 1T76A 1Z5XE 4HLWA 2GP7A 2G0GA 5IZ0A 3N00A 5I4VA 3IXPA 1XDKB 1BSXA 2POBA 3TKMA 3V3QA 3G8IA 1A52A 1X7RA 2O4JA 5GT4A 2F4BA 2XYWA 3RY9A 4L96A 3VJSA 1K74D 4REFA 1XPCA 4YNKA 5KYAA 3OMQA 2B1ZA 3OMPA 2YLQA 4DORA 3OSAA 5APHA 2PIRA 1XP6A 4L98A 1YYEA 3RVFA 2ZNNA 4OHAA 1NQ0A 4ZN9A 2BAWA 4XHDA 1Y0SA 2ZK3A 3VT9A 3VJIA 4IW8A 4A4VA 4QE6A 4KZJA 4ITFA 2ZNPA 1N46A 4WHGA 3HVLA 4IUIA 4OGHA 3BQDA 1PK5A 2XHSA 1QKUA 2JF9A 2Q70A 3L3ZA 3OLLA 3OAPA 4ZOMA 2OUZA 1XV9B 4OEAA 3BEJA 4ITEA 4X1FA 4S0SA 4DK8A 4Q13A 4RE8A 3W0YA 1T73A 2ZMHA 3F5CA 3HC5A 4ZN7A 2QPYA 3D24A 4O8FA 5DXQA 2P7AA 3A3ZX 1FM6A 1GS4A 2QA8A 3HLVA 4MGAA 1S9QA 3KMZA 3T03A 5IXKA 5DXEA 4ZO1B 5DZ3A 3OS8A 4OK1A 1Y9RA 1SQNA 3CDPA 3FALB 4LBDA 1NQ1A 4TV1B 5JY3A 4OIVA 5E15A 5KR9A 3WT6A 1Y0XX 4NQAB 4XT9A 1QKNA 2V7CA 4OZTE 1FM9A 2PIXA 2ZK4A 3L0EA 3FLIA 1RDTD 1Z5XU 4M8HA 2LBDA 3VHVA 3ET1A 5DZ1A 5KRLA 5G43A 1XZXX 3ADWA 3NOAA 1P8DA 5C4UA 3VT8A 3WJ5A 4MDDA 1A28A 4G21A 2B50A 5F9BA 2GWXA 1T79A 2PIVA 4XI3A 3CLDA 2AMBA 3Q95A 3PO9A 4G1YA 2IOKA 5GICA 3V9TA 1YJEA 4NUFA 3U9QA 5B5BA 2P7ZA 3L1BA 3UU7B 3W0HA 5DXRA 1XVPB 4JYIA 3SP9A 2Q1HA 4OKBA 5DV3A 2YLPA 4PF3A 2PKLA 4OFRA 5G5WA 5DXBB 5HZCA 2PNUA 3GYTA 2ZXNA 4MG8B 4OEDA 1G1UA 4MGBB 1Q4XA 1PDUA 2HASA 2HARA 1XP9A 2R40A 2VV4A 3B0WA 3H52A 3F7DA 4OLMA 1L2IA 5DMFA 3VRVA 3G9EA 3GWSX 5L7HA 3D90A 1ZDUA 3K8SA 4RZFA 5DI7A 5EITA 3UUCA 1FD0A 4DOSA 5DRMA 3L3XA 4S15A 1ZEOA 4J5XC 3O1DA 3AZ2A 3AX8A 4OARA 1R1KA 4CI5A 3JZCA 5FQRA 4G1DA 2P7GA 3HODA 2Q6RA 3B3KA 2VV0A 3W0AA 5HYRA 5AZVA 2AB2A 1TFCA 5APKA 3DZUD 4JYGA 4LSJA 4PP3A 4K7AA 4OZTU 4XLDA 3VHWA 1PZLA 4K4JA 2VV2A 4OKTA 4QJRA 1YIMA 3KFCA 5E1CA 4ZJRA 3UP0A 3GBKA 4PPSA 4RFWA 5DY8A 3X36A 3JZBA 3OSWA 3MNEA 4FNEA 4PRGA 2BJ4A 3W5RA 3WFFA 4ZNHA 1GWQA 2E2RA 1KNUA 4G1ZA 2Q7JA 3B1MA 3WWRA 5CJ6A 2VSTA 3OGTA 4JGVA 3W0CA 1VJBA 2Z4JA 5LGAA 4PLEA 1PCGA 1YOKA 3E7CA 1PRGA 3O1EA 1XLSE 1SJ0A 5AZTA 3HZFA 5DZHA 2OCFA 4PXMA 1R20A 1XIUA 2ZMIA 3UVVA 3PEQA 5KYJA 3G0WA 1PQ9A 4YPQA 2ZNQA 2Z4BA 2P4YA 3DZYD 5E0WA 5EI1A 4RUJA 3ADTA 3VT4A 1M2ZA 3F5CB 5KRCA 4RUPA 1XB7A 2PRGA 3CDSA 2QA8B 4K6IA 3D5FA 3IPQA 4MGAB 4ZJWA 2ZY0A 2VV3A 1YP0A 3FUGA 3V9VA 1FCZA 1S19A 3IA6A 3K23A 4IA3A 2ZL9A 2HWQA 2ZVTA 3A40X 3ADXA 5SYZA 4DK7A 4QL8A 3HQ5A 3VTBA 2PINA 2JFAA 5B41A 2QSEA 2ZK1A 1I38A 2FAIA 4N5GA 5EC9A 4CSJA 3ZR7A 4A4WA 3A78A 3V9YA 4NY9A 3IPUA 4KZMA 2YJDA 2ZK0A 2IHQA 2AX8A 2ZK5A 1EXXA 1NHZA 2Q1VA 3CS4A 5DV8A 2HB7A 4J5WC 1R6GA 3P0UA 3ERTA 1KKQA 1G2NA 2W8YA 5DK9A 3AUNA 1EXAA 2J4AA 3WFGA 2ZKCA 3B67A 3IXPD 2ZLCA 5C4TA 1P93A 4P6XA 5DXPA 1RKHA 3KBAA 4XUHA 3Q95B 4NB6A 2AX6A 5AVIA 4IV2A 4RMDA 2GPVA 3H0AD 2JJ3A 2FVJA 2YHDA 5DMCA 5DSHA 3SP6A 1N4HA 2PIUA 1MZNA 1M13A 3BC5A 3OSIA 3W5QA 2AX7A 1X7EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RZE A;  2HB8 A;  2POG A;  1S9P A;  4OJ9 A;  4IA1 A;  1X7B A;  5KCC A;  3PLZ A;  4ZNS A;  2AYR A;  4EM9 A;  5KD9 A;  3W5P A;  2VV4 B;  2GPU A;  2V0V A;  1R5K A;  4FHH A;  3RLL A;  1YA3 A;  2O4R A;  3ET3 A;  5DL4 A;  2ZLA A;  5EHJ A;  4OJ4 A;  2HAM A;  4X1G A;  1RKG A;  3GWX A;  4IVW A;  3L03 A;  3V4A A;  3VTC A;  3VTD A;  5DIE A;  3B5R A;  2ACL A;  4KZI A;  3KMG A;  2P1V A;  2ATH A;  4REE A;  4NIE A;  1OSH A;  3L0L A;  1LV2 A;  3TKC A;  3W5T A;  3KMR A;  3AN3 A;  1XOW A;  2ZK6 A;  5FQV A;  5G3J A;  3W0G A;  1H9U A;  3IMY A;  4J5X A;  4MG7 A;  1SR7 A;  2I0J A;  5DKE A;  5C4S A;  2QE4 A;  5GID A;  2NXX A;  1FM6 D;  1RDT A;  4Y29 A;  3AFR A;  4RMC A;  2ZK2 A;  4R06 A;  1TXI A;  4ZO1 X;  5DXK A;  2P54 A;  2ZXZ A;  4S14 A;  4JL4 A;  2AXA A;  3VHU A;  5KRM A;  4OZR E;  3QT0 A;  5DYD A;  1T74 A;  2I0G A;  2H77 A;  4WHF A;  5DUH A;  2QMV A;  3PRG A;  1N83 A;  1FM9 D;  3KDU A;  2GTK A;  3E94 A;  3A2H A;  2BJ4 B;  2Q7K A;  4N8R A;  1XNX A;  1ILG A;  4POJ A;  2XYX A;  1YMT A;  2VSR A;  3CJW A;  3OZJ A;  4QE8 A;  1HG4 A;  5DWG A;  3UP3 A;  1S0Z A;  1XQ3 A;  4YMQ A;  4OH6 A;  3WT5 A;  5FQP A;  4DQM A;  3GZ9 A;  1YY4 A;  3R8D A;  3M7R A;  4LTW A;  5AYG A;  2Q60 A;  5HCV A;  3UVV B;  5KRI A;  3DCT A;  3B0R A;  5E0X A;  5KRA A;  5AAV A;  1FCX A;  3B66 A;  2Q5S A;  4APU A;  1G5Y A;  4UDD A;  2G0H A;  3TX7 B;  3P88 A;  1QKM A;  