5KCTA

Crystal structure of the er-alpha ligand-binding domain (y537s) in complex with an n-ethyl, 4-chlorobenzyl obhs-n derivative
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
246
structure length
236
Chain Sequence
KNSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLSDLLLEMLDAHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Estrogen receptor
publication title Full antagonism of the estrogen receptor without a prototypical ligand side chain.
pubmed doi rcsb
source organism Homo sapiens
total genus 91
structure length 236
sequence length 246
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 5kctA00
5KRCA 2PIPL 4QJRA 1XQCA 2QA6A 5L11A 1I7GA 1Q4XA 3B67A 3GBKA 5FQTA 1I7IA 2ZBSA 1HG4A 3AZ1A 4JYIA 3UUAA 3VT9A 1BSXA 5C4OA 1MV9A 1YUCA 5DV6A 4PPPA 3FURA 3M7RA 4OZTU 5DWIA 5DKGA 2P15A 3IXPD 3P8XA 3RY9A 3VT6A 3ET1A 2QTUA 1NYXA 1N4HA 1Y0XX 2REWA 3B66A 3IPUA 3K22A 3L03A 3UUDB 4DK7A 3O1EA 5EJVA 1T74A 4IUIA 2VV1B 4RMEA 3OLFA 5DXMA 5CJ6A 2XHSA 3D90A 3KPZA 1R20A 4JYHA 4MGDB 1RK3A 2VV4B 2O4JA 3OMQA 1PDUA 5DKSA 3SP6A 4OZRE 4XLDA 2GWXA 4OILA 3V3QA 3OKHA 2G0HA 4ZI1A 4L96A 3V3EA 3UVVA 4NIEA 2QA8A 2YLQA 5DU5A 4CSJA 5E0XA 3VJIA 3WFFA 1OSVA 4WHFA 2AO6A 2P1TA 5DK9A 5KRLA 1L2IA 2ZK0A 5DY8A 3AN4A 2JJ3A 5G3JA 4OH5A 1FCYA 2OM9A 2AAXA 4X1FA 3OMKA 3R5MA 2ZXNA 3G8OA 3DZYD 2HB8A 4OHAA 3A3ZX 1PQCA 1FM9A 2ZMHA 3PCUA 4KZIA 5KROA 1ZGYA 2Q5SA 2ZMIA 4IQRA 2HASA 5DXGA 2AA6A 5L7EA 1YY4A 1QKUA 1XP6A 3MNEA 3KWYA 4DM6A 3TKMA 2PIVA 3R8IA 5C4SA 3X1IA 1Z95A 2PIQA 3RVFA 1R6GA 4CI5A 1NQ7A 2G5OA 5DX3B 2HARA 2OVMA 3W0YA 3GWSX 3OKIA 1MVCA 4XAOA 3DY6A 2ZFXA 1NDEA 1Z5XU 3HM1A 3OOKA 4OFUA 3WTQA 4APUA 5IXKA 