5KCFA

Crystal structure of the er-alpha ligand-binding domain (y537s) in complex with an n-ethyl, 4-methoxybenzyl obhs-n derivative
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
247
structure length
236
Chain Sequence
KNSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLSDLLLEMLDAHRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Estrogen receptor
publication title Full antagonism of the estrogen receptor without a prototypical ligand side chain.
pubmed doi rcsb
source organism Homo sapiens
total genus 90
structure length 236
sequence length 247
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 5kcfA00
2VV1A 2QGTA 3UUCA 1XOWA 1DKFA 5B41A 1S0XA 3VTCA 1T7TA 4YT1A 4RFWA 4PVUA 1SJ0A 5DIGA 1R5KA 3E00A 2V7CA 4RUJA 3X1HA 4E2JA 4XLDA 1KNUA 4XUHA 5E1CA 2A3IA 1ZDTA 1G50A 2PIPL 5APKA 4MG9A 1FCYA 2AXAA 3ZRAA 2R40D 2HASA 2Q59A 5EITA 5DWIA 4APUA 2HWRA 2Q60A 2Q5GA 3FEJA 4N1YA 4OLMA 4RUOX 2QNVA 4UDBA 4IQRA 2GPOA 1WM0X 2BJ4B 1YIMA 4PWLA 4IU7A 4ZNHA 3X1IA 2GL8A 5KYAA 5KRCA 5APHA 2ABIA 5L11A 5EC9A 2QGWA 3L03A 3B0RA 3OZJA 3ADSA 2Q3YA 3WT6A 1T76A 3TX7B 5HYRA 2J4AA 4IVWA 1R20D 1PDUA 1Z5XE 2JFAA 2JJ3A 4QJRA 4DK8A 3VRWA 1R20A 3F5CA 4PPPA 2ZNQA 3NSPA 5AVIA 5KCUA 2ZASA 2YLQA 3BEJA 4OIVA 3RUUA 3SP9A 3X36A 3ZR7A 3R8DA 3V49A 4X1GA 1TFCA 1I7GA 3R29A 2HWQA 3PRGA 3D5FA 5KCDA 1XB7A 1S0ZA 1VJBA 4OKXA 5IZ0A 1M7WA 2ZMJA 2AO6A 2Q7KA 3CDSA 2REWA 2PINA 5GICA 4PPSA 2PIQA 3DCUA 3HC5A 4POJA 3OS8C 4RZGA 3OZ0A 3DY6A 4B7WA 1XLSE 4WHGA 3KYTA 2VV3A 1NDEA 3W0GA 4BCRA 3AURA 1YINA 3R8IA 4ITEA 4LSJA 3ADTA 3X31A 2Q6JA 4XHDA 5EI1A 2AX7A 5G43A 2OZ7A 2PIRA 1NYXA 3RLLA 2IOKA 3CS6A 3H0AA 2ZK4A 4MG8A 4OZRE 2VV4A 4L96A 4R2UA 3GYUA 3FC6B 1ZKYA 4ZN7A 5AAVB 3W0CA 1HG4A 4S14A 3A2JA 1OVLA 5KRFA 5FQRA 3VN2A 5HJPB 4G21A 3TY0A 3PLZA 3VJIA 3LBDA 4DMAA 4O8FA 2ZLCA 5DSHA 2QPYA 3W0AA 3FUGA 1SKXA 5DI7A 1X7RA 4IUIA 4S0TA 3G9EA 1N83A 3FS1A 3ILZA 4OH5A 1RJKA 4PP6A 5FQVA 3WWRA 4CI4A 5EGVA 2EWPA 1T63A 2YLPA 4QM0A 5B5BA 4KZJA 2NXXE 2POBA 3ET2A 5SYZA 5JJMA 5KRAA 1S19A 2O9IA 3PBAA 4WPFA 4ZN9A 2Z4BA 5AWJA 2ZK2A 2P15A 5AVLA 1TXIA 1T73A 3CQVA 5AYGA 1PQ6A 2GPPA 4OARA 4OKWA 5DIEA 4FNEA 5AZVA 5KD9A 2JF9A 1ZDUA 5EJVA 2P7AA 3A9EA 3AZ3A 3B0QA 4REFA 3W5PA 1SR7A 2GP7A 1XQ3A 2Q7IA 4MGBB 1U9EA 2G0HA 3ADWA 5DKGA 5I4VA 3ET0A 4KZMA 1H9UA 3P0UA 5E0WA 4REEA 3UUDA 1G5YA 3NOAA 2B50A 3L0JA 4NY9A 4FGYA 1X7EA 2AX9A 1MVCA 5E15A 2AB2A 4JYHA 1R1KD 4PP5A 3VT9A 3DR1A 1ZUCA 5A86A 2ACLB 5HZCA 3GZ9A 4A2JA 2ZXZA 2QZOA 5KCTA 2XHSA 3HVLA 3OGTA 1XVPB 1ILHA 4ZO1X 3P8XA 3UUAA 4DOSA 3FEIA 1P8DA 5GIEA 2QH6A 5ACCA 5AK2A 2F4BA 4UDDA 1BSXA 3DT3A 3CDPA 3W0IA 5JI0D 3PCUA 4XT9A 1YUCA 4A4WA 2J14A 2ZFXA 3CTBA 4PRGA 4OHAA 1T7RA 5DVVA 3VRTA 4K6IA 4JL4A 1SQNA 5DXGA 4JGVA 2NPAA 2AA2A 3Q95A 4FHIA 4J26A 5HYKA 3HLVA 4YMQA 2ZL9A 2GIUA 3UU7B 2Q7JA 2AMBA 3OLSA 3R5NA 5DXMA 2AA5A 1RKGA 2VV0A 3MNEA 1XNXA 1Q4XA 2Q6SA 5DVSA 4PF3A 4MG5A 1N46A 4J5XA 1XIUA 4J5WA 1ZEOA 3GYTA 3ZRBA 1QKMA 4LNXA 4OIUA 2R40A 3D90A 2AA6A 2VV1B 1EXXA 5DWEA 4X1FA 5AWKA 1DKFB 2HBHA 2ZK1A 2OCFA 5G5WA 5C4UA 3AZ1A 2ZY0A 2Q70A 4WVDA 2GTKA 2QE4A 1IE8A 3L3ZA 5CJ6A 4PP3A 5KRIA 3NSQA 5L7EA 4MG9B 5M96A 2IHQA 4LBDA 1LBDA 4DORA 2Q59B 2Z4JA 3IMYA 3MNOA 1XPCA 2NW4A 5KYJA 4ITFA 4CSJA 3WFGA 3SZ1A 4ZJRA 5DUEA 2YHDA 4JYIA 5DV6A 3VJSA 2ZMIA 3K6PA 5DU5A 3DZYD 4Q0AC 4POHA 1PQCA 4EMAA 2HFPA 5DZ0A 3BC5A 4N8RA 3OMKA 1PK5A 2AMAA 2HARA 2QXMA 4OEYA 3R5MA 4PLEA 4Q13A 1DB1A 5DRJA 2JFAB 3OOFA 1S9PA 1KKQA 1L2JA 1ILGA 3GN8A 5KCEA 5DWLA 3FALA 2HB7A 1I38A 2P7ZA 3F5CB 3OSIA 4IA3A 1PRGA 4ONIA 2FAIA 4QE6A 2FSZA 4RAKA 1NAXA 2YJAB 4OH6A 2ATHA 5DKBA 5DZ1A 2Q5PA 3L0LA 2Q1VA 4OJ4A 4S0SA 3VHWA 3KMGA 4CI5A 1S9QA 2QR9A 5DWJA 2OM9A 2ZNOA 5DRMA 2OVHA 2O4RA 1A28A 2OAXA 1M13A 3B66A 3KMZA 3OKIA 1YP0A 4G2IA 3VT5A 1G1UA 1L2IA 2YATA 3K8SA 3G0WA 2Q61A 4TV1A 1Y9RA 5AAUA 2Q5SA 4YNKA 2PJLA 4E4KA 3GWSX 5DLRA 5DTVA 1NQ7A 3ADUA 3JZCA 5DIDA 1FM6D 3ADXA 2AWHA 3G8IA 3KPZA 4OGHA 4R6SA 1GS4A 3ERDA 5GT4A 1E3KA 5DZ3A 4NB6A 5APJA 3W5QA 3VTBA 2GPUA 3S9SA 4MG8B 1XV9A 2BAWA 2VV4B 2LBDA 4RZEA 4Y29A 3B0TA 1NRLA 1XQCA 3VRUA 3IPSA 2PRGA 2YLYA 1UHLA 1OVLB 4RMEA 4ZNVA 3HQ5A 2AAXA 1PQ9A 2ZKCA 1XAPA 2B1VA 3D57A 1G2NA 4IW8A 3ET1A 1MV9A 1X7JA 1K4WA 3AN3A 5DYDA 5DXBA 5C4OA 4G20A 3A40X 2H79A 2OVMA 5G46A 4XAOA 4IV2A 1RKHA 3B65A 4MGAA 2QMVA 3O1EA 4XTAA 3CS8A 4NUFA 5G42A 1XP6A 3KFCA 3VT3A 5JJMB 5IAWA 3WT5A 4OFUA 3OMOA 2W8YA 1XLSA 1ERRA 1RDTD 3AUQA 5E0XA 2J7YA 3E94A 1XJ7A 3VT6A 5C4SA 1QKNA 5F9BA 5KRMA 1LV2A 4OK1A 1EREA 5DYBA 3W5TA 2YLOA 3V3EA 3V4AA 5DVCA 5KRLA 2VSRA 2AM9A 2Q7LA 3V9TA 3B3KA 3A9EB 4KZIA 4S15A 2ZK6A 1YMTA 3IPUA 3DZUD 1NQ2A 2B23A 3OMPA 1K74D 1XDKA 3HODA 1R1KA 2QA6A 2FVJA 4MGCA 4WQPA 4NQAB 5IXKA 5DX3A 3IA6A 4MG7A 1X76A 3OMMA 3AN4A 5ETHA 5DXKA 4TUZA 3UUDB 3B67A 3RY9A 5HJSA 4QK4A 4OZTU 4MGDA 5LGAA 1FD0A 3OAPA 5DXEA 2P1TA 3UVVA 2R6WA 3KDTA 3MNPA 4XI3A 1YA3A 3A2HA 2I4PA 4ZNTA 3UP0A 1N4HA 4E4QA 3FLIA 2QA8A 2H77A 5DY8A 3W0YA 2VSTA 2QZOB 2V0VA 1I7IA 1T5ZA 5KCWA 3OMQA 2ZK5A 4PLDA 1GWXA 3BQDA 2NXXA 2ZLAA 5DMCA 3UUAB 3KMRA 5DKSA 5DP0A 5ICKA 3WMHA 4UDAA 4OJ9A 1YJEA 1UPWA 2I4ZA 3DCTA 1FCXA 2PIVA 5DUHA 3N00A 4YPQA 4ZI1A 4FHHA 5HCVA 2Q6RA 1KV6A 2AA7A 4IWFA 2PNUA 3D6DA 3GD2A 5DXPA 5FQSA 4P6WA 3CWDA 3E7CA 3Q95B 1XZXX 5DXQA 3U9QA 3HM1A 3IXPD 3KBAA 5G44A 2ZVTA 2HAMA 4M8HA 2GWXA 2AX8A 3E00D 3AZ2A 5DL4A 1FBYA 2O4JA 3V9YA 5JY3A 5DKEA 2Q1HA 1U3QA 3L1BA 3PO9A 4A4VA 2BJ4A 5DWGA 3WJ4A 4OJBA 4EM9A 3RVFA 4J5XC 1XNNA 1T74A 5GIDA 4J5WC 3OOKA 4RWVA 5KR9A 5DXRA 3HO0A 2ZK0A 1T7MA 2HB8A 4ZNUA 3VHUA 3A2IA 4RE8A 4HLWA 2ZK3A 3DZYA 3OLLA 1Z5XU 4IWCA 5E7VA 3HZFA 1XP9A 4J24A 2P54A 2HCDA 3B68A 3OSWA 5L7HA 3WT7A 4IA2A 4MDDA 4JAZA 3OS9A 1YOKA 2OUZA 3A78A 5LWPA 5EHJA 2QSEA 3PEQA 3W0HA 1NQ0A 4Q50A 5KCCA 1FCZA 2G44A 2YFEA 3VI8A 1QKUA 1Y0SA 1YY4A 2PKLA 3OS8A 4ZO1B 1QKTA 3GBKA 3AX8A 3CJWA 4WHFA 2PITA 3D24A 3VJTA 1I37A 3P88A 5G45A 5DV8A 4N73A 1OSVA 4IW6A 5AZTA 3FALB 4NIEA 2Q8SA 4OEZA 1UPVA 4RZFA 1T79A 4QE8A 2NV7A 3K23A 3VRVA 3VT4A 1Z95A 3W0JA 3JZBA 5DZHA 4RMDA 3VSOA 5DMFA 1RK3A 2ZBSA 4L98A 2B1ZA 1A52A 4M8EA 4OZRU 4WLBA 5DV3A 1FM6A 4DK7A 3FC6A 3G8OA 3KWYA 4K4JA 2P1UA 5AAVA 4G1YA 5E19A 5DUGA 5HJPA 2HC4A 4PXMA 1P93A 3H52A 3GWXA 3UP3A 3W5RA 4TV1B 1OSHA 1NQ1A 3H0AD 5L7GA 5KRHA 2AYRA 1FM9D 3IPQA 2J7XA 3VJHA 3AUNA 1X78A 3O1DA 5H1EA 1FM9A 4P6XA 1HJ1A 2P7GA 3VT7A 1U3SA 1ZGYA 2ZNNA 4IS8A 4K7AA 2AX6A 4XUMA 3ZQTA 1YOWA 3QT0A 2XYXA 2I0JA 1XV9B 2P4YA 4IV4A 5G3JA 2PIWA 2R6YA 1UHLB 3TKMA 4OEDA 1XP1A 4JYGA 3SP6A 4LNWA 1EXAA 2PIOA 4RMCA 4UDCA 1OT7A 1YYEA 2PIXA 1Y0XX 5DK9A 4DM6A 4HEEX 2XYJA 3OSAA 3EYBA 5DXBB 3WTQA 5KROA 1UOMA 4QL8A 1RDTA 1ZAFA 2XKWA 3FURA 4FN9A 2I0GA 3B1MA 5KRJA 3V9VA 4MGBA 3VTDA 2G0GA 3T03A 3VT8A 4MGAB 3TKCA 2IOGA 3OKHA 2PIUA 2E2RA 3B0WA 3RLJA 3V3QA 2P1VA 5KRKA 3B5RA 3CS4A 3P89A 5FQTA 2QXSA 2POGA 3VHVA 2G5OA 3DZUA 2YJDA 1K74A 5E14A 4G1ZA 1U3RA 4G1DA 4MG6A 2ACLA 1NHZA 4ZOMA 5KCFA 2QTUA 3WGPA 4OKBA 3ADVA 2ZMHA 2XYWA 4IA7A 1E3GA 1XVPA 1NUOA 3M7RA 4IVYA 5FQPA 3A3ZX 1GWRA 5DZIA 2GPVA 3K22A 2I4JA 1R6GA 1XDKB 2HVCA 5C4TA 1MZNA 1X7BA 2ZNPA 2QW4A 3ET3A 3KDUA 4MG7B 4ZNWA 5DX3B 1NAVA 3OLFA 4OKTA 3ERTA 3F7DA 4OILA 4TUZB 4DQMA 3AFRA 2ZXNA 4ZJWA 4OZTE 4F9MA 4N5GA 2ZXMA 1IE9A 4MGDB 3FXVA 3HC6A 4LTWA 3RUTA 1ZH7A 1T7FA 1T65A 3UVVB 3R8AA 3UU7A 5K13A 3R2AA 2QABA 4IA1A 4OFRA 4RUPA 3LMPA 4R06A 2QA8B 1PZLA 1PCGA 4OEAA 3L3XA 4DM8A 3VSPA 3CLDA 4OC7A 1GWQA 3WFFA 3L0EA 3WJ5A 4G2HA 1M2ZA 4ZNSA 3IXPA 1K7LA 2VV2A