4IV4 A;  4ZI1 A;  5ICK A;  2QTU A;  1U3R A;  5ETH A;  1MVC A;  5KCU A;  5AWK A;  5KCW A;  2PIP L;  4OEY A;  1NAV A;  2R40 D;  5DVV A;  3MNP A;  5DX3 A;  1U9E A;  5DP0 A;  3A9E A;  4Q50 A;  2AA6 A;  2GIU A;  5JJM A;  1ZUC A;  3KDT A;  2Q8S A;  4OKX A;  4RZG A;  3B65 A;  5DV6 A;  2JFA B;  2XYJ A;  3OS8 C;  4RME A;  1T7T A;  1ZGY A;  5EJV A;  3ERD A;  4POH A;  5AVL A;  1XNN A;  1PQ6 A;  1OT7 A;  5KRF A;  4FGY A;  4E4K A;  3UUA A;  1ZAF A;  2PJL A;  4FN9 A;  1K7L A;  2QZO A;  1YIN A;  1IE9 A;  3FUR A;  2QAB A;  3HC6 A;  2YLO A;  4G2I A;  5DIG A;  3ZRA A;  1R1K D;  5HJP A;  3PCU A;  3ILZ A;  5DLR A;  4PP6 A;  3V3E A;  4OZR U;  4PLD A;  4J5W A;  3VRW A;  3HO0 A;  4PWL A;  3E00 D;  2ZXM A;  3ADU A;  2HWR A;  5GIE A;  3OMK A;  3OMM A;  2O9I A;  3DCU A;  4MGD A;  4OC7 A;  3VRT A;  3VSP A;  3SZ1 A;  4A2J A;  3DR1 A;  3OZ0 A;  2OM9 A;  2Q5P A;  4OIU A;  1E3K A;  1XAP A;  5DID A;  4ZNT A;  4R2U A;  4UDC A;  1NQ2 A;  2Q6J A;  3OKH A;  4LNW A;  5KRO A;  4DM6 A;  4M8E A;  2AA5 A;  3K22 A;  4BCR A;  2PIQ A;  3ADV A;  5G45 A;  5HYK A;  2NV7 A;  1UPW A;  2OVM A;  1ERE A;  3ZRB A;  3X1I A;  5A86 A;  1NDE A;  1X78 A;  3WTQ A;  4UDA A;  2QR9 A;  5AK2 A;  1DKF A;  3B0T A;  4RWV A;  1NRL A;  3K6P A;  1ZKY A;  3OLS A;  1GWR A;  1R20 D;  4FHI A;  1E3G A;  2ACL B;  2AAX A;  4PVU A;  1NQ7 A;  3MNO A;  3D57 A;  3KYT A;  2GL8 A;  5M96 A;  2P1T A;  3AUR A;  4WLB A;  2H79 A;  1MV9 A;  1XJ7 A;  2G5O A;  2QNV A;  3A2I A;  4IS8 A;  3OS9 A;  4MG7 B;  1SKX A;  2YFE A;  3ET0 A;  2OZ7 A;  2AX9 A;  1NYX A;  1K74 A;  2AA7 A;  3AN4 A;  1PQC A;  1G50 A;  1I7I A;  1I37 A;  5DKS A;  5KRK A;  5EGV A;  1UHL A;  1XP1 A;  4S0T A;  4WQP A;  3LMP A;  2P15 A;  3AZ3 A;  3R2A A;  2Q59 B;  3FEJ A;  4UDB A;  3TY0 A;  1K4W A;  2QW4 A;  5KCE A;  1OVL A;  1OSV A;  4ZNV A;  5DYB A;  3OMO A;  3OOK A;  3R8A A;  3CS8 A;  2AWH A;  2J7X A;  3VJT A;  3H0A A;  5G46 A;  3FXV A;  2IOG A;  4TUZ A;  4IWF A;  3R5N A;  1KV6 A;  2AO6 A;  4EMA A;  5APJ A;  3CWD A;  5AAU A;  1Z95 A;  2P1U A;  4G20 A;  4PP5 A;  2R6W A;  3G8O A;  2HC4 A;  5H1E A;  4IA2 A;  5L11 A;  1T7F A;  3FC6 A;  5E19 A;  1ERR A;  3VT7 A;  4OKW A;  4MG9 A;  4QK4 A;  2OAX A;  2ZMJ A;  5JI0 D;  5FQT A;  3B0Q A;  5AAV B;  5DXG A;  1U3S A;  5AWJ A;  5KCD A;  2Q6S A;  4IA7 A;  2NW4 A;  4N1Y A;  4IQR A;  1FCY A;  4Q0A C;  1FBY A;  3VT6 A;  2VV1 A;  2ZBS A;  3OOF A;  5G42 A;  2Q61 A;  2QA6 A;  5DWE A;  5DX3 B;  3A9E B;  2REW A;  3FS1 A;  2ABI A;  2Q5G A;  5JJM B;  1L2J A;  2HBH A;  1YUC A;  5DUG A;  2J14 A;  4OFU A;  2Q59 A;  4ZNU A;  1XDK A;  3UUA B;  2QZO B;  1LBD A;  3X1H A;  2B23 A;  1YOW A;  3ADS A;  3B68 A;  1UPV A;  1X7J A;  5DTV A;  5DVS A;  1DB1 A;  2QGW A;  3AUQ A;  3CS6 A;  2AMA A;  3GYU A;  4OIL A;  5HJP B;  3NSP A;  5KRH A;  5KCT A;  4R6S A;  3DY6 A;  3EYB A;  3NSQ A;  1T63 A;  2PIW A;  4MGC A;  1M7W A;  5KRJ A;  2R6Y A;  3VSO A;  1HJ1 A;  2B1V A;  2I4P A;  4MGD B;  3WJ4 A;  1X76 A;  5LWP A;  4IU7 A;  3UUD B;  1S0X A;  4IW6 A;  5DUE A;  3DT3 A;  2HCD A;  5L7E A;  1ILH A;  1NUO A;  3ZQT A;  4XTA A;  4MG6 A;  3VJH A;  2OVH A;  5DRJ A;  3VN2 A;  4DMA A;  5IAW A;  2HFP A;  4P6W A;  2J7Y A;  4J26 A;  1I7G A;  3CQV A;  3VT5 A;  1XV9 A;  2ZNO A;  2HVC A;  3KPZ A;  3W0I A;  3W0J A;  4RAK A;  2FSZ A;  1DKF B;  2I4J A;  1XLS A;  2QH6 A;  2NPA A;  1NAX A;  3IPS A;  5FQS A;  1XQC A;  3VI8 A;  2NXX E;  4JYH A;  5DXM A;  4QM0 A;  2PIO A;  4ZNW A;  5DWI A;  3DZU A;  4WVD A;  3ET2 A;  2ZAS A;  3A2J A;  1QKT A;  3FAL A;  4WPF A;  4XUM A;  4TV1 A;  5DU5 A;  3VT3 A;  3R8I A;  3PBA A;  1IE8 A;  3RLJ A;  4DM8 A;  5DWL A;  3KWY A;  3RUU A;  4J24 A;  1ZH7 A;  1RK3 A;  2QGT A;  4ONI A;  2I4Z A;  4XAO A;  5E14 A;  2EWP A;  1UOM A;  5DWJ A;  3OKI A;  1T7R A;  2XKW A;  3OLF A;  1UHL B;  1T65 A;  2AA2 A;  5C4O A;  2Q7I A;  5DZI A;  4E2J A;  4YT1 A;  3E00 A;  2YLY A;  2G44 A;  3UUD A;  2Q7L A;  1U3Q A;  4IWC A;  5DZ0 A;  3HM1 A;  1OVL B;  4N73 A;  4G2H A;  5DKG A;  5L7G A;  2GPP A;  3LBD A;  2GPO A;  3WGP A;  4E4Q A;  3P89 A;  2ZFX A;  3FEI A;  3L0J A;  4TUZ B;  3RUT A;  3UU7 A;  5G44 A;  1XVP A;  3S9S A;  5HJS A;  