2VV3A 2ABIA 4R06A 2P7AA 3DR1A 3X36A 4DMAA 3UP0A 3FS1A 4G1ZA 2Z4BA 4OJ4A 4RUPA 4OJBA 4G1DA 4WHGA 1G1UA 5A86A 2Q8SA 3VHVA 3UU7A 5DI7A 5KRHA 5KYJA 4K6IA 3PBAA 5KCFA 3E00A 1ZDTA 2H79A 1G2NA 1K7LA 1YOWA 2R40A 3L0LA 4REEA 1M7WA 1ZH7A 3ERTA 4MG8B 4UDAA 4ZO1X 5DKBA 3WWRA 2P1UA 5ETHA 1K74A 2AA2A 2ZMJA 1NUOA 1XDKA 5C4TA 3KYTA 1PQ9A 2B1ZA 2AX8A 1K4WA 5JY3A 4IVYA 2I4PA 5ICKA 4X1GA 3SP9A 2HB7A 3W0GA 2QGWA 2OZ7A 3AZ3A 4ZNTA 2P1VA 2PRGA 2B1VA 1YA3A 2ZL9A 5AK2A 2Q59A 5KCEA 1TFCA 1X7BA 3KMGA 5DUEA 3RLJA 1FD0A 2P7ZA 3IXPA 4S0SA 1YP0A 4MDDA 5DXQA 2JFAB 3ADWA 4MGAB 1T7RA 2ZY0A 3B5RA 3Q95A 4MG6A 2VSRA 4IWFA 5DZ1A 4R2UA 1KKQA 3L3XA 3W0IA 4MG9A 1U3SA 1I37A 3OS8A 5E0WA 5APKA 4ZOMA 4Q50A 5DRJA 1E3GA 2IOKA 1XP9A 2QXMA 2J7XA 1KV6A 3B1MA 1PCGA 3IPQA 4FGYA 4DQMA 5HYRA 2QZOB 4ITEA 3L1BA 3OMPA 5APJA 5AZVA 4FN9A 1T73A 2QR9A 4Q0AC 1OVLA 4EMAA 4OEZA 3R8DA 4XHDA 1X7EA 3L3ZA 4E4KA 2B50A 4IWCA 4MGCA 5ACCA 2ZASA 3VHWA 3DT3A 3IA6A 4IU7A 5DZIA 3WT7A 4J24A 5DXPA 1T76A 1YMTA 4XT9A 4N8RA 5DWGA 4QE6A 2Q1HA 3DZYA 2J14A 4WVDA 2ACLA 1FCXA 5GT4A 3E00D 5AAUA 1XB7A 4POHA 5I4VA 3KFCA 3MNPA 2F4BA 2R40D 4PLDA 4RZGA 2AB2A 4QL8A 3UUCA 1PRGA 3E94A 1HJ1A 2NV7A 2ZLCA 4K4JA 4RFWA 2PJLA 3P88A 4IA2A 1XP1A 3FC6A 4J5WA 2XKWA 4S15A 3B68A 2I0JA 3CQVA 5AVLA 2O9IA 4S14A 1X76A 4ZN7A 3A2HA 1MZNA 1ZDUA 3KMZA 4RZFA 3WT6A 4IW8A 5AAVB 1WM0X 2AX6A 5GICA 3ADXA 3X31A 5KCWA 4L98A 5G46A 1S9PA 2ZVTA 5DRMA 1ZEOA 3CS4A 1T7FA 2PIRA 3L0JA 1S0ZA 3U9QA 4KZMA 3TKCA 5EITA 3KBAA 4WQPA 4A4WA 2E2RA 2QABA 4OARA 1RJKA 4UDBA 1QKNA 3T03A 5C4UA 4YT1A 2BJ4A 5DIGA 3B0RA 2GPUA 3V9VA 1T5ZA 4LTWA 5E7VA 3BQDA 1R5KA 2GPPA 3B65A 3F5CB 3KDTA 5DXBB 5HJSA 4CI4A 3VTCA 5DKEA 3R8AA 2W8YA 