chains in the Genus database with same CATH superfamily
2VV1A 2QGTA 3UUCA 1XOWA 1DKFA 5B41A 1S0XA 3VTCA 1T7TA 4YT1A 4RFWA 4PVUA 1SJ0A 5DIGA 1R5KA 3E00A 2V7CA 4RUJA 3X1HA 4E2JA 4XLDA 1KNUA 4XUHA 5E1CA 2A3IA 1ZDTA 1G50A 2PIPL 5APKA 4MG9A 1FCYA 2AXAA 3ZRAA 2R40D 2HASA 2Q59A 5EITA 5DWIA 4APUA 2HWRA 2Q60A 2Q5GA 3FEJA 4N1YA 4OLMA 4RUOX 2QNVA 4UDBA 4IQRA 2GPOA 1WM0X 2BJ4B 1YIMA 4PWLA 4IU7A 4ZNHA 3X1IA 2GL8A 5KYAA 5KRCA 5APHA 2ABIA 5L11A 5EC9A 2QGWA 3L03A 3B0RA 3OZJA 3ADSA 2Q3YA 3WT6A 1T76A 3TX7B 5HYRA 2J4AA 4IVWA 1R20D 1PDUA 1Z5XE 2JFAA 2JJ3A 4QJRA 4DK8A 3VRWA 1R20A 3F5CA 4PPPA 2ZNQA 3NSPA 5AVIA 5KCUA 2ZASA 2YLQA 3BEJA 4OIVA 3RUUA 3SP9A 3X36A 3ZR7A 3R8DA 3V49A 4X1GA 1TFCA 1I7GA 3R29A 2HWQA 3PRGA 3D5FA 5KCDA 1XB7A 1S0ZA 1VJBA 4OKXA 5IZ0A 1M7WA 2ZMJA 2AO6A 2Q7KA 3CDSA 2REWA 2PINA 5GICA 4PPSA 2PIQA 3DCUA 3HC5A 4POJA 3OS8C 4RZGA 3OZ0A 3DY6A 4B7WA 1XLSE 4WHGA 3KYTA 2VV3A 1NDEA 3W0GA 4BCRA 3AURA 1YINA 3R8IA 4ITEA 4LSJA 3ADTA 3X31A 2Q6JA 4XHDA 5EI1A 2AX7A 5G43A 2OZ7A 2PIRA 1NYXA 3RLLA 2IOKA 3CS6A 3H0AA 2ZK4A 4MG8A 4OZRE 2VV4A 4L96A 4R2UA 3GYUA 3FC6B 1ZKYA 4ZN7A 5AAVB 3W0CA 1HG4A 4S14A 3A2JA 1OVLA 5KRFA 5FQRA 3VN2A 5HJPB 4G21A 3TY0A 3PLZA 3VJIA 3LBDA 4DMAA 4O8FA 2ZLCA 5DSHA 2QPYA 3W0AA 3FUGA 1SKXA 5DI7A 1X7RA 4IUIA 4S0TA 3G9EA 1N83A 3FS1A 3ILZA 4OH5A 1RJKA 4PP6A 5FQVA 3WWRA 4CI4A 5EGVA 2EWPA 1T63A 2YLPA 4QM0A 5B5BA 4KZJA 2NXXE 2POBA 3ET2A 5SYZA 5JJMA 5KRAA 1S19A 2O9IA 3PBAA 4WPFA 4ZN9A 2Z4BA 5AWJA 2ZK2A 2P15A 5AVLA 1TXIA 1T73A 3CQVA 5AYGA 1PQ6A 2GPPA 4OARA 4OKWA 5DIEA 4FNEA 5AZVA 5KD9A 2JF9A 1ZDUA 5EJVA 2P7AA 3A9EA 3AZ3A 3B0QA 4REFA 3W5PA 1SR7A 2GP7A 1XQ3A 2Q7IA 4MGBB 1U9EA 2G0HA 3ADWA 5DKGA 5I4VA 3ET0A 4KZMA 1H9UA 3P0UA 5E0WA 4REEA 3UUDA 1G5YA 3NOAA 2B50A 3L0JA 4NY9A 4FGYA 1X7EA 2AX9A 1MVCA 5E15A 2AB2A 4JYHA 1R1KD 4PP5A 3VT9A 3DR1A 1ZUCA 5A86A 2ACLB 5HZCA 3GZ9A 4A2JA 2ZXZA 2QZOA 5KCTA 2XHSA 3HVLA 3OGTA 1XVPB 1ILHA 4ZO1X 3P8XA 3UUAA 4DOSA 3FEIA 1P8DA 5GIEA 2QH6A 5ACCA 5AK2A 2F4BA 4UDDA 1BSXA 3DT3A 3CDPA 3W0IA 5JI0D 3PCUA 4XT9A 1YUCA 4A4WA 2J14A 2ZFXA 3CTBA 4PRGA 4OHAA 1T7RA 5DVVA 3VRTA 4K6IA 4JL4A 1SQNA 5DXGA 4JGVA 2NPAA 2AA2A 3Q95A 4FHIA 4J26A 5HYKA 3HLVA 4YMQA 2ZL9A 2GIUA 3UU7B 2Q7JA 2AMBA 3OLSA 3R5NA 5DXMA 2AA5A 1RKGA 2VV0A 3MNEA 1XNXA 1Q4XA 2Q6SA 5DVSA 4PF3A 4MG5A 1N46A 4J5XA 1XIUA 4J5WA 1ZEOA 3GYTA 3ZRBA 1QKMA 4LNXA 4OIUA 2R40A 3D90A 2AA6A 2VV1B 1EXXA 5DWEA 4X1FA 5AWKA 1DKFB 2HBHA 2ZK1A 2OCFA 5G5WA 5C4UA 3AZ1A 2ZY0A 2Q70A 4WVDA 2GTKA 2QE4A 1IE8A 3L3ZA 5CJ6A 4PP3A 5KRIA 3NSQA 5L7EA 4MG9B 5M96A 2IHQA 4LBDA 1LBDA 4DORA 2Q59B 2Z4JA 3IMYA 3MNOA 1XPCA 2NW4A 5KYJA 4ITFA 4CSJA 3WFGA 3SZ1A 4ZJRA 5DUEA 2YHDA 4JYIA 5DV6A 3VJSA 2ZMIA 3K6PA 5DU5A 3DZYD 4Q0AC 4POHA 1PQCA 4EMAA 2HFPA 5DZ0A 3BC5A 4N8RA 3OMKA 1PK5A 2AMAA 2HARA 2QXMA 4OEYA 3R5MA 4PLEA 4Q13A 1DB1A 5DRJA 2JFAB 3OOFA 1S9PA 1KKQA 1L2JA 1ILGA 3GN8A 5KCEA 5DWLA 3FALA 2HB7A 1I38A 2P7ZA 3F5CB 3OSIA 4IA3A 1PRGA 4ONIA 2FAIA 4QE6A 2FSZA 4RAKA 1NAXA 2YJAB 4OH6A 2ATHA 5DKBA 5DZ1A 2Q5PA 3L0LA 2Q1VA 4OJ4A 4S0SA 3VHWA 3KMGA 4CI5A 1S9QA 2QR9A 5DWJA 2OM9A 2ZNOA 5DRMA 2OVHA 2O4RA 1A28A 2OAXA 1M13A 3B66A 3KMZA 3OKIA 1YP0A 4G2IA 3VT5A 1G1UA 1L2IA 2YATA 3K8SA 3G0WA 2Q61A 4TV1A 1Y9RA 5AAUA 2Q5SA 4YNKA 2PJLA 4E4KA 3GWSX 5DLRA 5DTVA 1NQ7A 3ADUA 3JZCA 5DIDA 1FM6D 3ADXA 2AWHA 3G8IA 3KPZA 4OGHA 4R6SA 1GS4A 3ERDA 5GT4A 1E3KA 5DZ3A 4NB6A 5APJA 3W5QA 3VTBA 2GPUA 3S9SA 4MG8B 1XV9A 2BAWA 2VV4B 2LBDA 4RZEA 4Y29A 3B0TA 1NRLA 1XQCA 3VRUA 3IPSA 2PRGA 2YLYA 1UHLA 1OVLB 4RMEA 4ZNVA 3HQ5A 2AAXA 1PQ9A 2ZKCA 1XAPA 2B1VA 3D57A 1G2NA 4IW8A 3ET1A 1MV9A 1X7JA 1K4WA 3AN3A 5DYDA 5DXBA 5C4OA 4G20A 3A40X 2H79A 2OVMA 5G46A 4XAOA 4IV2A 1RKHA 3B65A 4MGAA 2QMVA 3O1EA 4XTAA 3CS8A 4NUFA 5G42A 1XP6A 3KFCA 3VT3A 5JJMB 5IAWA 3WT5A 4OFUA 3OMOA 2W8YA 1XLSA 1ERRA 1RDTD 3AUQA 5E0XA 2J7YA 3E94A 1XJ7A 3VT6A 5C4SA 1QKNA 5F9BA 5KRMA 1LV2A 4OK1A 1EREA 5DYBA 3W5TA 2YLOA 3V3EA 3V4AA 5DVCA 5KRLA 2VSRA 2AM9A 2Q7LA 3V9TA 3B3KA 3A9EB 4KZIA 4S15A 2ZK6A 1YMTA 3IPUA 3DZUD 1NQ2A 2B23A 3OMPA 1K74D 1XDKA 3HODA 1R1KA 2QA6A 2FVJA 4MGCA 4WQPA 4NQAB 5IXKA 5DX3A 3IA6A 4MG7A 1X76A 3OMMA 3AN4A 5ETHA 5DXKA 4TUZA 3UUDB 3B67A 3RY9A 5HJSA 4QK4A 4OZTU 4MGDA 5LGAA 1FD0A 3OAPA 5DXEA 2P1TA 3UVVA 2R6WA 3KDTA 3MNPA 4XI3A 1YA3A 3A2HA 2I4PA 4ZNTA 3UP0A 1N4HA 4E4QA 3FLIA 2QA8A 2H77A 5DY8A 3W0YA 2VSTA 2QZOB 2V0VA 1I7IA 1T5ZA 5KCWA 3OMQA 2ZK5A 4PLDA 1GWXA 3BQDA 2NXXA 2ZLAA 5DMCA 3UUAB 3KMRA 5DKSA 5DP0A 5ICKA 3WMHA 4UDAA 4OJ9A 1YJEA 1UPWA 2I4ZA 3DCTA 1FCXA 2PIVA 5DUHA 3N00A 4YPQA 4ZI1A 4FHHA 5HCVA 2Q6RA 1KV6A 2AA7A 4IWFA 2PNUA 3D6DA 3GD2A 5DXPA 5FQSA 4P6WA 3CWDA 3E7CA 3Q95B 1XZXX 5DXQA 3U9QA 3HM1A 3IXPD 3KBAA 5G44A 2ZVTA 2HAMA 4M8HA 2GWXA 2AX8A 3E00D 3AZ2A 5DL4A 1FBYA 2O4JA 3V9YA 5JY3A 5DKEA 2Q1HA 1U3QA 3L1BA 3PO9A 4A4VA 2BJ4A 5DWGA 3WJ4A 4OJBA 4EM9A 3RVFA 4J5XC 1XNNA 1T74A 5GIDA 4J5WC 3OOKA 4RWVA 5KR9A 5DXRA 3HO0A 2ZK0A 1T7MA 2HB8A 4ZNUA 3VHUA 3A2IA 4RE8A 4HLWA 2ZK3A 3DZYA 3OLLA 1Z5XU 4IWCA 5E7VA 3HZFA 1XP9A 4J24A 2P54A 2HCDA 3B68A 3OSWA 5L7HA 3WT7A 4IA2A 4MDDA 4JAZA 3OS9A 1YOKA 2OUZA 3A78A 5LWPA 5EHJA 2QSEA 3PEQA 3W0HA 1NQ0A 4Q50A 5KCCA 1FCZA 2G44A 2YFEA 3VI8A 1QKUA 1Y0SA 1YY4A 2PKLA 3OS8A 4ZO1B 1QKTA 3GBKA 3AX8A 3CJWA 4WHFA 2PITA 3D24A 3VJTA 1I37A 3P88A 5G45A 5DV8A 4N73A 1OSVA 4IW6A 5AZTA 3FALB 4NIEA 2Q8SA 4OEZA 1UPVA 4RZFA 1T79A 4QE8A 2NV7A 3K23A 3VRVA 3VT4A 1Z95A 3W0JA 3JZBA 5DZHA 4RMDA 3VSOA 5DMFA 1RK3A 2ZBSA 4L98A 2B1ZA 1A52A 4M8EA 4OZRU 4WLBA 5DV3A 1FM6A 4DK7A 3FC6A 3G8OA 3KWYA 