2YJA B;  3P8X A;  4OJB A;  3DZY A;  4IVY A;  2AM9 A;  4LNX A;  3FC6 B;  1GWX A;  4MG5 A;  4CI4 A;  5DXB A;  4MG8 A;  3GD2 A;  3R29 A;  4MG9 B;  4MGB A;  3AZ1 A;  4RUO X;  1T7M A;  5ACC A;  5KCF A;  2A3I A;  5K13 A;  5E7V A;  2QXM A;  4OH5 A;  2QXS A;  5DVC A;  3V49 A;  4HEE X;  4OEZ A;  4PPP A;  3D6D A;  3VRU A;  2Q3Y A;  2VV1 B;  3X31 A;  1RJK A;  1T5Z A;  3GN8 A;  3R5M A;  3WT7 A;  5DKB A;  4F9M A;  4JAZ A;  3WMH A;  2PIT A;  2YAT A;  3CTB A;  4B7W A;  1WM0 X;  1ZDT A;  1T76 A;  1Z5X E;  4HLW A;  2GP7 A;  2G0G A;  5IZ0 A;  3N00 A;  5I4V A;  3IXP A;  1XDK B;  1BSX A;  2POB A;  3TKM A;  3V3Q A;  3G8I A;  1A52 A;  1X7R A;  2O4J A;  5GT4 A;  2F4B A;  2XYW A;  3RY9 A;  4L96 A;  3VJS A;  1K74 D;  4REF A;  1XPC A;  4YNK A;  5KYA A;  3OMQ A;  2B1Z A;  3OMP A;  2YLQ A;  4DOR A;  3OSA A;  5APH A;  2PIR A;  1XP6 A;  4L98 A;  1YYE A;  3RVF A;  2ZNN A;  4OHA A;  1NQ0 A;  4ZN9 A;  2BAW A;  4XHD A;  1Y0S A;  2ZK3 A;  3VT9 A;  3VJI A;  4IW8 A;  4A4V A;  4QE6 A;  4KZJ A;  4ITF A;  2ZNP A;  1N46 A;  4WHG A;  3HVL A;  4IUI A;  4OGH A;  3BQD A;  1PK5 A;  2XHS A;  1QKU A;  2JF9 A;  2Q70 A;  3L3Z A;  3OLL A;  3OAP A;  4ZOM A;  2OUZ A;  1XV9 B;  4OEA A;  3BEJ A;  4ITE A;  4X1F A;  4S0S A;  4DK8 A;  4Q13 A;  4RE8 A;  3W0Y A;  1T73 A;  2ZMH A;  3F5C A;  3HC5 A;  4ZN7 A;  2QPY A;  3D24 A;  4O8F A;  5DXQ A;  2P7A A;  3A3Z X;  1FM6 A;  1GS4 A;  2QA8 A;  3HLV A;  4MGA A;  1S9Q A;  3KMZ A;  3T03 A;  5IXK A;  5DXE A;  4ZO1 B;  5DZ3 A;  3OS8 A;  4OK1 A;  1Y9R A;  1SQN A;  3CDP A;  3FAL B;  4LBD A;  1NQ1 A;  4TV1 B;  5JY3 A;  4OIV A;  5E15 A;  5KR9 A;  3WT6 A;  1Y0X X;  4NQA B;  4XT9 A;  1QKN A;  2V7C A;  4OZT E;  1FM9 A;  2PIX A;  2ZK4 A;  3L0E A;  3FLI A;  1RDT D;  1Z5X U;  4M8H A;  2LBD A;  3VHV A;  3ET1 A;  5DZ1 A;  5KRL A;  5G43 A;  1XZX X;  3ADW A;  3NOA A;  1P8D A;  5C4U A;  3VT8 A;  3WJ5 A;  4MDD A;  1A28 A;  4G21 A;  2B50 A;  5F9B A;  2GWX A;  1T79 A;  2PIV A;  4XI3 A;  3CLD A;  2AMB A;  3Q95 A;  3PO9 A;  4G1Y A;  2IOK A;  5GIC A;  3V9T A;  1YJE A;  4NUF A;  3U9Q A;  5B5B A;  2P7Z A;  3L1B A;  3UU7 B;  3W0H A;  5DXR A;  1XVP B;  4JYI A;  3SP9 A;  2Q1H A;  4OKB A;  5DV3 A;  2YLP A;  4PF3 A;  2PKL A;  4OFR A;  5G5W A;  5DXB B;  5HZC A;  2PNU A;  3GYT A;  2ZXN A;  4MG8 B;  4OED A;  1G1U A;  4MGB B;  1Q4X A;  1PDU A;  2HAS A;  2HAR A;  1XP9 A;  2R40 A;  2VV4 A;  3B0W A;  3H52 A;  3F7D A;  4OLM A;  1L2I A;  5DMF A;  3VRV A;  3G9E A;  3GWS X;  5L7H A;  3D90 A;  1ZDU A;  3K8S A;  4RZF A;  5DI7 A;  5EIT A;  3UUC A;  1FD0 A;  4DOS A;  5DRM A;  3L3X A;  4S15 A;  1ZEO A;  4J5X C;  3O1D A;  3AZ2 A;  3AX8 A;  4OAR A;  1R1K A;  4CI5 A;  3JZC A;  5FQR A;  4G1D A;  2P7G A;  3HOD A;  2Q6R A;  3B3K A;  2VV0 A;  3W0A A;  5HYR A;  5AZV A;  2AB2 A;  1TFC A;  5APK A;  3DZU D;  4JYG A;  4LSJ A;  4PP3 A;  4K7A A;  4OZT U;  4XLD A;  3VHW A;  1PZL A;  4K4J A;  2VV2 A;  4OKT A;  4QJR A;  1YIM A;  3KFC A;  5E1C A;  4ZJR A;  3UP0 A;  3GBK A;  4PPS A;  4RFW A;  5DY8 A;  3X36 A;  3JZB A;  3OSW A;  3MNE A;  4FNE A;  4PRG A;  2BJ4 A;  3W5R A;  3WFF A;  4ZNH A;  1GWQ A;  2E2R A;  1KNU A;  4G1Z A;  2Q7J A;  3B1M A;  3WWR A;  5CJ6 A;  2VST A;  3OGT A;  4JGV A;  3W0C A;  1VJB A;  2Z4J A;  5LGA A;  4PLE A;  1PCG A;  1YOK A;  3E7C A;  1PRG A;  3O1E A;  1XLS E;  1SJ0 A;  5AZT A;  3HZF A;  5DZH A;  2OCF A;  4PXM A;  1R20 A;  1XIU A;  2ZMI A;  3UVV A;  3PEQ A;  5KYJ A;  3G0W A;  1PQ9 A;  4YPQ A;  2ZNQ A;  2Z4B A;  2P4Y A;  3DZY D;  5E0W A;  5EI1 A;  4RUJ A;  3ADT A;  3VT4 A;  1M2Z A;  3F5C B;  5KRC A;  4RUP A;  1XB7 A;  2PRG A;  3CDS A;  2QA8 B;  4K6I A;  3D5F A;  3IPQ A;  4MGA B;  4ZJW A;  2ZY0 A;  2VV3 A;  1YP0 A;  3FUG A;  3V9V A;  1FCZ A;  1S19 A;  3IA6 A;  3K23 A;  4IA3 A;  2ZL9 A;  2HWQ A;  2ZVT A;  3A40 X;  3ADX A;  5SYZ A;  4DK7 A;  4QL8 A;  3HQ5 A;  3VTB A;  2PIN A;  2JFA A;  5B41 A;  2QSE A;  2ZK1 A;  1I38 A;  2FAI A;  4N5G A;  5EC9 A;  4CSJ A;  3ZR7 A;  4A4W A;  3A78 A;  3V9Y A;  4NY9 A;  3IPU A;  4KZM A;  2YJD A;  2ZK0 A;  2IHQ A;  2AX8 A;  2ZK5 A;  1EXX A;  1NHZ A;  2Q1V A;  3CS4 A;  5DV8 A;  2HB7 A;  4J5W C;  1R6G A;  3P0U A;  3ERT A;  1KKQ A;  1G2N A;  2W8Y A;  5DK9 A;  3AUN A;  1EXA A;  2J4A A;  3WFG A;  2ZKC A;  3B67 A;  3IXP D;  2ZLC A;  5C4T A;  1P93 A;  4P6X A;  5DXP A;  1RKH A;  3KBA A;  4XUH A;  3Q95 B;  4NB6 A;  2AX6 A;  5AVI A;  4IV2 A;  4RMD A;  2GPV A;  3H0A D;  2JJ3 A;  2FVJ A;  2YHD A;  5DMC A;  5DSH A;  3SP6 A;  1N4H A;  2PIU A;  1MZN A;  1M13 A;  3BC5 A;  3OSI A;  3W5Q A;  2AX7 A;  1X7E A; 