3FALB 3KDUA 4ZNHA 5KYAA 2HAMA 3NSQA 5DVCA 4PXMA 3OMMA 5HJPB 2ZK6A 4ONIA 2IHQA 3O1DA 4NQAB 3JZBA 2ZK5A 3GYTA 1FBYA 5IAWA 2V0VA 1ILGA 5JJMB 5G42A 5AYGA 1X7RA 2AYRA 1A52A 3A2IA 3A9EA 5HZCA 4JYGA 1Z5XE 1GWQA 3W0AA 3RUTA 4LNWA 4R6SA 1NQ2A 2XYXA 5KCCA 1XJ7A 4DOSA 2HFPA 3LBDA 2VSTA 2G44A 5KRIA 3FEJA 3NSPA 1I38A 1T65A 4PPSA 5EC9A 1RDTD 2GP7A 3HODA 5KR9A 2PITA 1ZKYA 3G9EA 4RMCA 3VT3A 4G2IA 2ZKCA 1T7MA 4IS8A 5IZ0A 2H77A 3WJ4A 1N46A 5DMCA 1EXAA 4E2JA 1OT7A 2YHDA 5FQSA 3ZQTA 3CS8A 2QZOA 1NRLA 2VV2A 3D24A 4HEEX 1XVPA 4RE8A 1T7TA 1T63A 1XLSA 2ZK3A 4FNEA 3OS8C 2GPVA 3OSIA 4TV1B 3GD2A 2AX9A 2HVCA 4OKTA 1SQNA 2GIUA 3RLLA 3RUUA 2Z4JA 2P7GA 4OGHA 1RKGA 1XV9A 4OIVA 3VT5A 3S9SA 4ZN9A 4XTAA 3VRTA 2QW4A 3UUAB 3PRGA 3DZUA 3OS9A 4B7WA 4O8FA 5DZHA 1UPWA 1GWXA 5G45A 5DV3A 4YMQA 5DMFA 3OAPA 1PK5A 4MG7B 2FSZA 1QKMA 2BAWA 3W5RA 1ZAFA 1UHLB 2VV0A 5DIDA 3P0UA 2Q60A 3R5NA 3VT7A 2ZNQA 2QXSA 1Y9RA 4OKWA 3PEQA 4TUZA 2GPOA 4MGBA 1ERRA 1XAPA 4PWLA 2ZNOA 3ADUA 4PRGA 3UVVB 3CS6A 2AMBA 2QA8B 4K7AA 4PLEA 5LGAA 4XUMA 1X7JA 2PIWA 2Q5PA 3B3KA 3G0WA 2AA7A 3PO9A 1S0XA 1M2ZA 2PIXA 1PZLA 2ZK2A 3VI8A 4JAZA 5AWJA 3UUDA 2VV1A 2NPAA 2ZNPA 4F9MA 2HCDA 4G20A 1U3RA 5E19A 3HO0A 4MGDA 5KRAA 1NHZA 2VV4A 3E7CA 5DYDA 3ZRBA 1P8DA 3OOFA 1KNUA 4G1YA 2LBDA 3OLLA 4PP5A 2AM9A 5DUHA 4LNXA 4IA1A 2YLYA 1GWRA 5DL4A 3VHUA 4OLMA 2GTKA 2QMVA 2OAXA 3OGTA 2YJDA 1IE9A 3CTBA 3NOAA 2QNVA 2PINA 4ZJWA 3DZUD 5DLRA 1S19A 3VN2A 5DIEA 1FCZA 3WMHA 2Q6JA 4DM8A 3F7DA 3VTBA 1A28A 3K8SA 2FAIA 5HYKA 3W0JA 3H0AD 2R6YA 4NY9A 2QH6A 5K13A 5KCUA 3VT4A 1RDTA 4FHHA 1ILHA 1XNXA 5E15A 2GL8A 3OZJA 1FM6D 2Q7IA 3UU7B 3AURA 2I0GA 4KZJA 1IE8A 3G8IA 4MGBB 4S0TA 2V7CA 4IA7A 1XQ3A 