4K4JA 2P1UA 5AAVA 4G1YA 5E19A 5DUGA 5HJPA 2HC4A 4PXMA 1P93A 3H52A 3GWXA 3UP3A 3W5RA 4TV1B 1OSHA 1NQ1A 3H0AD 5L7GA 5KRHA 2AYRA 1FM9D 3IPQA 2J7XA 3VJHA 3AUNA 1X78A 3O1DA 5H1EA 1FM9A 4P6XA 1HJ1A 2P7GA 3VT7A 1U3SA 1ZGYA 2ZNNA 4IS8A 4K7AA 2AX6A 4XUMA 3ZQTA 1YOWA 3QT0A 2XYXA 2I0JA 1XV9B 2P4YA 4IV4A 5G3JA 2PIWA 2R6YA 1UHLB 3TKMA 4OEDA 1XP1A 4JYGA 3SP6A 4LNWA 1EXAA 2PIOA 4RMCA 4UDCA 1OT7A 1YYEA 2PIXA 1Y0XX 5DK9A 4DM6A 4HEEX 2XYJA 3OSAA 3EYBA 5DXBB 3WTQA 5KROA 1UOMA 4QL8A 1RDTA 1ZAFA 2XKWA 3FURA 4FN9A 2I0GA 3B1MA 5KRJA 3V9VA 4MGBA 3VTDA 2G0GA 3T03A 3VT8A 4MGAB 3TKCA 2IOGA 3OKHA 2PIUA 2E2RA 3B0WA 3RLJA 3V3QA 2P1VA 5KRKA 3B5RA 3CS4A 3P89A 5FQTA 2QXSA 2POGA 3VHVA 2G5OA 3DZUA 2YJDA 1K74A 5E14A 4G1ZA 1U3RA 4G1DA 4MG6A 2ACLA 1NHZA 4ZOMA 5KCFA 2QTUA 3WGPA 4OKBA 3ADVA 2ZMHA 2XYWA 4IA7A 1E3GA 1XVPA 1NUOA 3M7RA 4IVYA 5FQPA 3A3ZX 1GWRA 5DZIA 2GPVA 3K22A 2I4JA 1R6GA 1XDKB 2HVCA 5C4TA 1MZNA 1X7BA 2ZNPA 2QW4A 3ET3A 3KDUA 4MG7B 4ZNWA 5DX3B 1NAVA 3OLFA 4OKTA 3ERTA 3F7DA 4OILA 4TUZB 4DQMA 3AFRA 2ZXNA 4ZJWA 4OZTE 4F9MA 4N5GA 2ZXMA 1IE9A 4MGDB 3FXVA 3HC6A 4LTWA 3RUTA 1ZH7A 1T7FA 1T65A 3UVVB 3R8AA 3UU7A 5K13A 3R2AA 2QABA 4IA1A 4OFRA 4RUPA 3LMPA 4R06A 2QA8B 1PZLA 1PCGA 4OEAA 3L3XA 4DM8A 3VSPA 3CLDA 4OC7A 1GWQA 3WFFA 3L0EA 3WJ5A 4G2HA 1M2ZA 4ZNSA 3IXPA 1K7LA 2VV2A
chains in the Genus database with same CATH topology
2VV1A 2QGTA 3UUCA 1XOWA 1DKFA 5B41A 1S0XA 3VTCA 1T7TA 4YT1A 4RFWA 4PVUA 1SJ0A 5DIGA 1R5KA 3E00A 2V7CA 4RUJA 3X1HA 4E2JA 4XLDA 1KNUA 4XUHA 5E1CA 2A3IA 1ZDTA 1G50A 2PIPL 5APKA 4MG9A 1FCYA 2AXAA 3ZRAA 2R40D 2HASA 2Q59A 5EITA 5DWIA 4APUA 2HWRA 2Q60A 2Q5GA 3FEJA 4N1YA 4OLMA 4RUOX 2QNVA 4UDBA 4IQRA 2GPOA 1WM0X 2BJ4B 1YIMA 4PWLA 4IU7A 4ZNHA 3X1IA 2GL8A 5KYAA 5KRCA 5APHA 2ABIA 5L11A 5EC9A 2QGWA 3L03A 3B0RA 3OZJA 3ADSA 2Q3YA 3WT6A 1T76A 3TX7B 5HYRA 2J4AA 4IVWA 1R20D 1PDUA 1Z5XE 2JFAA 2JJ3A 4QJRA 4DK8A 3VRWA 1R20A 3F5CA 4PPPA 2ZNQA 3NSPA 5AVIA 5KCUA 2ZASA 2YLQA 3BEJA 4OIVA 3RUUA 3SP9A 3X36A 3ZR7A 3R8DA 3V49A 4X1GA 1TFCA 1I7GA 3R29A 2HWQA 3PRGA 3D5FA 5KCDA 1XB7A 1S0ZA 1VJBA 4OKXA 5IZ0A 1M7WA 2ZMJA 2AO6A 2Q7KA 3CDSA 2REWA 2PINA 5GICA 4PPSA 2PIQA 3DCUA 3HC5A 4POJA 3OS8C 4RZGA 3OZ0A 3DY6A 4B7WA 1XLSE 4WHGA 3KYTA 2VV3A 1NDEA 3W0GA 4BCRA 3AURA 1YINA 3R8IA 4ITEA 4LSJA 3ADTA 3X31A 2Q6JA 4XHDA 5EI1A 2AX7A 5G43A 2OZ7A 2PIRA 1NYXA 3RLLA 2IOKA 3CS6A 3H0AA 2ZK4A 4MG8A 4OZRE 2VV4A 4L96A 4R2UA 3GYUA 3FC6B 1ZKYA 4ZN7A 5AAVB 3W0CA 1HG4A 4S14A 3A2JA 1OVLA 5KRFA 5FQRA 3VN2A 5HJPB 4G21A 3TY0A 3PLZA 3VJIA 3LBDA 4DMAA 4O8FA 2ZLCA 5DSHA 2QPYA 3W0AA 3FUGA 1SKXA 5DI7A 1X7RA 4IUIA 4S0TA 3G9EA 1N83A 3FS1A 3ILZA 4OH5A 1RJKA 4PP6A 5FQVA 3WWRA 4CI4A 5EGVA 2EWPA 1T63A 2YLPA 4QM0A 5B5BA 4KZJA 2NXXE 2POBA 3ET2A 5SYZA 5JJMA 5KRAA 1S19A 2O9IA 3PBAA 4WPFA 4ZN9A 2Z4BA 5AWJA 2ZK2A 2P15A 5AVLA 1TXIA 1T73A 3CQVA 5AYGA 1PQ6A 2GPPA 4OARA 4OKWA 5DIEA 4FNEA 5AZVA 5KD9A 2JF9A 1ZDUA 5EJVA 2P7AA 3A9EA 3AZ3A 3B0QA 4REFA 3W5PA 1SR7A 2GP7A 1XQ3A 2Q7IA 4MGBB 1U9EA 2G0HA 3ADWA 5DKGA 5I4VA 3ET0A 4KZMA 1H9UA 3P0UA 5E0WA 4REEA 3UUDA 1G5YA 3NOAA 2B50A 3L0JA 4NY9A 4FGYA 1X7EA 2AX9A 1MVCA 5E15A 2AB2A 4JYHA 1R1KD 4PP5A 3VT9A 3DR1A 1ZUCA 5A86A 2ACLB 5HZCA 3GZ9A 4A2JA 2ZXZA 2QZOA 5KCTA 2XHSA 3HVLA 3OGTA 1XVPB 1ILHA 4ZO1X 3P8XA 3UUAA 4DOSA 3FEIA 1P8DA 5GIEA 2QH6A 5ACCA 5AK2A 2F4BA 4UDDA 1BSXA 3DT3A 3CDPA 3W0IA 5JI0D 3PCUA 4XT9A 1YUCA 4A4WA 2J14A 2ZFXA 3CTBA 4PRGA 4OHAA 1T7RA 5DVVA 3VRTA 4K6IA 4JL4A 1SQNA 5DXGA 4JGVA 2NPAA 2AA2A 3Q95A 4FHIA 4J26A 5HYKA 3HLVA 4YMQA 2ZL9A 2GIUA 3UU7B 2Q7JA 2AMBA 3OLSA 3R5NA 5DXMA 2AA5A 1RKGA 2VV0A 3MNEA 1XNXA 1Q4XA 2Q6SA 5DVSA 4PF3A 4MG5A 1N46A 4J5XA 1XIUA 4J5WA 1ZEOA 3GYTA 3ZRBA 1QKMA 4LNXA 4OIUA 2R40A 3D90A 2AA6A 2VV1B 1EXXA 5DWEA 4X1FA 5AWKA 1DKFB 2HBHA 2ZK1A 2OCFA 5G5WA 5C4UA 3AZ1A 2ZY0A 2Q70A 4WVDA 2GTKA 2QE4A 1IE8A 3L3ZA 5CJ6A 4PP3A 5KRIA 3NSQA 5L7EA 4MG9B 5M96A 2IHQA 4LBDA 1LBDA 4DORA 2Q59B 2Z4JA 3IMYA 3MNOA 1XPCA 2NW4A 5KYJA 4ITFA 4CSJA 3WFGA 3SZ1A 4ZJRA 5DUEA 2YHDA 4JYIA 5DV6A 3VJSA 2ZMIA 3K6PA 5DU5A 3DZYD 4Q0AC 4POHA 1PQCA 4EMAA 2HFPA 5DZ0A 3BC5A 4N8RA 3OMKA 1PK5A 2AMAA 2HARA 2QXMA 4OEYA 3R5MA 4PLEA 4Q13A 1DB1A 5DRJA 2JFAB 3OOFA 1S9PA 1KKQA 1L2JA 1ILGA 3GN8A 5KCEA 5DWLA 3FALA 2HB7A 1I38A 2P7ZA 3F5CB 3OSIA 4IA3A 1PRGA 4ONIA 2FAIA 4QE6A 2FSZA 4RAKA 1NAXA 2YJAB 4OH6A 2ATHA 5DKBA 5DZ1A 2Q5PA 3L0LA 2Q1VA 4OJ4A 4S0SA 3VHWA 3KMGA 4CI5A 1S9QA 2QR9A 5DWJA 2OM9A 2ZNOA 5DRMA 2OVHA 2O4RA 1A28A 2OAXA 1M13A 3B66A 3KMZA 3OKIA 1YP0A 4G2IA 3VT5A 1G1UA 1L2IA 2YATA 3K8SA 3G0WA 2Q61A 4TV1A 1Y9RA 5AAUA 2Q5SA 4YNKA 2PJLA 4E4KA 3GWSX 5DLRA 5DTVA 1NQ7A 3ADUA 3JZCA 5DIDA 1FM6D 3ADXA 2AWHA 3G8IA 3KPZA 4OGHA 4R6SA 1GS4A 3ERDA 5GT4A 1E3KA 5DZ3A 4NB6A 5APJA 3W5QA 3VTBA 2GPUA 3S9SA 4MG8B 1XV9A 2BAWA 2VV4B 2LBDA 4RZEA 4Y29A 3B0TA 1NRLA 1XQCA 3VRUA 3IPSA 2PRGA 2YLYA 1UHLA 1OVLB 4RMEA 4ZNVA 3HQ5A 2AAXA 1PQ9A 2ZKCA 1XAPA 2B1VA 3D57A 1G2NA 4IW8A 3ET1A 1MV9A 1X7JA 1K4WA 3AN3A 5DYDA 5DXBA 5C4OA 4G20A 3A40X 2H79A 2OVMA 5G46A 4XAOA 4IV2A 1RKHA 3B65A 4MGAA 2QMVA 3O1EA 4XTAA 3CS8A 4NUFA 5G42A 1XP6A 3KFCA 3VT3A 5JJMB 5IAWA 3WT5A 4OFUA 3OMOA 2W8YA 1XLSA 1ERRA 1RDTD 3AUQA 5E0XA 2J7YA 3E94A 1XJ7A 3VT6A 5C4SA 1QKNA 5F9BA 5KRMA 1LV2A 4OK1A 1EREA 5DYBA 3W5TA 2YLOA 3V3EA 3V4AA 5DVCA 5KRLA 2VSRA 2AM9A 2Q7LA 3V9TA 3B3KA 3A9EB 4KZIA 4S15A 2ZK6A 1YMTA 3IPUA 3DZUD 1NQ2A 2B23A 3OMPA 1K74D 1XDKA 3HODA 1R1KA 2QA6A 2FVJA 4MGCA 4WQPA 4NQAB 5IXKA 5DX3A 3IA6A 4MG7A 1X76A 3OMMA 3AN4A 5ETHA 5DXKA 4TUZA 3UUDB 3B67A 3RY9A 5HJSA 4QK4A 4OZTU 4MGDA 5LGAA 1FD0A 3OAPA 5DXEA 2P1TA 3UVVA 2R6WA 3KDTA 3MNPA 4XI3A 1YA3A 3A2HA 2I4PA 4ZNTA 3UP0A 1N4HA 4E4QA 3FLIA 2QA8A 2H77A 5DY8A 3W0YA 2VSTA 2QZOB 2V0VA 1I7IA 1T5ZA 5KCWA 3OMQA 2ZK5A 4PLDA 1GWXA 3BQDA 2NXXA 2ZLAA 5DMCA 3UUAB 3KMRA 5DKSA 5DP0A 5ICKA 3WMHA 4UDAA 4OJ9A 1YJEA 1UPWA 2I4ZA 3DCTA 1FCXA 2PIVA 5DUHA 3N00A 4YPQA 4ZI1A 4FHHA 5HCVA 2Q6RA 1KV6A 2AA7A 4IWFA 2PNUA 3D6DA 3GD2A 5DXPA 5FQSA 4P6WA 3CWDA 3E7CA 3Q95B 1XZXX 5DXQA 3U9QA 3HM1A 3IXPD 3KBAA 5G44A 2ZVTA 2HAMA 4M8HA 2GWXA 2AX8A 3E00D 3AZ2A 5DL4A 1FBYA 2O4JA 3V9YA 5JY3A 5DKEA 2Q1HA 1U3QA 3L1BA 3PO9A 4A4VA 2BJ4A 5DWGA 3WJ4A 4OJBA 4EM9A 3RVFA 4J5XC 1XNNA 1T74A 5GIDA 4J5WC 3OOKA 4RWVA 5KR9A 5DXRA 3HO0A 2ZK0A 1T7MA 2HB8A 4ZNUA 3VHUA 3A2IA 4RE8A 4HLWA 2ZK3A 3DZYA 3OLLA 1Z5XU 4IWCA 5E7VA 3HZFA 1XP9A 4J24A 2P54A 2HCDA 3B68A 3OSWA 5L7HA 3WT7A 4IA2A 4MDDA 4JAZA 3OS9A 1YOKA 2OUZA 3A78A 5LWPA 5EHJA 2QSEA 3PEQA 3W0HA 1NQ0A 4Q50A 5KCCA 1FCZA 2G44A 2YFEA 