#chains in the Genus database with same CATH topology
 4RZE A;  2HB8 A;  2POG A;  1S9P A;  4OJ9 A;  4IA1 A;  1X7B A;  5KCC A;  3PLZ A;  4ZNS A;  2AYR A;  4EM9 A;  5KD9 A;  3W5P A;  2VV4 B;  2GPU A;  2V0V A;  1R5K A;  4FHH A;  3RLL A;  1YA3 A;  2O4R A;  3ET3 A;  5DL4 A;  2ZLA A;  5EHJ A;  4OJ4 A;  2HAM A;  4X1G A;  1RKG A;  3GWX A;  4IVW A;  3L03 A;  3V4A A;  3VTC A;  3VTD A;  5DIE A;  3B5R A;  2ACL A;  4KZI A;  3KMG A;  2P1V A;  2ATH A;  4REE A;  4NIE A;  1OSH A;  3L0L A;  1LV2 A;  3TKC A;  3W5T A;  3KMR A;  3AN3 A;  1XOW A;  2ZK6 A;  5FQV A;  5G3J A;  3W0G A;  1H9U A;  3IMY A;  4J5X A;  4MG7 A;  1SR7 A;  2I0J A;  5DKE A;  5C4S A;  2QE4 A;  5GID A;  2NXX A;  1FM6 D;  1RDT A;  4Y29 A;  3AFR A;  4RMC A;  2ZK2 A;  4R06 A;  1TXI A;  4ZO1 X;  5DXK A;  2P54 A;  2ZXZ A;  4S14 A;  4JL4 A;  2AXA A;  3VHU A;  5KRM A;  4OZR E;  3QT0 A;  5DYD A;  1T74 A;  2I0G A;  2H77 A;  4WHF A;  5DUH A;  2QMV A;  3PRG A;  1N83 A;  1FM9 D;  3KDU A;  2GTK A;  3E94 A;  3A2H A;  2BJ4 B;  2Q7K A;  4N8R A;  1XNX A;  1ILG A;  4POJ A;  2XYX A;  1YMT A;  2VSR A;  3CJW A;  3OZJ A;  4QE8 A;  1HG4 A;  5DWG A;  3UP3 A;  1S0Z A;  1XQ3 A;  4YMQ A;  4OH6 A;  3WT5 A;  5FQP A;  4DQM A;  3GZ9 A;  1YY4 A;  3R8D A;  3M7R A;  4LTW A;  5AYG A;  2Q60 A;  5HCV A;  3UVV B;  5KRI A;  3DCT A;  3B0R A;  5E0X A;  5KRA A;  5AAV A;  1FCX A;  3B66 A;  2Q5S A;  4APU A;  1G5Y A;  4UDD A;  2G0H A;  3TX7 B;  3P88 A;  1QKM A;  4IV4 A;  4ZI1 A;  5ICK A;  2QTU A;  1U3R A;  5ETH A;  1MVC A;  5KCU A;  5AWK A;  5KCW A;  2PIP L;  4OEY A;  1NAV A;  2R40 D;  5DVV A;  3MNP A;  5DX3 A;  1U9E A;  5DP0 A;  3A9E A;  4Q50 A;  2AA6 A;  2GIU A;  5JJM A;  1ZUC A;  3KDT A;  2Q8S A;  4OKX A;  4RZG A;  3B65 A;  5DV6 A;  2JFA B;  2XYJ A;  3OS8 C;  4RME A;  1T7T A;  1ZGY A;  5EJV A;  3ERD A;  4POH A;  5AVL A;  1XNN A;  1PQ6 A;  1OT7 A;  5KRF A;  4FGY A;  4E4K A;  3UUA A;  1ZAF A;  2PJL A;  4FN9 A;  1K7L A;  2QZO A;  1YIN A;  1IE9 A;  3FUR A;  2QAB A;  3HC6 A;  2YLO A;  4G2I A;  5DIG A;  3ZRA A;  1R1K D;  5HJP A;  3PCU A;  3ILZ A;  5DLR A;  4PP6 A;  3V3E A;  4OZR U;  4PLD A;  4J5W A;  3VRW A;  3HO0 A;  4PWL A;  3E00 D;  2ZXM A;  3ADU A;  2HWR A;  5GIE A;  3OMK A;  3OMM A;  2O9I A;  3DCU A;  4MGD A;  4OC7 A;  3VRT A;  3VSP A;  3SZ1 A;  4A2J A;  3DR1 A;  3OZ0 A;  2OM9 A;  2Q5P A;  4OIU A;  1E3K A;  1XAP A;  5DID A;  4ZNT A;  4R2U A;  4UDC A;  1NQ2 A;  2Q6J A;  3OKH A;  4LNW A;  5KRO A;  4DM6 A;  4M8E A;  2AA5 A;  3K22 A;  4BCR A;  2PIQ A;  3ADV A;  5G45 A;  5HYK A;  2NV7 A;  1UPW A;  2OVM A;  1ERE A;  3ZRB A;  3X1I A;  5A86 A;  1NDE A;  1X78 A;  3WTQ A;  4UDA A;  2QR9 A;  5AK2 A;  1DKF A;  3B0T A;  4RWV A;  1NRL A;  3K6P A;  1ZKY A;  3OLS A;  1GWR A;  1R20 D;  4FHI A;  1E3G A;  2ACL B;  2AAX A;  4PVU A;  1NQ7 A;  3MNO A;  3D57 A;  3KYT A;  2GL8 A;  5M96 A;  2P1T A;  3AUR A;  4WLB A;  2H79 A;  1MV9 A;  1XJ7 A;  2G5O A;  2QNV A;  3A2I A;  4IS8 A;  3OS9 A;  4MG7 B;  1SKX A;  2YFE A;  3ET0 A;  2OZ7 A;  2AX9 A;  1NYX A;  1K74 A;  2AA7 A;  3AN4 A;  1PQC A;  1G50 A;  1I7I A;  1I37 A;  5DKS A;  5KRK A;  5EGV A;  1UHL A;  1XP1 A;  4S0T A;  4WQP A;  3LMP A;  2P15 A;  3AZ3 A;  3R2A A;  2Q59 B;  3FEJ A;  4UDB A;  3TY0 A;  1K4W A;  2QW4 A;  5KCE A;  1OVL A;  1OSV A;  4ZNV A;  5DYB A;  3OMO A;  3OOK A;  3R8A A;  3CS8 A;  2AWH A;  2J7X A;  3VJT A;  3H0A A;  5G46 A;  3FXV A;  2IOG A;  4TUZ A;  4IWF A;  3R5N A;  1KV6 A;  2AO6 A;  4EMA A;  5APJ A;  3CWD A;  5AAU A;  1Z95 A;  2P1U A;  4G20 A;  4PP5 A;  2R6W A;  3G8O A;  2HC4 A;  5H1E A;  4IA2 A;  5L11 A;  1T7F A;  3FC6 A;  5E19 A;  1ERR A;  3VT7 A;  4OKW A;  4MG9 A;  4QK4 A;  2OAX A;  2ZMJ A;  5JI0 D;  5FQT A;  3B0Q A;  5AAV B;  5DXG A;  1U3S A;  5AWJ A;  5KCD A;  2Q6S A;  