4RWVA 2YATA 3CWDA 2Q61A 1YJEA 3CDSA 1XNNA 1XDKB 2OCFA 3BEJA 5DX3A 2B23A 3AN3A 3X1HA 5KCTA 4M8EA 2Q5GA 1XLSE 4PVUA 5DZ3A 3IPSA 4UDDA 1NQ0A 5M96A 2POGA 3WFGA 4HLWA 1G50A 2IOGA 2NXXE 4Q13A 2Q59B 3ADVA 1M13A 4N73A 3VRWA 3JZCA 3WGPA 2P54A 1G5YA 2ATHA 3OMOA 3SZ1A 2O4RA 2Q7KA 3CDPA 5G43A 3W0HA 2Q7LA 5EI1A 4A4VA 4E4QA 4RMDA 4YPQA 5KCDA 3Q95B 2AX7A 4PP3A 3W5TA 1VJBA 4IVWA 2HC4A 3B0QA 4XUHA 3ADSA 4MG8A 4MG9B 2ZK1A 4MG7A 5E14A 1YOKA 1SR7A 2AMAA 3ET2A 2HWQA 4REFA 2YJAB 1UPVA 2R6WA 1UHLA 3IMYA 4NB6A 4QE8A 2XYWA 2Q3YA 3TY0A 5DZ0A 3HZFA 1XPCA 4ZNWA 4NUFA 1DKFB 1OVLB 3HC6A 3OSWA 2PKLA 4POJA 2YLPA 3AZ2A 4M8HA 4A2JA 1N83A 3A40X 2POBA 4OEDA 5FQVA 3UP3A 3V9YA 3AFRA 1PQ6A 2AWHA 4N1YA 2P4YA 3DCUA 3KMRA 5DV8A 2JFAA 4J5XA 4MGAA 2QPYA 2I4ZA 3B0TA 2A3IA 3BC5A 4OIUA 5DTVA 5GIDA 3PLZA 5FQPA 5H1EA 3A2JA 3HLVA 4OC7A 3R29A 2QSEA 5KRFA 3AX8A 3ET3A 4RUOX 1U3QA 1YYEA 2ACLB 4YNKA 5DSHA 3R2AA 2XYJA 4OEYA 2ZLAA 3VSOA 5KRJA 2YFEA 5APHA 3VJSA 5KD9A 1EXXA 5DWJA 1R1KA 3CJWA 4OZRU 3ILZA 4QK4A 5DVSA 1NAVA 4LSJA 4WLBA 4ZNSA 5GIEA 3FC6B 3GYUA 5DUGA 2NXXA 2YLOA 1SKXA 4IV2A 1XIUA 3TX7B 3VRVA 3V49A 1XZXX 4ITFA 1LV2A 3OZ0A 3B0WA 4Y29A 3DCTA 5E1CA 3CLDA 2JF9A 4OJ9A 3A78A 3OLSA 3VJHA 3HVLA 4FHIA 1S9QA 4PP6A 3H0AA 5DP0A 5KRMA 2Q6SA 3ADTA 4UDCA 3HQ5A 4LBDA 4ZJRA 1FM6A 3ET0A 4MG5A 3D6DA 4OK1A 2Q7JA 2QE4A 3MNOA 1ZUCA 2BJ4B 3N00A 1Y0SA 4ZNUA 4DK8A 2ZXMA 1R20D 5AAVA 5G44A 1TXIA 5DVVA 3AUQA 4J5WC 4RZEA 1U9EA 2Q1VA 4ZNVA 3V4AA 2QGTA 3FLIA 3W5PA 2Q6RA 1EREA 1T79A 5B41A 1NQ1A 5F9BA 5AVIA 3W0CA 1E3KA 4P6WA 5LWPA 4G2HA 3K6PA 2Q70A 5HCVA 3ZRAA 1YIMA 3HC5A 1X78A 3WT5A 5EHJA 3VSPA 3A9EB 4G21A 4XI3A 2OUZA 5DXRA 2EWPA 3VRUA 2FVJA 4IV4A 5DXKA 