3VI8A 1QKUA 1Y0SA 1YY4A 2PKLA 3OS8A 4ZO1B 1QKTA 3GBKA 3AX8A 3CJWA 4WHFA 2PITA 3D24A 3VJTA 1I37A 3P88A 5G45A 5DV8A 4N73A 1OSVA 4IW6A 5AZTA 3FALB 4NIEA 2Q8SA 4OEZA 1UPVA 4RZFA 1T79A 4QE8A 2NV7A 3K23A 3VRVA 3VT4A 1Z95A 3W0JA 3JZBA 5DZHA 4RMDA 3VSOA 5DMFA 1RK3A 2ZBSA 4L98A 2B1ZA 1A52A 4M8EA 4OZRU 4WLBA 5DV3A 1FM6A 4DK7A 3FC6A 3G8OA 3KWYA 4K4JA 2P1UA 5AAVA 4G1YA 5E19A 5DUGA 5HJPA 2HC4A 4PXMA 1P93A 3H52A 3GWXA 3UP3A 3W5RA 4TV1B 1OSHA 1NQ1A 3H0AD 5L7GA 5KRHA 2AYRA 1FM9D 3IPQA 2J7XA 3VJHA 3AUNA 1X78A 3O1DA 5H1EA 1FM9A 4P6XA 1HJ1A 2P7GA 3VT7A 1U3SA 1ZGYA 2ZNNA 4IS8A 4K7AA 2AX6A 4XUMA 3ZQTA 1YOWA 3QT0A 2XYXA 2I0JA 1XV9B 2P4YA 4IV4A 5G3JA 2PIWA 2R6YA 1UHLB 3TKMA 4OEDA 1XP1A 4JYGA 3SP6A 4LNWA 1EXAA 2PIOA 4RMCA 4UDCA 1OT7A 1YYEA 2PIXA 1Y0XX 5DK9A 4DM6A 4HEEX 2XYJA 3OSAA 3EYBA 5DXBB 3WTQA 5KROA 1UOMA 4QL8A 1RDTA 1ZAFA 2XKWA 3FURA 4FN9A 2I0GA 3B1MA 5KRJA 3V9VA 4MGBA 3VTDA 2G0GA 3T03A 3VT8A 4MGAB 3TKCA 2IOGA 3OKHA 2PIUA 2E2RA 3B0WA 3RLJA 3V3QA 2P1VA 5KRKA 3B5RA 3CS4A 3P89A 5FQTA 2QXSA 2POGA 3VHVA 2G5OA 3DZUA 2YJDA 1K74A 5E14A 4G1ZA 1U3RA 4G1DA 4MG6A 2ACLA 1NHZA 4ZOMA 5KCFA 2QTUA 3WGPA 4OKBA 3ADVA 2ZMHA 2XYWA 4IA7A 1E3GA 1XVPA 1NUOA 3M7RA 4IVYA 5FQPA 3A3ZX 1GWRA 5DZIA 2GPVA 3K22A 2I4JA 1R6GA 1XDKB 2HVCA 5C4TA 1MZNA 1X7BA 2ZNPA 2QW4A 3ET3A 3KDUA 4MG7B 4ZNWA 5DX3B 1NAVA 3OLFA 4OKTA 3ERTA 3F7DA 4OILA 4TUZB 4DQMA 3AFRA 2ZXNA 4ZJWA 4OZTE 4F9MA 4N5GA 2ZXMA 1IE9A 4MGDB 3FXVA 3HC6A 4LTWA 3RUTA 1ZH7A 1T7FA 1T65A 3UVVB 3R8AA 3UU7A 5K13A 3R2AA 2QABA 4IA1A 4OFRA 4RUPA 3LMPA 4R06A 2QA8B 1PZLA 1PCGA 4OEAA 3L3XA 4DM8A 3VSPA 3CLDA 4OC7A 1GWQA 3WFFA 3L0EA 3WJ5A 4G2HA 1M2ZA 4ZNSA 3IXPA 1K7LA 2VV2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VV1 A;  2QGT A;  3UUC A;  1XOW A;  1DKF A;  5B41 A;  1S0X A;  3VTC A;  1T7T A;  4YT1 A;  4RFW A;  4PVU A;  1SJ0 A;  5DIG A;  1R5K A;  3E00 A;  2V7C A;  4RUJ A;  3X1H A;  4E2J A;  4XLD A;  1KNU A;  4XUH A;  5E1C A;  2A3I A;  1ZDT A;  1G50 A;  2PIP L;  5APK A;  4MG9 A;  1FCY A;  2AXA A;  3ZRA A;  2R40 D;  2HAS A;  2Q59 A;  5EIT A;  5DWI A;  4APU A;  2HWR A;  2Q60 A;  2Q5G A;  3FEJ A;  4N1Y A;  4OLM A;  4RUO X;  2QNV A;  4UDB A;  4IQR A;  2GPO A;  1WM0 X;  2BJ4 B;  1YIM A;  4PWL A;  4IU7 A;  4ZNH A;  3X1I A;  2GL8 A;  5KYA A;  5KRC A;  5APH A;  2ABI A;  5L11 A;  5EC9 A;  2QGW A;  3L03 A;  3B0R A;  3OZJ A;  3ADS A;  2Q3Y A;  3WT6 A;  1T76 A;  3TX7 B;  5HYR A;  2J4A A;  4IVW A;  1R20 D;  1PDU A;  1Z5X E;  2JFA A;  2JJ3 A;  4QJR A;  4DK8 A;  3VRW A;  1R20 A;  3F5C A;  4PPP A;  2ZNQ A;  3NSP A;  5AVI A;  5KCU A;  2ZAS A;  2YLQ A;  3BEJ A;  4OIV A;  3RUU A;  3SP9 A;  3X36 A;  3ZR7 A;  3R8D A;  3V49 A;  4X1G A;  1TFC A;  1I7G A;  3R29 A;  2HWQ A;  3PRG A;  3D5F A;  5KCD A;  1XB7 A;  1S0Z A;  1VJB A;  4OKX A;  5IZ0 A;  1M7W A;  2ZMJ A;  2AO6 A;  2Q7K A;  3CDS A;  2REW A;  2PIN A;  5GIC A;  4PPS A;  2PIQ A;  3DCU A;  3HC5 A;  4POJ A;  3OS8 C;  4RZG A;  3OZ0 A;  3DY6 A;  4B7W A;  1XLS E;  4WHG A;  3KYT A;  2VV3 A;  1NDE A;  3W0G A;  4BCR A;  3AUR A;  1YIN A;  3R8I A;  4ITE A;  4LSJ A;  3ADT A;  3X31 A;  2Q6J A;  4XHD A;  5EI1 A;  2AX7 A;  5G43 A;  2OZ7 A;  2PIR A;  1NYX A;  3RLL A;  2IOK A;  3CS6 A;  3H0A A;  2ZK4 A;  4MG8 A;  4OZR E;  2VV4 A;  4L96 A;  4R2U A;  3GYU A;  3FC6 B;  1ZKY A;  4ZN7 A;  5AAV B;  3W0C A;  1HG4 A;  4S14 A;  3A2J A;  1OVL A;  5KRF A;  5FQR A;  3VN2 A;  5HJP B;  4G21 A;  3TY0 A;  3PLZ A;  3VJI A;  3LBD A;  4DMA A;  4O8F A;  2ZLC A;  5DSH A;  2QPY A;  3W0A A;  3FUG A;  1SKX A;  5DI7 A;  1X7R A;  4IUI A;  4S0T A;  3G9E A;  1N83 A;  3FS1 A;  3ILZ A;  4OH5 A;  1RJK A;  4PP6 A;  5FQV A;  3WWR A;  4CI4 A;  5EGV A;  2EWP A;  1T63 A;  2YLP A;  4QM0 A;  5B5B A;  4KZJ A;  2NXX E;  2POB A;  3ET2 A;  5SYZ A;  5JJM A;  5KRA A;  1S19 A;  2O9I A;  3PBA A;  4WPF A;  4ZN9 A;  2Z4B A;  5AWJ A;  2ZK2 A;  2P15 A;  5AVL A;  1TXI A;  1T73 A;  3CQV A;  5AYG A;  1PQ6 A;  2GPP A;  4OAR A;  4OKW A;  5DIE A;  4FNE A;  5AZV A;  5KD9 A;  2JF9 A;  1ZDU A;  5EJV A;  2P7A A;  3A9E A;  3AZ3 A;  3B0Q A;  4REF A;  3W5P A;  1SR7 A;  2GP7 A;  1XQ3 A;  2Q7I A;  4MGB B;  1U9E A;  2G0H A;  3ADW A;  5DKG A;  5I4V A;  3ET0 A;  4KZM A;  1H9U A;  3P0U A;  5E0W A;  4REE A;  3UUD A;  1G5Y A;  3NOA A;  2B50 A;  3L0J A;  4NY9 A;  4FGY A;  1X7E A;  2AX9 A;  1MVC A;  5E15 A;  2AB2 A;  4JYH A;  1R1K D;  4PP5 A;  3VT9 A;  3DR1 A;  1ZUC A;  5A86 A;  2ACL B;  5HZC A;  3GZ9 A;  4A2J A;  2ZXZ A;  2QZO A;  5KCT A;  2XHS A;  3HVL A;  3OGT A;  1XVP B;  1ILH A;  4ZO1 X;  3P8X A;  3UUA A;  4DOS A;  3FEI A;  1P8D A;  5GIE A;  2QH6 A;  5ACC A;  5AK2 A;  2F4B A;  4UDD A;  1BSX A;  3DT3 A;  3CDP A;  3W0I A;  5JI0 D;  3PCU A;  4XT9 A;  1YUC A;  4A4W A;  2J14 A;  2ZFX A;  3CTB A;  4PRG A;  4OHA A;  1T7R A;  5DVV A;  3VRT A;  4K6I A;  4JL4 A;  1SQN A;  5DXG A;  4JGV A;  2NPA A;  2AA2 A;  3Q95 A;  4FHI A;  4J26 A;  5HYK A;  3HLV A;  4YMQ A;  2ZL9 A;  2GIU A;  3UU7 B;  2Q7J A;  2AMB A;  3OLS A;  3R5N A;  5DXM A;  2AA5 A;  1RKG A;  2VV0 A;  3MNE A;  1XNX A;  1Q4X A;  2Q6S A;  5DVS A;  4PF3 A;  4MG5 A;  1N46 A;  4J5X A;  1XIU A;  4J5W A;  1ZEO A;  3GYT A;  3ZRB A;  1QKM A;  4LNX A;  4OIU A;  2R40 A;  3D90 A;  2AA6 A;  2VV1 B;  1EXX A;  5DWE A;  4X1F A;  5AWK A;  1DKF B;  2HBH A;  2ZK1 A;  2OCF A;  5G5W A;  5C4U A;  3AZ1 A;  2ZY0 A;  2Q70 A;  4WVD A;  2GTK A;  2QE4 A;  1IE8 A;  3L3Z A;  5CJ6 A;  4PP3 A;  5KRI A;  3NSQ A;  5L7E A;  4MG9 B;  5M96 A;  2IHQ A;  4LBD A;  1LBD A;  4DOR A;  2Q59 B;  2Z4J A;  3IMY A;  3MNO A;  1XPC A;  2NW4 A;  5KYJ A;  4ITF A;  4CSJ A;  3WFG A;  3SZ1 A;  4ZJR A;  5DUE A;  2YHD A;  4JYI A;  5DV6 A;  3VJS A;  2ZMI A;  3K6P A;  5DU5 A;  3DZY D;  4Q0A C;  4POH A;  1PQC A;  4EMA A;  2HFP A;  5DZ0 A;  3BC5 A;  4N8R A;  3OMK A;  1PK5 A;  2AMA A;  2HAR A;  2QXM A;  4OEY A;  3R5M A;  4PLE A;  4Q13 A;  1DB1 A;  5DRJ A;  2JFA B;  3OOF A;  1S9P A;  1KKQ A;  1L2J A;  1ILG A;  3GN8 A;  5KCE A;  5DWL A;  3FAL A;  2HB7 A;  1I38 A;  2P7Z A;  3F5C B;  3OSI A;  4IA3 A;  1PRG A;  4ONI A;  2FAI A;  4QE6 A;  2FSZ A;  4RAK A;  1NAX A;  2YJA B;  4OH6 A;  2ATH A;  5DKB A;  5DZ1 A;  2Q5P A;  3L0L A;  2Q1V A;  4OJ4 A;  4S0S A;  3VHW A;  3KMG A;  4CI5 A;  1S9Q A;  2QR9 A;  5DWJ A;  2OM9 A;  2ZNO A;  5DRM A;  2OVH A;  2O4R A;  1A28 A;  2OAX A;  1M13 A;  3B66 A;  3KMZ A;  3OKI A;  1YP0 A;  4G2I A;  3VT5 A;  1G1U A;  1L2I A;  2YAT A;  3K8S A;  3G0W A;  2Q61 A;  4TV1 A;  1Y9R A;  