4IA7 A;  2NW4 A;  4N1Y A;  4IQR A;  1FCY A;  4Q0A C;  1FBY A;  3VT6 A;  2VV1 A;  2ZBS A;  3OOF A;  5G42 A;  2Q61 A;  2QA6 A;  5DWE A;  5DX3 B;  3A9E B;  2REW A;  3FS1 A;  2ABI A;  2Q5G A;  5JJM B;  1L2J A;  2HBH A;  1YUC A;  5DUG A;  2J14 A;  4OFU A;  2Q59 A;  4ZNU A;  1XDK A;  3UUA B;  2QZO B;  1LBD A;  3X1H A;  2B23 A;  1YOW A;  3ADS A;  3B68 A;  1UPV A;  1X7J A;  5DTV A;  5DVS A;  1DB1 A;  2QGW A;  3AUQ A;  3CS6 A;  2AMA A;  3GYU A;  4OIL A;  5HJP B;  3NSP A;  5KRH A;  5KCT A;  4R6S A;  3DY6 A;  3EYB A;  3NSQ A;  1T63 A;  2PIW A;  4MGC A;  1M7W A;  5KRJ A;  2R6Y A;  3VSO A;  1HJ1 A;  2B1V A;  2I4P A;  4MGD B;  3WJ4 A;  1X76 A;  5LWP A;  4IU7 A;  3UUD B;  1S0X A;  4IW6 A;  5DUE A;  3DT3 A;  2HCD A;  5L7E A;  1ILH A;  1NUO A;  3ZQT A;  4XTA A;  4MG6 A;  3VJH A;  2OVH A;  5DRJ A;  3VN2 A;  4DMA A;  5IAW A;  2HFP A;  4P6W A;  2J7Y A;  4J26 A;  1I7G A;  3CQV A;  3VT5 A;  1XV9 A;  2ZNO A;  2HVC A;  3KPZ A;  3W0I A;  3W0J A;  4RAK A;  2FSZ A;  1DKF B;  2I4J A;  1XLS A;  2QH6 A;  2NPA A;  1NAX A;  3IPS A;  5FQS A;  1XQC A;  3VI8 A;  2NXX E;  4JYH A;  5DXM A;  4QM0 A;  2PIO A;  4ZNW A;  5DWI A;  3DZU A;  4WVD A;  3ET2 A;  2ZAS A;  3A2J A;  1QKT A;  3FAL A;  4WPF A;  4XUM A;  4TV1 A;  5DU5 A;  3VT3 A;  3R8I A;  3PBA A;  1IE8 A;  3RLJ A;  4DM8 A;  5DWL A;  3KWY A;  3RUU A;  4J24 A;  1ZH7 A;  1RK3 A;  2QGT A;  4ONI A;  2I4Z A;  4XAO A;  5E14 A;  2EWP A;  1UOM A;  5DWJ A;  3OKI A;  1T7R A;  2XKW A;  3OLF A;  1UHL B;  1T65 A;  2AA2 A;  5C4O A;  2Q7I A;  5DZI A;  4E2J A;  4YT1 A;  3E00 A;  2YLY A;  2G44 A;  3UUD A;  2Q7L A;  1U3Q A;  4IWC A;  5DZ0 A;  3HM1 A;  1OVL B;  4N73 A;  4G2H A;  5DKG A;  5L7G A;  2GPP A;  3LBD A;  2GPO A;  3WGP A;  4E4Q A;  3P89 A;  2ZFX A;  3FEI A;  3L0J A;  4TUZ B;  3RUT A;  3UU7 A;  5G44 A;  1XVP A;  3S9S A;  5HJS A;  2YJA B;  3P8X A;  4OJB A;  3DZY A;  4IVY A;  2AM9 A;  4LNX A;  3FC6 B;  1GWX A;  4MG5 A;  4CI4 A;  5DXB A;  4MG8 A;  3GD2 A;  3R29 A;  4MG9 B;  4MGB A;  3AZ1 A;  4RUO X;  1T7M A;  5ACC A;  5KCF A;  2A3I A;  5K13 A;  5E7V A;  2QXM A;  4OH5 A;  2QXS A;  5DVC A;  3V49 A;  4HEE X;  4OEZ A;  4PPP A;  3D6D A;  3VRU A;  2Q3Y A;  2VV1 B;  3X31 A;  1RJK A;  1T5Z A;  3GN8 A;  3R5M A;  3WT7 A;  5DKB A;  4F9M A;  4JAZ A;  3WMH A;  2PIT A;  2YAT A;  3CTB A;  4B7W A;  1WM0 X;  1ZDT A;  1T76 A;  1Z5X E;  4HLW A;  2GP7 A;  2G0G A;  5IZ0 A;  3N00 A;  5I4V A;  3IXP A;  1XDK B;  1BSX A;  2POB A;  3TKM A;  3V3Q A;  3G8I A;  1A52 A;  1X7R A;  2O4J A;  5GT4 A;  2F4B A;  2XYW A;  3RY9 A;  4L96 A;  3VJS A;  1K74 D;  4REF A;  1XPC A;  4YNK A;  5KYA A;  3OMQ A;  2B1Z A;  3OMP A;  2YLQ A;  4DOR A;  3OSA A;  5APH A;  2PIR A;  1XP6 A;  4L98 A;  1YYE A;  3RVF A;  2ZNN A;  4OHA A;  1NQ0 A;  4ZN9 A;  2BAW A;  4XHD A;  1Y0S A;  2ZK3 A;  3VT9 A;  3VJI A;  4IW8 A;  4A4V A;  4QE6 A;  4KZJ A;  4ITF A;  2ZNP A;  1N46 A;  4WHG A;  3HVL A;  4IUI A;  4OGH A;  3BQD A;  1PK5 A;  2XHS A;  1QKU A;  2JF9 A;  2Q70 A;  3L3Z A;  3OLL A;  3OAP A;  4ZOM A;  2OUZ A;  1XV9 B;  4OEA A;  3BEJ A;  4ITE A;  4X1F A;  4S0S A;  4DK8 A;  4Q13 A;  4RE8 A;  3W0Y A;  1T73 A;  2ZMH A;  3F5C A;  3HC5 A;  4ZN7 A;  2QPY A;  3D24 A;  4O8F A;  5DXQ A;  2P7A A;  3A3Z X;  1FM6 A;  1GS4 A;  2QA8 A;  3HLV A;  4MGA A;  1S9Q A;  3KMZ A;  3T03 A;  5IXK A;  5DXE A;  4ZO1 B;  5DZ3 A;  3OS8 A;  4OK1 A;  1Y9R A;  1SQN A;  3CDP A;  3FAL B;  4LBD A;  1NQ1 A;  4TV1 B;  5JY3 A;  4OIV A;  5E15 A;  5KR9 A;  3WT6 A;  1Y0X X;  4NQA B;  4XT9 A;  1QKN A;  2V7C A;  4OZT E;  1FM9 A;  2PIX A;  2ZK4 A;  3L0E A;  3FLI A;  1RDT D;  1Z5X U;  4M8H A;  2LBD A;  3VHV A;  3ET1 A;  5DZ1 A;  5KRL A;  5G43 A;  1XZX X;  3ADW A;  3NOA A;  1P8D A;  5C4U A;  3VT8 A;  3WJ5 A;  4MDD A;  1A28 A;  4G21 A;  2B50 A;  5F9B A;  2GWX A;  1T79 A;  2PIV A;  4XI3 A;  3CLD A;  2AMB A;  3Q95 A;  3PO9 A;  4G1Y A;  2IOK A;  5GIC A;  3V9T A;  1YJE A;  4NUF A;  3U9Q A;  5B5B A;  2P7Z A;  3L1B A;  3UU7 B;  3W0H A;  5DXR A;  1XVP B;  4JYI A;  3SP9 A;  2Q1H A;  4OKB A;  5DV3 A;  2YLP A;  4PF3 A;  2PKL A;  4OFR A;  5G5W A;  5DXB B;  5HZC A;  2PNU A;  3GYT A;  2ZXN A;  4MG8 B;  4OED A;  