1R1KD 4JGVA 1DB1A 4J26A 4RUJA 2PIOA 4ZO1B 2PIUA 1FM9D 1RKHA 3F5CA 4OKXA 4QM0A 5DXBA 3OSAA 2PNUA 5G5WA 3FXVA 3FALA 5L7HA 4OKBA 1P93A 3V9TA 2G0GA 5DWEA 2NW4A 3K23A 5L7GA 5HJPA 3ERDA 1H9UA 4N5GA 3GZ9A 3FEIA 2OVHA 5AZTA 1XVPB 2ZXZA 2I4JA 5JJMA 3VTDA 5B5BA 3EYBA 3WJ5A 1DKFA 2AXAA 3VT8A 1LBDA 1XV9B 1XOWA 4EM9A 2AA5A 5SYZA 5JI0D 4RAKA 4PF3A 3D5FA 4P6XA 1OSHA 3GN8A 3LMPA 4BCRA 5DWLA 1GS4A 4IW6A 1UOMA 3ZR7A 5EGVA 3GWXA 4OFRA 4IA3A 4OH6A 5AWKA 5KRKA 2ZNNA 5FQRA 3AUNA 3H52A 1NAXA 2ZK4A 2HBHA 4J5XC 4WPFA 3FUGA 4OZTE 3W5QA 3VJTA 3D57A 2HWRA 1YINA 4OEAA 1K74D 2J7YA 3L0EA 4TV1A 3QT0A 1L2JA 1QKTA 4JL4A 4TUZB 5DYBA 5DXEA 1SJ0A 4DORA 3P89A 2J4AA
chains in the Genus database with same CATH superfamily
5KRCA 2PIPL 4QJRA 1XQCA 2QA6A 5L11A 1I7GA 1Q4XA 3B67A 3GBKA 5FQTA 1I7IA 2ZBSA 1HG4A 3AZ1A 4JYIA 3UUAA 3VT9A 1BSXA 5C4OA 1MV9A 1YUCA 5DV6A 4PPPA 3FURA 3M7RA 4OZTU 5DWIA 5DKGA 2P15A 3IXPD 3P8XA 3RY9A 3VT6A 3ET1A 2QTUA 1NYXA 1N4HA 1Y0XX 2REWA 3B66A 3IPUA 3K22A 3L03A 3UUDB 4DK7A 3O1EA 5EJVA 1T74A 4IUIA 2VV1B 4RMEA 3OLFA 5DXMA 5CJ6A 2XHSA 3D90A 3KPZA 1R20A 4JYHA 4MGDB 1RK3A 2VV4B 2O4JA 3OMQA 1PDUA 5DKSA 3SP6A 4OZRE 4XLDA 2GWXA 4OILA 3V3QA 3OKHA 2G0HA 4ZI1A 4L96A 3V3EA 3UVVA 4NIEA 2QA8A 2YLQA 5DU5A 4CSJA 5E0XA 3VJIA 3WFFA 1OSVA 4WHFA 2AO6A 2P1TA 5DK9A 5KRLA 1L2IA 2ZK0A 5DY8A 3AN4A 2JJ3A 5G3JA 4OH5A 1FCYA 2OM9A 2AAXA 4X1FA 3OMKA 3R5MA 2ZXNA 3G8OA 3DZYD 2HB8A 4OHAA 3A3ZX 1PQCA 1FM9A 2ZMHA 3PCUA 4KZIA 5KROA 1ZGYA 2Q5SA 2ZMIA 4IQRA 2HASA 5DXGA 2AA6A 5L7EA 1YY4A 1QKUA 1XP6A 3MNEA 3KWYA 4DM6A 3TKMA 2PIVA 3R8IA 5C4SA 3X1IA 1Z95A 2PIQA 3RVFA 1R6GA 4CI5A 1NQ7A 2G5OA 5DX3B 2HARA 2OVMA 3W0YA 3GWSX 3OKIA 1MVCA 4XAOA 