5AAU A;  2Q5S A;  4YNK A;  2PJL A;  4E4K A;  3GWS X;  5DLR A;  5DTV A;  1NQ7 A;  3ADU A;  3JZC A;  5DID A;  1FM6 D;  3ADX A;  2AWH A;  3G8I A;  3KPZ A;  4OGH A;  4R6S A;  1GS4 A;  3ERD A;  5GT4 A;  1E3K A;  5DZ3 A;  4NB6 A;  5APJ A;  3W5Q A;  3VTB A;  2GPU A;  3S9S A;  4MG8 B;  1XV9 A;  2BAW A;  2VV4 B;  2LBD A;  4RZE A;  4Y29 A;  3B0T A;  1NRL A;  1XQC A;  3VRU A;  3IPS A;  2PRG A;  2YLY A;  1UHL A;  1OVL B;  4RME A;  4ZNV A;  3HQ5 A;  2AAX A;  1PQ9 A;  2ZKC A;  1XAP A;  2B1V A;  3D57 A;  1G2N A;  4IW8 A;  3ET1 A;  1MV9 A;  1X7J A;  1K4W A;  3AN3 A;  5DYD A;  5DXB A;  5C4O A;  4G20 A;  3A40 X;  2H79 A;  2OVM A;  5G46 A;  4XAO A;  4IV2 A;  1RKH A;  3B65 A;  4MGA A;  2QMV A;  3O1E A;  4XTA A;  3CS8 A;  4NUF A;  5G42 A;  1XP6 A;  3KFC A;  3VT3 A;  5JJM B;  5IAW A;  3WT5 A;  4OFU A;  3OMO A;  2W8Y A;  1XLS A;  1ERR A;  1RDT D;  3AUQ A;  5E0X A;  2J7Y A;  3E94 A;  1XJ7 A;  3VT6 A;  5C4S A;  1QKN A;  5F9B A;  5KRM A;  1LV2 A;  4OK1 A;  1ERE A;  5DYB A;  3W5T A;  2YLO A;  3V3E A;  3V4A A;  5DVC A;  5KRL A;  2VSR A;  2AM9 A;  2Q7L A;  3V9T A;  3B3K A;  3A9E B;  4KZI A;  4S15 A;  2ZK6 A;  1YMT A;  3IPU A;  3DZU D;  1NQ2 A;  2B23 A;  3OMP A;  1K74 D;  1XDK A;  3HOD A;  1R1K A;  2QA6 A;  2FVJ A;  4MGC A;  4WQP A;  4NQA B;  5IXK A;  5DX3 A;  3IA6 A;  4MG7 A;  1X76 A;  3OMM A;  3AN4 A;  5ETH A;  5DXK A;  4TUZ A;  3UUD B;  3B67 A;  3RY9 A;  5HJS A;  4QK4 A;  4OZT U;  4MGD A;  5LGA A;  1FD0 A;  3OAP A;  5DXE A;  2P1T A;  3UVV A;  2R6W A;  3KDT A;  3MNP A;  4XI3 A;  1YA3 A;  3A2H A;  2I4P A;  4ZNT A;  3UP0 A;  1N4H A;  4E4Q A;  3FLI A;  2QA8 A;  2H77 A;  5DY8 A;  3W0Y A;  2VST A;  2QZO B;  2V0V A;  1I7I A;  1T5Z A;  5KCW A;  3OMQ A;  2ZK5 A;  4PLD A;  1GWX A;  3BQD A;  2NXX A;  2ZLA A;  5DMC A;  3UUA B;  3KMR A;  5DKS A;  5DP0 A;  5ICK A;  3WMH A;  4UDA A;  4OJ9 A;  1YJE A;  1UPW A;  2I4Z A;  3DCT A;  1FCX A;  2PIV A;  5DUH A;  3N00 A;  4YPQ A;  4ZI1 A;  4FHH A;  5HCV A;  2Q6R A;  1KV6 A;  2AA7 A;  4IWF A;  2PNU A;  3D6D A;  3GD2 A;  5DXP A;  5FQS A;  4P6W A;  3CWD A;  3E7C A;  3Q95 B;  1XZX X;  5DXQ A;  3U9Q A;  3HM1 A;  3IXP D;  3KBA A;  5G44 A;  2ZVT A;  2HAM A;  4M8H A;  2GWX A;  2AX8 A;  3E00 D;  3AZ2 A;  5DL4 A;  1FBY A;  2O4J A;  3V9Y A;  5JY3 A;  5DKE A;  2Q1H A;  1U3Q A;  3L1B A;  3PO9 A;  4A4V A;  2BJ4 A;  5DWG A;  3WJ4 A;  4OJB A;  4EM9 A;  3RVF A;  4J5X C;  1XNN A;  1T74 A;  5GID A;  4J5W C;  3OOK A;  4RWV A;  5KR9 A;  5DXR A;  3HO0 A;  2ZK0 A;  1T7M A;  2HB8 A;  4ZNU A;  3VHU A;  3A2I A;  4RE8 A;  4HLW A;  2ZK3 A;  3DZY A;  3OLL A;  1Z5X U;  4IWC A;  5E7V A;  3HZF A;  1XP9 A;  4J24 A;  2P54 A;  2HCD A;  3B68 A;  3OSW A;  5L7H A;  3WT7 A;  4IA2 A;  4MDD A;  4JAZ A;  3OS9 A;  1YOK A;  2OUZ A;  3A78 A;  5LWP A;  5EHJ A;  2QSE A;  3PEQ A;  3W0H A;  1NQ0 A;  4Q50 A;  5KCC A;  1FCZ A;  2G44 A;  2YFE A;  3VI8 A;  1QKU A;  1Y0S A;  1YY4 A;  2PKL A;  3OS8 A;  4ZO1 B;  1QKT A;  3GBK A;  3AX8 A;  3CJW A;  4WHF A;  2PIT A;  3D24 A;  3VJT A;  1I37 A;  3P88 A;  5G45 A;  5DV8 A;  4N73 A;  1OSV A;  4IW6 A;  5AZT A;  3FAL B;  4NIE A;  2Q8S A;  4OEZ A;  1UPV A;  4RZF A;  1T79 A;  4QE8 A;  2NV7 A;  3K23 A;  3VRV A;  3VT4 A;  1Z95 A;  3W0J A;  3JZB A;  5DZH A;  4RMD A;  3VSO A;  5DMF A;  1RK3 A;  2ZBS A;  4L98 A;  2B1Z A;  1A52 A;  4M8E A;  4OZR U;  4WLB A;  5DV3 A;  1FM6 A;  4DK7 A;  3FC6 A;  3G8O A;  3KWY A;  4K4J A;  2P1U A;  5AAV A;  4G1Y A;  5E19 A;  5DUG A;  5HJP A;  2HC4 A;  4PXM A;  1P93 A;  3H52 A;  3GWX A;  3UP3 A;  3W5R A;  4TV1 B;  1OSH A;  1NQ1 A;  3H0A D;  5L7G A;  5KRH A;  2AYR A;  1FM9 D;  3IPQ A;  2J7X A;  3VJH A;  3AUN A;  1X78 A;  3O1D A;  5H1E A;  1FM9 A;  4P6X A;  1HJ1 A;  2P7G A;  3VT7 A;  1U3S A;  1ZGY A;  2ZNN A;  4IS8 A;  4K7A A;  2AX6 A;  4XUM A;  3ZQT A;  1YOW A;  3QT0 A;  2XYX A;  2I0J A;  1XV9 B;  2P4Y A;  4IV4 A;  5G3J A;  2PIW A;  2R6Y A;  1UHL B;  3TKM A;  4OED A;  1XP1 A;  4JYG A;  3SP6 A;  4LNW A;  1EXA A;  2PIO A;  4RMC A;  4UDC A;  1OT7 A;  1YYE A;  2PIX A;  1Y0X X;  5DK9 A;  4DM6 A;  4HEE X;  2XYJ A;  3OSA A;  3EYB A;  5DXB B;  3WTQ A;  5KRO A;  1UOM A;  4QL8 A;  1RDT A;  1ZAF A;  2XKW A;  3FUR A;  4FN9 A;  2I0G A;  3B1M A;  5KRJ A;  3V9V A;  4MGB A;  3VTD A;  2G0G A;  3T03 A;  3VT8 A;  4MGA B;  3TKC A;  2IOG A;  3OKH A;  2PIU A;  2E2R A;  3B0W A;  3RLJ A;  3V3Q A;  2P1V A;  5KRK A;  3B5R A;  3CS4 A;  3P89 A;  5FQT A;  2QXS A;  2POG A;  3VHV A;  2G5O A;  3DZU A;  2YJD A;  1K74 A;  5E14 A;  4G1Z A;  1U3R A;  4G1D A;  4MG6 A;  2ACL A;  1NHZ A;  4ZOM A;  5KCF A;  2QTU A;  3WGP A;  4OKB A;  3ADV A;  2ZMH A;  2XYW A;  4IA7 A;  1E3G A;  1XVP A;  1NUO A;  3M7R A;  4IVY A;  5FQP A;  3A3Z X;  1GWR A;  5DZI A;  2GPV A;  3K22 A;  2I4J A;  1R6G A;  1XDK B;  2HVC A;  5C4T A;  1MZN A;  1X7B A;  2ZNP A;  2QW4 A;  3ET3 A;  3KDU A;  4MG7 B;  4ZNW A;  5DX3 B;  1NAV A;  3OLF A;  4OKT A;  3ERT A;  3F7D A;  4OIL A;  4TUZ B;  4DQM A;  3AFR A;  2ZXN A;  4ZJW A;  4OZT E;  4F9M A;  4N5G A;  2ZXM A;  1IE9 A;  4MGD B;  3FXV A;  3HC6 A;  4LTW A;  3RUT A;  1ZH7 A;  1T7F A;  1T65 A;  3UVV B;  3R8A A;  3UU7 A;  5K13 A;  3R2A A;  2QAB A;  4IA1 A;  4OFR A;  4RUP A;  3LMP A;  4R06 A;  2QA8 B;  1PZL A;  1PCG A;  4OEA A;  3L3X A;  4DM8 A;  3VSP A;  3CLD A;  4OC7 A;  1GWQ A;  3WFF A;  3L0E A;  3WJ5 A;  4G2H A;  1M2Z A;  4ZNS A;  3IXP A;  1K7L A;  2VV2 A; 
#chains in the Genus database with same CATH topology
 2VV1 A;  2QGT A;  3UUC A;  1XOW A;  1DKF A;  5B41 A;  1S0X A;  3VTC A;  1T7T A;  4YT1 A;  4RFW A;  4PVU A;  1SJ0 A;  5DIG A;  1R5K A;  3E00 A;  2V7C A;  4RUJ A;  3X1H A;  4E2J A;  4XLD A;  1KNU A;  4XUH A;  5E1C A;  2A3I A;  1ZDT A;  1G50 A;  2PIP L;  5APK A;  4MG9 A;  1FCY A;  2AXA A;  3ZRA A;  2R40 D;  2HAS A;  2Q59 A;  5EIT A;  5DWI A;  4APU A;  2HWR A;  2Q60 A;  2Q5G A;  3FEJ A;  4N1Y A;  4OLM A;  4RUO X;  2QNV A;  4UDB A;  4IQR A;  2GPO A;  1WM0 X;  2BJ4 B;  1YIM A;  4PWL A;  4IU7 A;  4ZNH A;  3X1I A;  2GL8 A;  5KYA A;  5KRC A;  5APH A;  2ABI A;  5L11 A;  5EC9 A;  2QGW A;  3L03 A;  3B0R A;  3OZJ A;  3ADS A;  2Q3Y A;  3WT6 A;  1T76 A;  3TX7 B;  5HYR A;  2J4A A;  4IVW A;  1R20 D;  1PDU A;  1Z5X E;  2JFA A;  2JJ3 A;  4QJR A;  4DK8 A;  3VRW A;  1R20 A;  3F5C A;  4PPP A;  2ZNQ A;  3NSP A;  5AVI A;  5KCU A;  2ZAS A;  2YLQ A;  3BEJ A;  4OIV A;  3RUU A;  3SP9 A;  3X36 A;  3ZR7 A;  3R8D A;  3V49 A;  4X1G A;  1TFC A;  1I7G A;  3R29 A;  2HWQ A;  