1G1U A;  4MGB B;  1Q4X A;  1PDU A;  2HAS A;  2HAR A;  1XP9 A;  2R40 A;  2VV4 A;  3B0W A;  3H52 A;  3F7D A;  4OLM A;  1L2I A;  5DMF A;  3VRV A;  3G9E A;  3GWS X;  5L7H A;  3D90 A;  1ZDU A;  3K8S A;  4RZF A;  5DI7 A;  5EIT A;  3UUC A;  1FD0 A;  4DOS A;  5DRM A;  3L3X A;  4S15 A;  1ZEO A;  4J5X C;  3O1D A;  3AZ2 A;  3AX8 A;  4OAR A;  1R1K A;  4CI5 A;  3JZC A;  5FQR A;  4G1D A;  2P7G A;  3HOD A;  2Q6R A;  3B3K A;  2VV0 A;  3W0A A;  5HYR A;  5AZV A;  2AB2 A;  1TFC A;  5APK A;  3DZU D;  4JYG A;  4LSJ A;  4PP3 A;  4K7A A;  4OZT U;  4XLD A;  3VHW A;  1PZL A;  4K4J A;  2VV2 A;  4OKT A;  4QJR A;  1YIM A;  3KFC A;  5E1C A;  4ZJR A;  3UP0 A;  3GBK A;  4PPS A;  4RFW A;  5DY8 A;  3X36 A;  3JZB A;  3OSW A;  3MNE A;  4FNE A;  4PRG A;  2BJ4 A;  3W5R A;  3WFF A;  4ZNH A;  1GWQ A;  2E2R A;  1KNU A;  4G1Z A;  2Q7J A;  3B1M A;  3WWR A;  5CJ6 A;  2VST A;  3OGT A;  4JGV A;  3W0C A;  1VJB A;  2Z4J A;  5LGA A;  4PLE A;  1PCG A;  1YOK A;  3E7C A;  1PRG A;  3O1E A;  1XLS E;  1SJ0 A;  5AZT A;  3HZF A;  5DZH A;  2OCF A;  4PXM A;  1R20 A;  1XIU A;  2ZMI A;  3UVV A;  3PEQ A;  5KYJ A;  3G0W A;  1PQ9 A;  4YPQ A;  2ZNQ A;  2Z4B A;  2P4Y A;  3DZY D;  5E0W A;  5EI1 A;  4RUJ A;  3ADT A;  3VT4 A;  1M2Z A;  3F5C B;  5KRC A;  4RUP A;  1XB7 A;  2PRG A;  3CDS A;  2QA8 B;  4K6I A;  3D5F A;  3IPQ A;  4MGA B;  4ZJW A;  2ZY0 A;  2VV3 A;  1YP0 A;  3FUG A;  3V9V A;  1FCZ A;  1S19 A;  3IA6 A;  3K23 A;  4IA3 A;  2ZL9 A;  2HWQ A;  2ZVT A;  3A40 X;  3ADX A;  5SYZ A;  4DK7 A;  4QL8 A;  3HQ5 A;  3VTB A;  2PIN A;  2JFA A;  5B41 A;  2QSE A;  2ZK1 A;  1I38 A;  2FAI A;  4N5G A;  5EC9 A;  4CSJ A;  3ZR7 A;  4A4W A;  3A78 A;  3V9Y A;  4NY9 A;  3IPU A;  4KZM A;  2YJD A;  2ZK0 A;  2IHQ A;  2AX8 A;  2ZK5 A;  1EXX A;  1NHZ A;  2Q1V A;  3CS4 A;  5DV8 A;  2HB7 A;  4J5W C;  1R6G A;  3P0U A;  3ERT A;  1KKQ A;  1G2N A;  2W8Y A;  5DK9 A;  3AUN A;  1EXA A;  2J4A A;  3WFG A;  2ZKC A;  3B67 A;  3IXP D;  2ZLC A;  5C4T A;  1P93 A;  4P6X A;  5DXP A;  1RKH A;  3KBA A;  4XUH A;  3Q95 B;  4NB6 A;  2AX6 A;  5AVI A;  4IV2 A;  4RMD A;  2GPV A;  3H0A D;  2JJ3 A;  2FVJ A;  2YHD A;  5DMC A;  5DSH A;  3SP6 A;  1N4H A;  2PIU A;  1MZN A;  1M13 A;  3BC5 A;  3OSI A;  3W5Q A;  2AX7 A;  1X7E A; 
#chains in the Genus database with same CATH homology
 4RZE A;  2HB8 A;  2POG A;  1S9P A;  4OJ9 A;  4IA1 A;  1X7B A;  5KCC A;  3PLZ A;  4ZNS A;  2AYR A;  4EM9 A;  5KD9 A;  3W5P A;  2VV4 B;  2GPU A;  2V0V A;  1R5K A;  4FHH A;  3RLL A;  1YA3 A;  2O4R A;  3ET3 A;  5DL4 A;  2ZLA A;  5EHJ A;  4OJ4 A;  2HAM A;  4X1G A;  1RKG A;  3GWX A;  4IVW A;  3L03 A;  3V4A A;  3VTC A;  3VTD A;  5DIE A;  3B5R A;  2ACL A;  4KZI A;  3KMG A;  2P1V A;  2ATH A;  4REE A;  4NIE A;  1OSH A;  3L0L A;  1LV2 A;  3TKC A;  3W5T A;  3KMR A;  3AN3 A;  1XOW A;  2ZK6 A;  5FQV A;  5G3J A;  3W0G A;  1H9U A;  3IMY A;  4J5X A;  4MG7 A;  1SR7 A;  2I0J A;  5DKE A;  5C4S A;  2QE4 A;  5GID A;  2NXX A;  1FM6 D;  1RDT A;  4Y29 A;  3AFR A;  4RMC A;  2ZK2 A;  4R06 A;  1TXI A;  4ZO1 X;  5DXK A;  2P54 A;  2ZXZ A;  4S14 A;  4JL4 A;  2AXA A;  3VHU A;  5KRM A;  4OZR E;  3QT0 A;  5DYD A;  1T74 A;  2I0G A;  2H77 A;  4WHF A;  5DUH A;  2QMV A;  3PRG A;  1N83 A;  1FM9 D;  3KDU A;  2GTK A;  3E94 A;  3A2H A;  2BJ4 B;  2Q7K A;  4N8R A;  1XNX A;  1ILG A;  4POJ A;  2XYX A;  1YMT A;  2VSR A;  3CJW A;  3OZJ A;  4QE8 A;  1HG4 A;  5DWG A;  3UP3 A;  1S0Z A;  1XQ3 A;  4YMQ A;  4OH6 A;  3WT5 A;  5FQP A;  4DQM A;  3GZ9 A;  1YY4 A;  3R8D A;  3M7R A;  4LTW A;  5AYG A;  2Q60 A;  5HCV A;  3UVV B;  5KRI A;  3DCT A;  3B0R A;  5E0X A;  5KRA A;  5AAV A;  1FCX A;  3B66 A;  2Q5S A;  4APU A;  1G5Y A;  4UDD A;  2G0H A;  3TX7 B;  3P88 A;  1QKM A;  4IV4 A;  4ZI1 A;  5ICK A;  2QTU A;  1U3R A;  5ETH A;  1MVC A;  5KCU A;  5AWK A;  5KCW A;  2PIP L;  4OEY A;  1NAV A;  2R40 D;  5DVV A;  3MNP A;  5DX3 A;  1U9E A;  5DP0 A;  3A9E A;  4Q50 A;  2AA6 A;  2GIU A;  5JJM A;  1ZUC A;  3KDT A;  2Q8S A;  4OKX A;  4RZG A;  3B65 A;  5DV6 A;  2JFA B;  2XYJ A;  3OS8 C;  4RME A;  1T7T A;  1ZGY A;  5EJV A;  3ERD A;  4POH A;  5AVL A;  1XNN A;  1PQ6 A;  1OT7 A;  5KRF A;  4FGY A;  4E4K A;  3UUA