3DY6A 2ZFXA 1NDEA 1Z5XU 3HM1A 3OOKA 4OFUA 3WTQA 4APUA 5IXKA 2VV3A 2ABIA 4R06A 2P7AA 3DR1A 3X36A 4DMAA 3UP0A 3FS1A 4G1ZA 2Z4BA 4OJ4A 4RUPA 4OJBA 4G1DA 4WHGA 1G1UA 5A86A 2Q8SA 3VHVA 3UU7A 5DI7A 5KRHA 5KYJA 4K6IA 3PBAA 5KCFA 3E00A 1ZDTA 2H79A 1G2NA 1K7LA 1YOWA 2R40A 3L0LA 4REEA 1M7WA 1ZH7A 3ERTA 4MG8B 4UDAA 4ZO1X 5DKBA 3WWRA 2P1UA 5ETHA 1K74A 2AA2A 2ZMJA 1NUOA 1XDKA 5C4TA 3KYTA 1PQ9A 2B1ZA 2AX8A 1K4WA 5JY3A 4IVYA 2I4PA 5ICKA 4X1GA 3SP9A 2HB7A 3W0GA 2QGWA 2OZ7A 3AZ3A 4ZNTA 2P1VA 2PRGA 2B1VA 1YA3A 2ZL9A 5AK2A 2Q59A 5KCEA 1TFCA 1X7BA 3KMGA 5DUEA 3RLJA 1FD0A 2P7ZA 3IXPA 4S0SA 1YP0A 4MDDA 5DXQA 2JFAB 3ADWA 4MGAB 1T7RA 2ZY0A 3B5RA 3Q95A 4MG6A 2VSRA 4IWFA 5DZ1A 4R2UA 1KKQA 3L3XA 3W0IA 4MG9A 1U3SA 1I37A 3OS8A 5E0WA 5APKA 4ZOMA 4Q50A 5DRJA 1E3GA 2IOKA 1XP9A 2QXMA 2J7XA 1KV6A 3B1MA 1PCGA 3IPQA 4FGYA 4DQMA 5HYRA 2QZOB 4ITEA 3L1BA 3OMPA 5APJA 5AZVA 4FN9A 1T73A 2QR9A 4Q0AC 1OVLA 4EMAA 4OEZA 3R8DA 4XHDA 1X7EA 3L3ZA 4E4KA 2B50A 4IWCA 4MGCA 5ACCA 2ZASA 3VHWA 3DT3A 3IA6A 4IU7A 5DZIA 3WT7A 4J24A 5DXPA 1T76A 1YMTA 4XT9A 4N8RA 5DWGA 4QE6A 2Q1HA 3DZYA 2J14A 4WVDA 2ACLA 1FCXA 5GT4A 3E00D 5AAUA 1XB7A 4POHA 5I4VA 3KFCA 3MNPA 2F4BA 2R40D 4PLDA 4RZGA 2AB2A 4QL8A 3UUCA 1PRGA 3E94A 1HJ1A 2NV7A 2ZLCA 4K4JA 4RFWA 2PJLA 3P88A 4IA2A 1XP1A 3FC6A 4J5WA 2XKWA 4S15A 3B68A 2I0JA 3CQVA 5AVLA 2O9IA 4S14A 1X76A 4ZN7A 3A2HA 1MZNA 1ZDUA 3KMZA 4RZFA 3WT6A 4IW8A 5AAVB 1WM0X 2AX6A 5GICA 3ADXA 3X31A 5KCWA 4L98A 5G46A 1S9PA 2ZVTA 5DRMA 1ZEOA 3CS4A 1T7FA 2PIRA 3L0JA 1S0ZA 3U9QA 4KZMA 3TKCA 5EITA 3KBAA 4WQPA 4A4WA 2E2RA 2QABA 4OARA 1RJKA 4UDBA 1QKNA 3T03A 5C4UA 4YT1A 2BJ4A 5DIGA 3B0RA 2GPUA 3V9VA 1T5ZA 4LTWA 5E7VA 3BQDA 1R5KA 