3PRG A;  3D5F A;  5KCD A;  1XB7 A;  1S0Z A;  1VJB A;  4OKX A;  5IZ0 A;  1M7W A;  2ZMJ A;  2AO6 A;  2Q7K A;  3CDS A;  2REW A;  2PIN A;  5GIC A;  4PPS A;  2PIQ A;  3DCU A;  3HC5 A;  4POJ A;  3OS8 C;  4RZG A;  3OZ0 A;  3DY6 A;  4B7W A;  1XLS E;  4WHG A;  3KYT A;  2VV3 A;  1NDE A;  3W0G A;  4BCR A;  3AUR A;  1YIN A;  3R8I A;  4ITE A;  4LSJ A;  3ADT A;  3X31 A;  2Q6J A;  4XHD A;  5EI1 A;  2AX7 A;  5G43 A;  2OZ7 A;  2PIR A;  1NYX A;  3RLL A;  2IOK A;  3CS6 A;  3H0A A;  2ZK4 A;  4MG8 A;  4OZR E;  2VV4 A;  4L96 A;  4R2U A;  3GYU A;  3FC6 B;  1ZKY A;  4ZN7 A;  5AAV B;  3W0C A;  1HG4 A;  4S14 A;  3A2J A;  1OVL A;  5KRF A;  5FQR A;  3VN2 A;  5HJP B;  4G21 A;  3TY0 A;  3PLZ A;  3VJI A;  3LBD A;  4DMA A;  4O8F A;  2ZLC A;  5DSH A;  2QPY A;  3W0A A;  3FUG A;  1SKX A;  5DI7 A;  1X7R A;  4IUI A;  4S0T A;  3G9E A;  1N83 A;  3FS1 A;  3ILZ A;  4OH5 A;  1RJK A;  4PP6 A;  5FQV A;  3WWR A;  4CI4 A;  5EGV A;  2EWP A;  1T63 A;  2YLP A;  4QM0 A;  5B5B A;  4KZJ A;  2NXX E;  2POB A;  3ET2 A;  5SYZ A;  5JJM A;  5KRA A;  1S19 A;  2O9I A;  3PBA A;  4WPF A;  4ZN9 A;  2Z4B A;  5AWJ A;  2ZK2 A;  2P15 A;  5AVL A;  1TXI A;  1T73 A;  3CQV A;  5AYG A;  1PQ6 A;  2GPP A;  4OAR A;  4OKW A;  5DIE A;  4FNE A;  5AZV A;  5KD9 A;  2JF9 A;  1ZDU A;  5EJV A;  2P7A A;  3A9E A;  3AZ3 A;  3B0Q A;  4REF A;  3W5P A;  1SR7 A;  2GP7 A;  1XQ3 A;  2Q7I A;  4MGB B;  1U9E A;  2G0H A;  3ADW A;  5DKG A;  5I4V A;  3ET0 A;  4KZM A;  1H9U A;  3P0U A;  5E0W A;  4REE A;  3UUD A;  1G5Y A;  3NOA A;  2B50 A;  3L0J A;  4NY9 A;  4FGY A;  1X7E A;  2AX9 A;  1MVC A;  5E15 A;  2AB2 A;  4JYH A;  1R1K D;  4PP5 A;  3VT9 A;  3DR1 A;  1ZUC A;  5A86 A;  2ACL B;  5HZC A;  3GZ9 A;  4A2J A;  2ZXZ A;  2QZO A;  5KCT A;  2XHS A;  3HVL A;  3OGT A;  1XVP B;  1ILH A;  4ZO1 X;  3P8X A;  3UUA A;  4DOS A;  3FEI A;  1P8D A;  5GIE A;  2QH6 A;  5ACC A;  5AK2 A;  2F4B A;  4UDD A;  1BSX A;  3DT3 A;  3CDP A;  3W0I A;  5JI0 D;  3PCU A;  4XT9 A;  1YUC A;  4A4W A;  2J14 A;  2ZFX A;  3CTB A;  4PRG A;  4OHA A;  1T7R A;  5DVV A;  3VRT A;  4K6I A;  4JL4 A;  1SQN A;  5DXG A;  4JGV A;  2NPA A;  2AA2 A;  3Q95 A;  4FHI A;  4J26 A;  5HYK A;  3HLV A;  4YMQ A;  2ZL9 A;  2GIU A;  3UU7 B;  2Q7J A;  2AMB A;  3OLS A;  3R5N A;  5DXM A;  2AA5 A;  1RKG A;  2VV0 A;  3MNE A;  1XNX A;  1Q4X A;  2Q6S A;  5DVS A;  4PF3 A;  4MG5 A;  1N46 A;  4J5X A;  1XIU A;  4J5W A;  1ZEO A;  3GYT A;  3ZRB A;  1QKM A;  4LNX A;  4OIU A;  2R40 A;  3D90 A;  2AA6 A;  2VV1 B;  1EXX A;  5DWE A;  4X1F A;  5AWK A;  1DKF B;  2HBH A;  2ZK1 A;  2OCF A;  5G5W A;  5C4U A;  3AZ1 A;  2ZY0 A;  2Q70 A;  4WVD A;  2GTK A;  2QE4 A;  1IE8 A;  3L3Z A;  5CJ6 A;  4PP3 A;  5KRI A;  3NSQ A;  5L7E A;  4MG9 B;  5M96 A;  2IHQ A;  4LBD A;  1LBD A;  4DOR A;  2Q59 B;  2Z4J A;  3IMY A;  3MNO A;  1XPC A;  2NW4 A;  5KYJ A;  4ITF A;  4CSJ A;  3WFG A;  3SZ1 A;  4ZJR A;  5DUE A;  2YHD A;  4JYI A;  5DV6 A;  3VJS A;  2ZMI A;  3K6P A;  5DU5 A;  3DZY D;  4Q0A C;  4POH A;  1PQC A;  4EMA A;  2HFP A;  5DZ0 A;  3BC5 A;  4N8R A;  3OMK A;  1PK5 A;  2AMA A;  2HAR A;  2QXM A;  4OEY A;  3R5M A;  4PLE A;  4Q13 A;  1DB1 A;  5DRJ A;  2JFA B;  3OOF A;  1S9P A;  1KKQ A;  1L2J A;  1ILG A;  3GN8 A;  5KCE A;  5DWL A;  3FAL A;  2HB7 A;  1I38 A;  2P7Z A;  3F5C B;  3OSI A;  4IA3 A;  1PRG A;  4ONI A;  2FAI A;  4QE6 A;  2FSZ A;  4RAK A;  1NAX A;  2YJA B;  4OH6 A;  2ATH A;  5DKB A;  5DZ1 A;  2Q5P A;  3L0L A;  2Q1V A;  4OJ4 A;  4S0S A;  3VHW A;  3KMG A;  4CI5 A;  1S9Q A;  2QR9 A;  5DWJ A;  2OM9 A;  2ZNO A;  5DRM A;  2OVH A;  2O4R A;  1A28 A;  2OAX A;  1M13 A;  3B66 A;  3KMZ A;  3OKI A;  1YP0 A;  4G2I A;  3VT5 A;  1G1U A;  1L2I A;  2YAT A;  3K8S A;  3G0W A;  2Q61 A;  4TV1 A;  1Y9R A;  5AAU A;  2Q5S A;  4YNK A;  2PJL A;  4E4K A;  3GWS X;  5DLR A;  5DTV A;  1NQ7 A;  3ADU A;  3JZC A;  5DID A;  1FM6 D;  3ADX A;  2AWH A;  3G8I A;  3KPZ A;  4OGH A;  4R6S A;  1GS4 A;  3ERD A;  5GT4 A;  1E3K A;  5DZ3 A;  4NB6 A;  5APJ A;  3W5Q A;  3VTB A;  2GPU A;  3S9S A;  4MG8 B;  1XV9 A;  2BAW A;  2VV4 B;  2LBD A;  4RZE A;  4Y29 A;  3B0T A;  1NRL A;  1XQC A;  3VRU A;  3IPS A;  2PRG A;  2YLY A;  1UHL A;  1OVL B;  4RME A;  4ZNV A;  3HQ5 A;  2AAX A;  1PQ9 A;  2ZKC A;  1XAP A;  2B1V A;  3D57 A;  1G2N A;  4IW8 A;  3ET1 A;  1MV9 A;  1X7J A;  1K4W A;  3AN3 A;  5DYD A;  5DXB A;  5C4O A;  4G20 A;  3A40 X;  2H79 A;  2OVM A;  5G46 A;  4XAO A;  4IV2 A;  1RKH A;  3B65 A;  4MGA A;  2QMV A;  3O1E A;  4XTA A;  3CS8 A;  4NUF A;  5G42 A;  1XP6 A;  3KFC A;  3VT3 A;  5JJM B;  5IAW A;  3WT5 A;  4OFU A;  3OMO A;  2W8Y A;  1XLS A;  1ERR A;  1RDT D;  3AUQ A;  5E0X A;  2J7Y A;  3E94 A;  1XJ7 A;  3VT6 A;  5C4S A;  1QKN A;  5F9B A;  5KRM A;  1LV2 A;  4OK1 A;  1ERE A;  5DYB A;  3W5T A;  2YLO A;  3V3E A;  3V4A A;  5DVC A;  5KRL A;  2VSR A;  2AM9 A;  2Q7L A;  3V9T A;  3B3K A;  3A9E B;  4KZI A;  4S15 A;  2ZK6 A;  1YMT A;  3IPU A;  3DZU D;  1NQ2 A;  2B23 A;  3OMP A;  1K74 D;  1XDK A;  3HOD A;  1R1K A;  2QA6 A;  2FVJ A;  4MGC A;  4WQP A;  4NQA B;  5IXK A;  5DX3 A;  3IA6 A;  4MG7 A;  1X76 A;  3OMM A;  3AN4 A;  5ETH A;  5DXK A;  4TUZ A;  3UUD B;  3B67 A;  3RY9 A;  5HJS A;  4QK4 A;  4OZT U;  4MGD A;  5LGA A;  1FD0 A;  3OAP A;  5DXE A;  2P1T A;  3UVV A;  2R6W A;  3KDT A;  3MNP A;  4XI3 A;  1YA3 A;  3A2H A;  2I4P A;  4ZNT A;  3UP0 A;  1N4H A;  4E4Q A;  3FLI A;  2QA8 A;  2H77 A;  5DY8 A;  3W0Y A;  2VST A;  2QZO B;  2V0V A;  1I7I A;  1T5Z A;  5KCW A;  3OMQ A;  2ZK5 A;  4PLD A;  1GWX A;  3BQD A;  2NXX A;  2ZLA A;  5DMC A;  3UUA B;  3KMR A;  5DKS A;  5DP0 A;  5ICK A;  3WMH A;  4UDA A;  4OJ9 A;  1YJE A;  1UPW A;  2I4Z A;  3DCT A;  1FCX A;  2PIV A;  5DUH A;  3N00 A;  4YPQ A;  4ZI1 A;  4FHH A;  5HCV A;  2Q6R A;  1KV6 A;  2AA7 A;  4IWF A;  2PNU A;  3D6D A;  3GD2 A;  5DXP A;  5FQS A;  4P6W A;  3CWD A;  3E7C A;  3Q95 B;  1XZX X;  5DXQ A;  3U9Q A;  3HM1 A;  3IXP D;  3KBA A;  5G44 A;  2ZVT A;  2HAM A;  4M8H A;  2GWX A;  2AX8 A;  3E00 D;  3AZ2 A;  5DL4 A;  1FBY A;  2O4J A;  3V9Y A;  5JY3 A;  5DKE A;  2Q1H A;  1U3Q A;  3L1B A;  3PO9 A;  4A4V A;  2BJ4 A;  5DWG A;  3WJ4 A;  4OJB A;  4EM9 A;  3RVF A;  4J5X C;  1XNN A;  1T74 A;  5GID A;  4J5W C;  3OOK A;  4RWV A;  5KR9 A;  5DXR A;  3HO0 A;  2ZK0 A;  1T7M A;  2HB8 A;  4ZNU A;  3VHU A;  3A2I A;  4RE8 A;  4HLW A;  2ZK3 A;  3DZY A;  3OLL A;  1Z5X U;  4IWC A;  5E7V A;  3HZF A;  1XP9 A;  4J24 A;  2P54 A;  2HCD A;  3B68 A;  3OSW A;  5L7H A;  3WT7 A;  4IA2 A;  