A;  1ZAF A;  2PJL A;  4FN9 A;  1K7L A;  2QZO A;  1YIN A;  1IE9 A;  3FUR A;  2QAB A;  3HC6 A;  2YLO A;  4G2I A;  5DIG A;  3ZRA A;  1R1K D;  5HJP A;  3PCU A;  3ILZ A;  5DLR A;  4PP6 A;  3V3E A;  4OZR U;  4PLD A;  4J5W A;  3VRW A;  3HO0 A;  4PWL A;  3E00 D;  2ZXM A;  3ADU A;  2HWR A;  5GIE A;  3OMK A;  3OMM A;  2O9I A;  3DCU A;  4MGD A;  4OC7 A;  3VRT A;  3VSP A;  3SZ1 A;  4A2J A;  3DR1 A;  3OZ0 A;  2OM9 A;  2Q5P A;  4OIU A;  1E3K A;  1XAP A;  5DID A;  4ZNT A;  4R2U A;  4UDC A;  1NQ2 A;  2Q6J A;  3OKH A;  4LNW A;  5KRO A;  4DM6 A;  4M8E A;  2AA5 A;  3K22 A;  4BCR A;  2PIQ A;  3ADV A;  5G45 A;  5HYK A;  2NV7 A;  1UPW A;  2OVM A;  1ERE A;  3ZRB A;  3X1I A;  5A86 A;  1NDE A;  1X78 A;  3WTQ A;  4UDA A;  2QR9 A;  5AK2 A;  1DKF A;  3B0T A;  4RWV A;  1NRL A;  3K6P A;  1ZKY A;  3OLS A;  1GWR A;  1R20 D;  4FHI A;  1E3G A;  2ACL B;  2AAX A;  4PVU A;  1NQ7 A;  3MNO A;  3D57 A;  3KYT A;  2GL8 A;  5M96 A;  2P1T A;  3AUR A;  4WLB A;  2H79 A;  1MV9 A;  1XJ7 A;  2G5O A;  2QNV A;  3A2I A;  4IS8 A;  3OS9 A;  4MG7 B;  1SKX A;  2YFE A;  3ET0 A;  2OZ7 A;  2AX9 A;  1NYX A;  1K74 A;  2AA7 A;  3AN4 A;  1PQC A;  1G50 A;  1I7I A;  1I37 A;  5DKS A;  5KRK A;  5EGV A;  1UHL A;  1XP1 A;  4S0T A;  4WQP A;  3LMP A;  2P15 A;  3AZ3 A;  3R2A A;  2Q59 B;  3FEJ A;  4UDB A;  3TY0 A;  1K4W A;  2QW4 A;  5KCE A;  1OVL A;  1OSV A;  4ZNV A;  5DYB A;  3OMO A;  3OOK A;  3R8A A;  3CS8 A;  2AWH A;  2J7X A;  3VJT A;  3H0A A;  5G46 A;  3FXV A;  2IOG A;  4TUZ A;  4IWF A;  3R5N A;  1KV6 A;  2AO6 A;  4EMA A;  5APJ A;  3CWD A;  5AAU A;  1Z95 A;  2P1U A;  4G20 A;  4PP5 A;  2R6W A;  3G8O A;  2HC4 A;  5H1E A;  4IA2 A;  5L11 A;  1T7F A;  3FC6 A;  5E19 A;  1ERR A;  3VT7 A;  4OKW A;  4MG9 A;  4QK4 A;  2OAX A;  2ZMJ A;  5JI0 D;  5FQT A;  3B0Q A;  5AAV B;  5DXG A;  1U3S A;  5AWJ A;  5KCD A;  2Q6S A;  4IA7 A;  2NW4 A;  4N1Y A;  4IQR A;  1FCY A;  4Q0A C;  1FBY A;  3VT6 A;  2VV1 A;  2ZBS A;  3OOF A;  5G42 A;  2Q61 A;  2QA6 A;  5DWE A;  5DX3 B;  3A9E B;  2REW A;  3FS1 A;  2ABI A;  2Q5G A;  5JJM B;  1L2J A;  2HBH A;  1YUC A;  5DUG A;  2J14 A;  4OFU A;  2Q59 A;  4ZNU A;  1XDK A;  3UUA B;  2QZO B;  1LBD A;  3X1H A;  2B23 A;  1YOW A;  3ADS A;  3B68 A;  1UPV A;  1X7J A;  5DTV A;  5DVS A;  1DB1 A;  2QGW A;  3AUQ A;  3CS6 A;  2AMA A;  3GYU A;  4OIL A;  5HJP B;  3NSP A;  5KRH A;  5KCT A;  4R6S A;  3DY6 A;  3EYB A;  3NSQ A;  1T63 A;  2PIW A;  4MGC A;  1M7W A;  5KRJ A;  2R6Y A;  3VSO A;  1HJ1 A;  2B1V A;  2I4P A;  4MGD B;  3WJ4 A;  1X76 A;  5LWP A;  4IU7 A;  3UUD B;  1S0X A;  4IW6 A;  5DUE A;  3DT3 A;  2HCD A;  5L7E A;  1ILH A;  1NUO A;  3ZQT A;  4XTA A;  4MG6 A;  3VJH A;  2OVH A;  5DRJ A;  3VN2 A;  4DMA A;  5IAW A;  2HFP A;  4P6W A;  2J7Y A;  4J26 A;  1I7G A;  3CQV A;  3VT5 A;  1XV9 A;  2ZNO A;  2HVC A;  3KPZ A;  3W0I A;  3W0J A;  4RAK A;  2FSZ A;  1DKF B;  2I4J A;  1XLS A;  2QH6 A;  2NPA A;  1NAX A;  3IPS A;  5FQS A;  1XQC A;  3VI8 A;  2NXX E;  4JYH A;  5DXM A;  4QM0 A;  2PIO A;  4ZNW A;  5DWI A;  3DZU A;  4WVD A;  3ET2 A;  2ZAS A;  3A2J A;  1QKT A;  3FAL A;  4WPF A;  4XUM A;  4TV1 A;  5DU5 A;  3VT3 A;  3R8I A;  3PBA A;  1IE8 A;  3RLJ A;  4DM8 A;  5DWL A;  3KWY A;  3RUU A;  4J24 A;  1ZH7 A;  1RK3 A;  2QGT A;  4ONI A;  2I4Z A;  4XAO A;  5E14 A;  2EWP A;  1UOM A;  5DWJ A;  3OKI A;  1T7R A;  2XKW A;  3OLF A;  1UHL B;  1T65 A;  2AA2 A;  5C4O A;  2Q7I A;  5DZI A;  4E2J A;  4YT1 A;  3E00 A;  2YLY A;  2G44 A;  3UUD A;  2Q7L A;  1U3Q A;  4IWC A;  5DZ0 A;  3HM1 A;  1OVL B;  4N73 A;  4G2H A;  5DKG A;  5L7G A;  2GPP A;  3LBD A;  2GPO A;  3WGP A;  4E4Q A;  3P89 A;  2ZFX A;  3FEI A;  3L0J A;  4TUZ B;  3RUT A;  3UU7 A;  5G44 A;  1XVP A;  3S9S A;  5HJS A;  2YJA B;  3P8X A;  4OJB A;  3DZY A;  4IVY A;  2AM9 A;  4LNX A;  3FC6 B;  1GWX A;  4MG5 A;  4CI4 A;  5DXB A;  4MG8 A;  3GD2 A;  3R29 A;  4MG9 B;  4MGB A;  3AZ1 A;  4RUO X;  1T7M A;  5ACC A;  5KCF A;  2A3I A;  5K13 A;  5E7V A;  2QXM A;  4OH5 A;  2QXS A;  5DVC A;  3V49 A;  4HEE X;  4OEZ A;  4PPP A;  3D6D A;  3VRU A;  2Q3Y A;  2VV1 B;  3X31 A;  1RJK A;  1T5Z A;  3GN8 A;  3R5M A;  3WT7 A;  5DKB A;  4F9M A;  4JAZ A;  3WMH A;  2PIT