2GPPA 3B65A 3F5CB 3KDTA 5DXBB 5HJSA 4CI4A 3VTCA 5DKEA 3R8AA 2W8YA 3FALB 3KDUA 4ZNHA 5KYAA 2HAMA 3NSQA 5DVCA 4PXMA 3OMMA 5HJPB 2ZK6A 4ONIA 2IHQA 3O1DA 4NQAB 3JZBA 2ZK5A 3GYTA 1FBYA 5IAWA 2V0VA 1ILGA 5JJMB 5G42A 5AYGA 1X7RA 2AYRA 1A52A 3A2IA 3A9EA 5HZCA 4JYGA 1Z5XE 1GWQA 3W0AA 3RUTA 4LNWA 4R6SA 1NQ2A 2XYXA 5KCCA 1XJ7A 4DOSA 2HFPA 3LBDA 2VSTA 2G44A 5KRIA 3FEJA 3NSPA 1I38A 1T65A 4PPSA 5EC9A 1RDTD 2GP7A 3HODA 5KR9A 2PITA 1ZKYA 3G9EA 4RMCA 3VT3A 4G2IA 2ZKCA 1T7MA 4IS8A 5IZ0A 2H77A 3WJ4A 1N46A 5DMCA 1EXAA 4E2JA 1OT7A 2YHDA 5FQSA 3ZQTA 3CS8A 2QZOA 1NRLA 2VV2A 3D24A 4HEEX 1XVPA 4RE8A 1T7TA 1T63A 1XLSA 2ZK3A 4FNEA 3OS8C 2GPVA 3OSIA 4TV1B 3GD2A 2AX9A 2HVCA 4OKTA 1SQNA 2GIUA 3RLLA 3RUUA 2Z4JA 2P7GA 4OGHA 1RKGA 1XV9A 4OIVA 3VT5A 3S9SA 4ZN9A 4XTAA 3VRTA 2QW4A 3UUAB 3PRGA 3DZUA 3OS9A 4B7WA 4O8FA 5DZHA 1UPWA 1GWXA 5G45A 5DV3A 4YMQA 5DMFA 3OAPA 1PK5A 4MG7B 2FSZA 1QKMA 2BAWA 3W5RA 1ZAFA 1UHLB 2VV0A 5DIDA 3P0UA 2Q60A 3R5NA 3VT7A 2ZNQA 2QXSA 1Y9RA 4OKWA 3PEQA 4TUZA 2GPOA 4MGBA 1ERRA 1XAPA 4PWLA 2ZNOA 3ADUA 4PRGA 3UVVB 3CS6A 2AMBA 2QA8B 4K7AA 4PLEA 5LGAA 4XUMA 1X7JA 2PIWA 2Q5PA 3B3KA 3G0WA 2AA7A 3PO9A 1S0XA 1M2ZA 2PIXA 1PZLA 2ZK2A 3VI8A 4JAZA 5AWJA 3UUDA 2VV1A 2NPAA 2ZNPA 4F9MA 2HCDA 4G20A 1U3RA 5E19A 3HO0A 4MGDA 5KRAA 1NHZA 2VV4A 3E7CA 5DYDA 3ZRBA 1P8DA 3OOFA 1KNUA 4G1YA 2LBDA 3OLLA 4PP5A 2AM9A 5DUHA 4LNXA 4IA1A 2YLYA 1GWRA 5DL4A 3VHUA 4OLMA 2GTKA 2QMVA 2OAXA 3OGTA 2YJDA 1IE9A 3CTBA 3NOAA 2QNVA 2PINA 4ZJWA 3DZUD 5DLRA 1S19A 3VN2A 5DIEA 1FCZA 3WMHA 2Q6JA 4DM8A 3F7DA 3VTBA 1A28A 3K8SA 2FAIA 5HYKA 3W0JA 3H0AD 2R6YA 4NY9A 2QH6A 5K13A 5KCUA 3VT4A 1RDTA 4FHHA 1ILHA 1XNXA 5E15A 2GL8A 3OZJA 1FM6D 2Q7IA 3UU7B 