4MDD A;  4JAZ A;  3OS9 A;  1YOK A;  2OUZ A;  3A78 A;  5LWP A;  5EHJ A;  2QSE A;  3PEQ A;  3W0H A;  1NQ0 A;  4Q50 A;  5KCC A;  1FCZ A;  2G44 A;  2YFE A;  3VI8 A;  1QKU A;  1Y0S A;  1YY4 A;  2PKL A;  3OS8 A;  4ZO1 B;  1QKT A;  3GBK A;  3AX8 A;  3CJW A;  4WHF A;  2PIT A;  3D24 A;  3VJT A;  1I37 A;  3P88 A;  5G45 A;  5DV8 A;  4N73 A;  1OSV A;  4IW6 A;  5AZT A;  3FAL B;  4NIE A;  2Q8S A;  4OEZ A;  1UPV A;  4RZF A;  1T79 A;  4QE8 A;  2NV7 A;  3K23 A;  3VRV A;  3VT4 A;  1Z95 A;  3W0J A;  3JZB A;  5DZH A;  4RMD A;  3VSO A;  5DMF A;  1RK3 A;  2ZBS A;  4L98 A;  2B1Z A;  1A52 A;  4M8E A;  4OZR U;  4WLB A;  5DV3 A;  1FM6 A;  4DK7 A;  3FC6 A;  3G8O A;  3KWY A;  4K4J A;  2P1U A;  5AAV A;  4G1Y A;  5E19 A;  5DUG A;  5HJP A;  2HC4 A;  4PXM A;  1P93 A;  3H52 A;  3GWX A;  3UP3 A;  3W5R A;  4TV1 B;  1OSH A;  1NQ1 A;  3H0A D;  5L7G A;  5KRH A;  2AYR A;  1FM9 D;  3IPQ A;  2J7X A;  3VJH A;  3AUN A;  1X78 A;  3O1D A;  5H1E A;  1FM9 A;  4P6X A;  1HJ1 A;  2P7G A;  3VT7 A;  1U3S A;  1ZGY A;  2ZNN A;  4IS8 A;  4K7A A;  2AX6 A;  4XUM A;  3ZQT A;  1YOW A;  3QT0 A;  2XYX A;  2I0J A;  1XV9 B;  2P4Y A;  4IV4 A;  5G3J A;  2PIW A;  2R6Y A;  1UHL B;  3TKM A;  4OED A;  1XP1 A;  4JYG A;  3SP6 A;  4LNW A;  1EXA A;  2PIO A;  4RMC A;  4UDC A;  1OT7 A;  1YYE A;  2PIX A;  1Y0X X;  5DK9 A;  4DM6 A;  4HEE X;  2XYJ A;  3OSA A;  3EYB A;  5DXB B;  3WTQ A;  5KRO A;  1UOM A;  4QL8 A;  1RDT A;  1ZAF A;  2XKW A;  3FUR A;  4FN9 A;  2I0G A;  3B1M A;  5KRJ A;  3V9V A;  4MGB A;  3VTD A;  2G0G A;  3T03 A;  3VT8 A;  4MGA B;  3TKC A;  2IOG A;  3OKH A;  2PIU A;  2E2R A;  3B0W A;  3RLJ A;  3V3Q A;  2P1V A;  5KRK A;  3B5R A;  3CS4 A;  3P89 A;  5FQT A;  2QXS A;  2POG A;  3VHV A;  2G5O A;  3DZU A;  2YJD A;  1K74 A;  5E14 A;  4G1Z A;  1U3R A;  4G1D A;  4MG6 A;  2ACL A;  1NHZ A;  4ZOM A;  5KCF A;  2QTU A;  3WGP A;  4OKB A;  3ADV A;  2ZMH A;  2XYW A;  4IA7 A;  1E3G A;  1XVP A;  1NUO A;  3M7R A;  4IVY A;  5FQP A;  3A3Z X;  1GWR A;  5DZI A;  2GPV A;  3K22 A;  2I4J A;  1R6G A;  1XDK B;  2HVC A;  5C4T A;  1MZN A;  1X7B A;  2ZNP A;  2QW4 A;  3ET3 A;  3KDU A;  4MG7 B;  4ZNW A;  5DX3 B;  1NAV A;  3OLF A;  4OKT A;  3ERT A;  3F7D A;  4OIL A;  4TUZ B;  4DQM A;  3AFR A;  2ZXN A;  4ZJW A;  4OZT E;  4F9M A;  4N5G A;  2ZXM A;  1IE9 A;  4MGD B;  3FXV A;  3HC6 A;  4LTW A;  3RUT A;  1ZH7 A;  1T7F A;  1T65 A;  3UVV B;  3R8A A;  3UU7 A;  5K13 A;  3R2A A;  2QAB A;  4IA1 A;  4OFR A;  4RUP A;  3LMP A;  4R06 A;  2QA8 B;  1PZL A;  1PCG A;  4OEA A;  3L3X A;  4DM8 A;  3VSP A;  3CLD A;  4OC7 A;  1GWQ A;  3WFF A;  3L0E A;  3WJ5 A;  4G2H A;  1M2Z A;  4ZNS A;  3IXP A;  1K7L A;  2VV2 A; 
#chains in the Genus database with same CATH homology
 2VV1 A;  2QGT A;  3UUC A;  1XOW A;  1DKF A;  5B41 A;  1S0X A;  3VTC A;  1T7T A;  4YT1 A;  4RFW A;  4PVU A;  1SJ0 A;  5DIG A;  1R5K A;  3E00 A;  2V7C A;  4RUJ A;  3X1H A;  4E2J A;  4XLD A;  1KNU A;  4XUH A;  5E1C A;  2A3I A;  1ZDT A;  1G50 A;  2PIP L;  5APK A;  4MG9 A;  1FCY A;  2AXA A;  3ZRA A;  2R40 D;  2HAS A;  2Q59 A;  5EIT A;  5DWI A;  4APU A;  2HWR A;  2Q60 A;  2Q5G A;  3FEJ A;  4N1Y A;  4OLM A;  4RUO X;  2QNV A;  4UDB A;  4IQR A;  2GPO A;  1WM0 X;  2BJ4 B;  1YIM A;  4PWL A;  4IU7 A;  4ZNH A;  3X1I A;  2GL8 A;  5KYA A;  5KRC A;  5APH A;  2ABI A;  5L11 A;  5EC9 A;  2QGW A;  3L03 A;  3B0R A;  3OZJ A;  3ADS A;  2Q3Y A;  3WT6 A;  1T76 A;  3TX7 B;  5HYR A;  2J4A A;  4IVW A;  1R20 D;  1PDU A;  1Z5X E;  2JFA A;  2JJ3 A;  4QJR A;  4DK8 A;  3VRW A;  1R20 A;  3F5C A;  4PPP A;  2ZNQ A;  3NSP A;  5AVI A;  5KCU A;  2ZAS A;  2YLQ A;  3BEJ A;  4OIV A;  3RUU A;  3SP9 A;  3X36 A;  3ZR7 A;  3R8D A;  3V49 A;  4X1G A;  1TFC A;  1I7G A;  3R29 A;  2HWQ A;  3PRG A;  3D5F A;  5KCD A;  1XB7 A;  1S0Z A;  1VJB A;  4OKX A;  5IZ0 A;  1M7W A;  2ZMJ A;  2AO6 A;  2Q7K A;  3CDS A;  2REW A;  2PIN A;  5GIC A;  4PPS A;  2PIQ A;  3DCU A;  3HC5 A;  4POJ A;  3OS8 C;  4RZG A;  3OZ0 A;  3DY6 A;  4B7W A;  1XLS E;  4WHG A;  3KYT A;  2VV3 A;  1NDE A;  3W0G A;  4BCR A;  3AUR A;  1YIN A;  3R8I A;  4ITE A;  4LSJ A;  3ADT A;  3X31 A;  2Q6J A;  4XHD A;  5EI1 A;  2AX7 A;  5G43 A;  2OZ7 A;  2PIR A;  1NYX A;  3RLL A;  2IOK A;  3CS6 A;  3H0A A;  2ZK4 A;  4MG8 A;  4OZR E;  2VV4 A;  4L96 A;  4R2U A;  3GYU A;  3FC6 B;  1ZKY A;  4ZN7 A;  5AAV B;  3W0C A;  1HG4 A;  4S14 A;  3A2J A;  1OVL A;  5KRF A;  5FQR A;  3VN2 A;  5HJP B;  4G21 A;  3TY0 A;  3PLZ A;  3VJI A;  3LBD A;  4DMA A;  4O8F A;  2ZLC A;  5DSH A;  2QPY A;  3W0A A;  3FUG A;  1SKX A;  5DI7 A;  1X7R A;  4IUI A;  4S0T A;  3G9E A;  1N83 A;  3FS1 A;  3ILZ A;  4OH5 A;  1RJK A;  4PP6 A;  5FQV A;  3WWR A;  4CI4 A;  5EGV A;  2EWP A;  1T63 A;  2YLP A;  4QM0 A;  5B5B A;  4KZJ A;  2NXX E;  2POB A;  3ET2 A;  5SYZ A;  5JJM A;  5KRA A;  1S19 A;  2O9I A;  3PBA A;  4WPF A;  4ZN9 A;  2Z4B A;  5AWJ A;  2ZK2 A;  2P15 A;  5AVL A;  1TXI A;  1T73 A;  3CQV A;  5AYG A;  1PQ6 A;  2GPP A;  4OAR A;  4OKW A;  5DIE A;  4FNE A;  5AZV A;  5KD9 A;  2JF9 A;  1ZDU A;  5EJV A;  2P7A A;  3A9E A;  3AZ3 A;  3B0Q A;  4REF A;  3W5P A;  1SR7 A;  2GP7 A;  1XQ3 A;  2Q7I A;  4MGB B;  1U9E A;  2G0H A;  3ADW A;  5DKG A;  5I4V A;  3ET0 A;  4KZM A;  1H9U A;  3P0U A;  5E0W A;  4REE A;  3UUD A;  1G5Y A;  3NOA A;  2B50 A;  3L0J A;  4NY9 A;  4FGY A;  1X7E A;  2AX9 A;  1MVC A;  5E15 A;  2AB2 A;  4JYH A;  1R1K D;  4PP5 A;  3VT9 A;  3DR1 A;  1ZUC A;  5A86 A;  2ACL B;  5HZC A;  3GZ9 A;  4A2J A;  2ZXZ A;  2QZO A;  5KCT A;  2XHS A;  3HVL A;  3OGT A;  1XVP B;  1ILH A;  4ZO1 X;  3P8X A;  3UUA A;  4DOS A;  3FEI A;  1P8D A;  5GIE A;  2QH6 A;  5ACC A;  5AK2 A;  2F4B A;  4UDD A;  1BSX A;  3DT3 A;  3CDP A;  3W0I A;  5JI0 D;  3PCU A;  4XT9 A;  1YUC A;  4A4W A;  2J14 A;  2ZFX A;  3CTB A;  4PRG A;  4OHA A;  1T7R A;  5DVV A;  3VRT A;  4K6I A;  4JL4 A;  1SQN A;  5DXG A;  4JGV A;  2NPA A;  2AA2 A;  3Q95 A;  4FHI A;  4J26 A;  5HYK A;  3HLV A;  4YMQ A;  2ZL9 A;  2GIU A;  3UU7 B;  2Q7J A;  2AMB A;  3OLS A;  3R5N A;  5DXM A;  2AA5 A;  1RKG A;  2VV0 A;  3MNE A;  1XNX A;  1Q4X A;  2Q6S A;  5DVS A;  4PF3 A;  4MG5 A;  1N46 A;  4J5X A;  1XIU A;  4J5W A;  1ZEO A;  3GYT A;  3ZRB A;  1QKM A;  4LNX A;  4OIU A;  2R40 A;  3D90 A;  2AA6 A;  2VV1 B;  1EXX A;  5DWE A;  4X1F A;  5AWK A;  1DKF B;  2HBH A;  2ZK1 A;  2OCF A;  5G5W A;  5C4U A;  3AZ1 A;  2ZY0 A;  2Q70 A;  4WVD A;  2GTK A;  2QE4 A;  1IE8 A;  3L3Z A;  5CJ6 A;  4PP3 A;  5KRI A;  3NSQ A;  5L7E A;  4MG9 