A;  2YAT A;  3CTB A;  4B7W A;  1WM0 X;  1ZDT A;  1T76 A;  1Z5X E;  4HLW A;  2GP7 A;  2G0G A;  5IZ0 A;  3N00 A;  5I4V A;  3IXP A;  1XDK B;  1BSX A;  2POB A;  3TKM A;  3V3Q A;  3G8I A;  1A52 A;  1X7R A;  2O4J A;  5GT4 A;  2F4B A;  2XYW A;  3RY9 A;  4L96 A;  3VJS A;  1K74 D;  4REF A;  1XPC A;  4YNK A;  5KYA A;  3OMQ A;  2B1Z A;  3OMP A;  2YLQ A;  4DOR A;  3OSA A;  5APH A;  2PIR A;  1XP6 A;  4L98 A;  1YYE A;  3RVF A;  2ZNN A;  4OHA A;  1NQ0 A;  4ZN9 A;  2BAW A;  4XHD A;  1Y0S A;  2ZK3 A;  3VT9 A;  3VJI A;  4IW8 A;  4A4V A;  4QE6 A;  4KZJ A;  4ITF A;  2ZNP A;  1N46 A;  4WHG A;  3HVL A;  4IUI A;  4OGH A;  3BQD A;  1PK5 A;  2XHS A;  1QKU A;  2JF9 A;  2Q70 A;  3L3Z A;  3OLL A;  3OAP A;  4ZOM A;  2OUZ A;  1XV9 B;  4OEA A;  3BEJ A;  4ITE A;  4X1F A;  4S0S A;  4DK8 A;  4Q13 A;  4RE8 A;  3W0Y A;  1T73 A;  2ZMH A;  3F5C A;  3HC5 A;  4ZN7 A;  2QPY A;  3D24 A;  4O8F A;  5DXQ A;  2P7A A;  3A3Z X;  1FM6 A;  1GS4 A;  2QA8 A;  3HLV A;  4MGA A;  1S9Q A;  3KMZ A;  3T03 A;  5IXK A;  5DXE A;  4ZO1 B;  5DZ3 A;  3OS8 A;  4OK1 A;  1Y9R A;  1SQN A;  3CDP A;  3FAL B;  4LBD A;  1NQ1 A;  4TV1 B;  5JY3 A;  4OIV A;  5E15 A;  5KR9 A;  3WT6 A;  1Y0X X;  4NQA B;  4XT9 A;  1QKN A;  2V7C A;  4OZT E;  1FM9 A;  2PIX A;  2ZK4 A;  3L0E A;  3FLI A;  1RDT D;  1Z5X U;  4M8H A;  2LBD A;  3VHV A;  3ET1 A;  5DZ1 A;  5KRL A;  5G43 A;  1XZX X;  3ADW A;  3NOA A;  1P8D A;  5C4U A;  3VT8 A;  3WJ5 A;  4MDD A;  1A28 A;  4G21 A;  2B50 A;  5F9B A;  2GWX A;  1T79 A;  2PIV A;  4XI3 A;  3CLD A;  2AMB A;  3Q95 A;  3PO9 A;  4G1Y A;  2IOK A;  5GIC A;  3V9T A;  1YJE A;  4NUF A;  3U9Q A;  5B5B A;  2P7Z A;  3L1B A;  3UU7 B;  3W0H A;  5DXR A;  1XVP B;  4JYI A;  3SP9 A;  2Q1H A;  4OKB A;  5DV3 A;  2YLP A;  4PF3 A;  2PKL A;  4OFR A;  5G5W A;  5DXB B;  5HZC A;  2PNU A;  3GYT A;  2ZXN A;  4MG8 B;  4OED A;  1G1U A;  4MGB B;  1Q4X A;  1PDU A;  2HAS A;  2HAR A;  1XP9 A;  2R40 A;  2VV4 A;  3B0W A;  3H52 A;  3F7D A;  4OLM A;  1L2I A;  5DMF A;  3VRV A;  3G9E A;  3GWS X;  5L7H A;  3D90 A;  1ZDU A;  3K8S A;  4RZF A;  5DI7 A;  5EIT A;  3UUC A;  1FD0 A;  4DOS A;  5DRM A;  3L3X A;  4S15 A;  1ZEO A;  4J5X C;  3O1D A;  3AZ2 A;  3AX8 A;  4OAR A;  1R1K A;  4CI5 A;  3JZC A;  5FQR A;  4G1D A;  2P7G A;  3HOD A;  2Q6R A;  3B3K A;  2VV0 A;  3W0A A;  5HYR A;  5AZV A;  2AB2 A;  1TFC A;  5APK A;  3DZU D;  4JYG A;  4LSJ A;  4PP3 A;  4K7A A;  4OZT U;  4XLD A;  3VHW A;  1PZL A;  4K4J A;  2VV2 A;  4OKT A;  4QJR A;  1YIM A;  3KFC A;  5E1C A;  4ZJR A;  3UP0 A;  3GBK A;  4PPS A;  4RFW A;  5DY8 A;  3X36 A;  3JZB A;  3OSW A;  3MNE A;  4FNE A;  4PRG A;  2BJ4 A;  3W5R A;  3WFF A;  4ZNH A;  1GWQ A;  2E2R A;  1KNU A;  4G1Z A;  2Q7J A;  3B1M A;  3WWR A;  5CJ6 A;  2VST A;  3OGT A;  4JGV A;  3W0C A;  1VJB A;  2Z4J A;  5LGA A;  4PLE A;  1PCG A;  1YOK A;  3E7C A;  1PRG A;  3O1E A;  1XLS E;  1SJ0 A;  5AZT A;  3HZF A;  5DZH A;  2OCF A;  4PXM A;  1R20 A;  1XIU A;  2ZMI A;  3UVV A;  3PEQ A;  5KYJ A;  3G0W A;  1PQ9 A;  4YPQ A;  2ZNQ A;  2Z4B A;  2P4Y A;  3DZY D;  5E0W A;  5EI1 A;  4RUJ A;  3ADT A;  3VT4 A;  1M2Z A;  3F5C B;  5KRC A;  4RUP A;  1XB7 A;  2PRG A;  3CDS A;  2QA8 B;  4K6I A;  3D5F A;  3IPQ A;  4MGA B;  4ZJW A;  2ZY0 A;  2VV3 A;  1YP0 A;  3FUG A;  3V9V A;  1FCZ A;  1S19 A;  3IA6 A;  3K23 A;  4IA3 A;  2ZL9 A;  2HWQ A;  2ZVT A;  3A40 X;  3ADX A;  5SYZ A;  4DK7 A;  4QL8 A;  3HQ5 A;  3VTB A;  2PIN A;  2JFA A;  5B41 A;  2QSE A;  2ZK1 A;  1I38 A;  2FAI A;  4N5G A;  5EC9 A;  4CSJ A;  3ZR7 A;  4A4W A;  3A78 A;  3V9Y A;  4NY9 A;  3IPU A;  4KZM A;  2YJD A;  2ZK0 A;  2IHQ A;  2AX8 A;  2ZK5 A;  1EXX A;  1NHZ A;  2Q1V A;  3CS4 A;  5DV8 A;  2HB7 A;  4J5W C;  1R6G A;  3P0U A;  3ERT A;  1KKQ A;  1G2N A;  2W8Y A;  5DK9 A;  3AUN A;  1EXA A;  2J4A A;  3WFG A;  2ZKC A;  3B67 A;  3IXP D;  2ZLC A;  5C4T A;  1P93 A;  4P6X A;  5DXP A;  1RKH A;  3KBA A;  4XUH A;  3Q95 B;  4NB6 A;  2AX6 A;  5AVI A;  4IV2 A;  4RMD A;  2GPV A;  3H0A D;  2JJ3 A;  2FVJ A;  2YHD A;  5DMC A;  5DSH A;  3SP6 A;  1N4H A;  2PIU A;  1MZN A;  1M13 A;  3BC5 A;  3OSI A;  3W5Q A;  2AX7 A;  1X7E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...