B;  5M96 A;  2IHQ A;  4LBD A;  1LBD A;  4DOR A;  2Q59 B;  2Z4J A;  3IMY A;  3MNO A;  1XPC A;  2NW4 A;  5KYJ A;  4ITF A;  4CSJ A;  3WFG A;  3SZ1 A;  4ZJR A;  5DUE A;  2YHD A;  4JYI A;  5DV6 A;  3VJS A;  2ZMI A;  3K6P A;  5DU5 A;  3DZY D;  4Q0A C;  4POH A;  1PQC A;  4EMA A;  2HFP A;  5DZ0 A;  3BC5 A;  4N8R A;  3OMK A;  1PK5 A;  2AMA A;  2HAR A;  2QXM A;  4OEY A;  3R5M A;  4PLE A;  4Q13 A;  1DB1 A;  5DRJ A;  2JFA B;  3OOF A;  1S9P A;  1KKQ A;  1L2J A;  1ILG A;  3GN8 A;  5KCE A;  5DWL A;  3FAL A;  2HB7 A;  1I38 A;  2P7Z A;  3F5C B;  3OSI A;  4IA3 A;  1PRG A;  4ONI A;  2FAI A;  4QE6 A;  2FSZ A;  4RAK A;  1NAX A;  2YJA B;  4OH6 A;  2ATH A;  5DKB A;  5DZ1 A;  2Q5P A;  3L0L A;  2Q1V A;  4OJ4 A;  4S0S A;  3VHW A;  3KMG A;  4CI5 A;  1S9Q A;  2QR9 A;  5DWJ A;  2OM9 A;  2ZNO A;  5DRM A;  2OVH A;  2O4R A;  1A28 A;  2OAX A;  1M13 A;  3B66 A;  3KMZ A;  3OKI A;  1YP0 A;  4G2I A;  3VT5 A;  1G1U A;  1L2I A;  2YAT A;  3K8S A;  3G0W A;  2Q61 A;  4TV1 A;  1Y9R A;  5AAU A;  2Q5S A;  4YNK A;  2PJL A;  4E4K A;  3GWS X;  5DLR A;  5DTV A;  1NQ7 A;  3ADU A;  3JZC A;  5DID A;  1FM6 D;  3ADX A;  2AWH A;  3G8I A;  3KPZ A;  4OGH A;  4R6S A;  1GS4 A;  3ERD A;  5GT4 A;  1E3K A;  5DZ3 A;  4NB6 A;  5APJ A;  3W5Q A;  3VTB A;  2GPU A;  3S9S A;  4MG8 B;  1XV9 A;  2BAW A;  2VV4 B;  2LBD A;  4RZE A;  4Y29 A;  3B0T A;  1NRL A;  1XQC A;  3VRU A;  3IPS A;  2PRG A;  2YLY A;  1UHL A;  1OVL B;  4RME A;  4ZNV A;  3HQ5 A;  2AAX A;  1PQ9 A;  2ZKC A;  1XAP A;  2B1V A;  3D57 A;  1G2N A;  4IW8 A;  3ET1 A;  1MV9 A;  1X7J A;  1K4W A;  3AN3 A;  5DYD A;  5DXB A;  5C4O A;  4G20 A;  3A40 X;  2H79 A;  2OVM A;  5G46 A;  4XAO A;  4IV2 A;  1RKH A;  3B65 A;  4MGA A;  2QMV A;  3O1E A;  4XTA A;  3CS8 A;  4NUF A;  5G42 A;  1XP6 A;  3KFC A;  3VT3 A;  5JJM B;  5IAW A;  3WT5 A;  4OFU A;  3OMO A;  2W8Y A;  1XLS A;  1ERR A;  1RDT D;  3AUQ A;  5E0X A;  2J7Y A;  3E94 A;  1XJ7 A;  3VT6 A;  5C4S A;  1QKN A;  5F9B A;  5KRM A;  1LV2 A;  4OK1 A;  1ERE A;  5DYB A;  3W5T A;  2YLO A;  3V3E A;  3V4A A;  5DVC A;  5KRL A;  2VSR A;  2AM9 A;  2Q7L A;  3V9T A;  3B3K A;  3A9E B;  4KZI A;  4S15 A;  2ZK6 A;  1YMT A;  3IPU A;  3DZU D;  1NQ2 A;  2B23 A;  3OMP A;  1K74 D;  1XDK A;  3HOD A;  1R1K A;  2QA6 A;  2FVJ A;  4MGC A;  4WQP A;  4NQA B;  5IXK A;  5DX3 A;  3IA6 A;  4MG7 A;  1X76 A;  3OMM A;  3AN4 A;  5ETH A;  5DXK A;  4TUZ A;  3UUD B;  3B67 A;  3RY9 A;  5HJS A;  4QK4 A;  4OZT U;  4MGD A;  5LGA A;  1FD0 A;  3OAP A;  5DXE A;  2P1T A;  3UVV A;  2R6W A;  3KDT A;  3MNP A;  4XI3 A;  1YA3 A;  3A2H A;  2I4P A;  4ZNT A;  3UP0 A;  1N4H A;  4E4Q A;  3FLI A;  2QA8 A;  2H77 A;  5DY8 A;  3W0Y A;  2VST A;  2QZO B;  2V0V A;  1I7I A;  1T5Z A;  5KCW A;  3OMQ A;  2ZK5 A;  4PLD A;  1GWX A;  3BQD A;  2NXX A;  2ZLA A;  5DMC A;  3UUA B;  3KMR A;  5DKS A;  5DP0 A;  5ICK A;  3WMH A;  4UDA A;  4OJ9 A;  1YJE A;  1UPW A;  2I4Z A;  3DCT A;  1FCX A;  2PIV A;  5DUH A;  3N00 A;  4YPQ A;  4ZI1 A;  4FHH A;  5HCV A;  2Q6R A;  1KV6 A;  2AA7 A;  4IWF A;  2PNU A;  3D6D A;  3GD2 A;  5DXP A;  5FQS A;  4P6W A;  3CWD A;  3E7C A;  3Q95 B;  1XZX X;  5DXQ A;  3U9Q A;  3HM1 A;  3IXP D;  3KBA A;  5G44 A;  2ZVT A;  2HAM A;  4M8H A;  2GWX A;  2AX8 A;  3E00 D;  3AZ2 A;  5DL4 A;  1FBY A;  2O4J A;  3V9Y A;  5JY3 A;  5DKE A;  2Q1H A;  1U3Q A;  3L1B A;  3PO9 A;  4A4V A;  2BJ4 A;  5DWG A;  3WJ4 A;  4OJB A;  4EM9 A;  3RVF A;  4J5X C;  1XNN A;  1T74 A;  5GID A;  4J5W C;  3OOK A;  4RWV A;  5KR9 A;  5DXR A;  3HO0 A;  2ZK0 A;  1T7M A;  2HB8 A;  4ZNU A;  3VHU A;  3A2I A;  4RE8 A;  4HLW A;  2ZK3 A;  3DZY A;  3OLL A;  1Z5X U;  4IWC A;  5E7V A;  3HZF A;  1XP9 A;  4J24 A;  2P54 A;  2HCD A;  3B68 A;  3OSW A;  5L7H A;  3WT7 A;  4IA2 A;  4MDD A;  4JAZ A;  3OS9 A;  1YOK A;  2OUZ A;  3A78 A;  5LWP A;  5EHJ A;  2QSE A;  3PEQ A;  3W0H A;  1NQ0 A;  4Q50 A;  5KCC A;  1FCZ A;  2G44 A;  2YFE A;  3VI8 A;  1QKU A;  1Y0S A;  1YY4 A;  2PKL A;  3OS8 A;  4ZO1 B;  1QKT A;  3GBK A;  3AX8 A;  3CJW A;  4WHF A;  2PIT A;  3D24 A;  3VJT A;  1I37 A;  3P88 A;  5G45 A;  5DV8 A;  4N73 A;  1OSV A;  4IW6 A;  5AZT A;  3FAL B;  4NIE A;  2Q8S A;  4OEZ A;  1UPV A;  4RZF A;  1T79 A;  4QE8 A;  2NV7 A;  3K23 A;  3VRV A;  3VT4 A;  1Z95 A;  3W0J A;  3JZB A;  5DZH A;  4RMD A;  3VSO A;  5DMF A;  1RK3 A;  2ZBS A;  4L98 A;  2B1Z A;  1A52 A;  4M8E A;  4OZR U;  4WLB A;  5DV3 A;  1FM6 A;  4DK7 A;  3FC6 A;  3G8O A;  3KWY A;  4K4J A;  2P1U A;  5AAV A;  4G1Y A;  5E19 A;  5DUG A;  5HJP A;  2HC4 A;  4PXM A;  1P93 A;  3H52 A;  3GWX A;  3UP3 A;  3W5R A;  4TV1 B;  1OSH A;  1NQ1 A;  3H0A D;  5L7G A;  5KRH A;  2AYR A;  1FM9 D;  3IPQ A;  2J7X A;  3VJH A;  3AUN A;  1X78 A;  3O1D A;  5H1E A;  1FM9 A;  4P6X A;  1HJ1 A;  2P7G A;  3VT7 A;  1U3S A;  1ZGY A;  2ZNN A;  4IS8 A;  4K7A A;  2AX6 A;  4XUM A;  3ZQT A;  1YOW A;  3QT0 A;  2XYX A;  2I0J A;  1XV9 B;  2P4Y A;  4IV4 A;  5G3J A;  2PIW A;  2R6Y A;  1UHL B;  3TKM A;  4OED A;  1XP1 A;  4JYG A;  3SP6 A;  4LNW A;  1EXA A;  2PIO A;  4RMC A;  4UDC A;  1OT7 A;  1YYE A;  2PIX A;  1Y0X X;  5DK9 A;  4DM6 A;  4HEE X;  2XYJ A;  3OSA A;  3EYB A;  5DXB B;  3WTQ A;  5KRO A;  1UOM A;  4QL8 A;  1RDT A;  1ZAF A;  2XKW A;  3FUR A;  4FN9 A;  2I0G A;  3B1M A;  5KRJ A;  3V9V A;  4MGB A;  3VTD A;  2G0G A;  3T03 A;  3VT8 A;  4MGA B;  3TKC A;  2IOG A;  3OKH A;  2PIU A;  2E2R A;  3B0W A;  3RLJ A;  3V3Q A;  2P1V A;  5KRK A;  3B5R A;  3CS4 A;  3P89 A;  5FQT A;  2QXS A;  2POG A;  3VHV A;  2G5O A;  3DZU A;  2YJD A;  1K74 A;  5E14 A;  4G1Z A;  1U3R A;  4G1D A;  4MG6 A;  2ACL A;  1NHZ A;  4ZOM A;  5KCF A;  2QTU A;  3WGP A;  4OKB A;  3ADV A;  2ZMH A;  2XYW A;  4IA7 A;  1E3G A;  1XVP A;  1NUO A;  3M7R A;  4IVY A;  5FQP A;  3A3Z X;  1GWR A;  5DZI A;  2GPV A;  3K22 A;  2I4J A;  1R6G A;  1XDK B;  2HVC A;  5C4T A;  1MZN A;  1X7B A;  2ZNP A;  2QW4 A;  3ET3 A;  3KDU A;  4MG7 B;  4ZNW A;  5DX3 B;  1NAV A;  3OLF A;  4OKT A;  3ERT A;  3F7D A;  4OIL A;  4TUZ B;  4DQM A;  3AFR A;  2ZXN A;  4ZJW A;  4OZT E;  4F9M A;  4N5G A;  2ZXM A;  1IE9 A;  4MGD B;  3FXV A;  3HC6 A;  4LTW A;  3RUT A;  1ZH7 A;  1T7F A;  1T65 A;  3UVV B;  3R8A A;  3UU7 A;  5K13 A;  3R2A A;  2QAB A;  4IA1 A;  4OFR A;  4RUP A;  3LMP A;  4R06 A;  2QA8 B;  1PZL A;  1PCG A;  4OEA A;  3L3X A;  4DM8 A;  3VSP A;  3CLD A;  4OC7 A;  1GWQ A;  3WFF A;  3L0E A;  3WJ5 A;  4G2H A;  1M2Z A;  4ZNS A;  3IXP A;  1K7L A;  2VV2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...