3AURA 2I0GA 4KZJA 1IE8A 3G8IA 4MGBB 4S0TA 2V7CA 4IA7A 1XQ3A 4RWVA 2YATA 3CWDA 2Q61A 1YJEA 3CDSA 1XNNA 1XDKB 2OCFA 3BEJA 5DX3A 2B23A 3AN3A 3X1HA 5KCTA 4M8EA 2Q5GA 1XLSE 4PVUA 5DZ3A 3IPSA 4UDDA 1NQ0A 5M96A 2POGA 3WFGA 4HLWA 1G50A 2IOGA 2NXXE 4Q13A 2Q59B 3ADVA 1M13A 4N73A 3VRWA 3JZCA 3WGPA 2P54A 1G5YA 2ATHA 3OMOA 3SZ1A 2O4RA 2Q7KA 3CDPA 5G43A 3W0HA 2Q7LA 5EI1A 4A4VA 4E4QA 4RMDA 4YPQA 5KCDA 3Q95B 2AX7A 4PP3A 3W5TA 1VJBA 4IVWA 2HC4A 3B0QA 4XUHA 3ADSA 4MG8A 4MG9B 2ZK1A 4MG7A 5E14A 1YOKA 1SR7A 2AMAA 3ET2A 2HWQA 4REFA 2YJAB 1UPVA 2R6WA 1UHLA 3IMYA 4NB6A 4QE8A 2XYWA 2Q3YA 3TY0A 5DZ0A 3HZFA 1XPCA 4ZNWA 4NUFA 1DKFB 1OVLB 3HC6A 3OSWA 2PKLA 4POJA 2YLPA 3AZ2A 4M8HA 4A2JA 1N83A 3A40X 2POBA 4OEDA 5FQVA 3UP3A 3V9YA 3AFRA 1PQ6A 2AWHA 4N1YA 2P4YA 3DCUA 3KMRA 5DV8A 2JFAA 4J5XA 4MGAA 2QPYA 2I4ZA 3B0TA 2A3IA 3BC5A 4OIUA 5DTVA 5GIDA 3PLZA 5FQPA 5H1EA 3A2JA 3HLVA 4OC7A 3R29A 2QSEA 5KRFA 3AX8A 3ET3A 4RUOX 1U3QA 1YYEA 2ACLB 4YNKA 5DSHA 3R2AA 2XYJA 4OEYA 2ZLAA 3VSOA 5KRJA 2YFEA 5APHA 3VJSA 5KD9A 1EXXA 5DWJA 1R1KA 3CJWA 4OZRU 3ILZA 4QK4A 5DVSA 1NAVA 4LSJA 4WLBA 4ZNSA 5GIEA 3FC6B 3GYUA 5DUGA 2NXXA 2YLOA 1SKXA 4IV2A 1XIUA 3TX7B 3VRVA 3V49A 1XZXX 4ITFA 1LV2A 3OZ0A 3B0WA 4Y29A 3DCTA 5E1CA 3CLDA 2JF9A 4OJ9A 3A78A 3OLSA 3VJHA 3HVLA 4FHIA 1S9QA 4PP6A 3H0AA 5DP0A 5KRMA 2Q6SA 3ADTA 4UDCA 3HQ5A 4LBDA 4ZJRA 1FM6A 3ET0A 4MG5A 3D6DA 4OK1A 2Q7JA 2QE4A 3MNOA 1ZUCA 2BJ4B 3N00A 1Y0SA 4ZNUA 4DK8A 2ZXMA 1R20D 5AAVA 5G44A 1TXIA 5DVVA 3AUQA 4J5WC 4RZEA 1U9EA 2Q1VA 4ZNVA 3V4AA 2QGTA 3FLIA 3W5PA 2Q6RA 1EREA 1T79A 5B41A 1NQ1A 5F9BA 5AVIA 3W0CA 1E3KA 4P6WA 5LWPA 4G2HA 3K6PA 2Q70A 5HCVA 3ZRAA 1YIMA 3HC5A 1X78A 3WT5A 5EHJA 3VSPA 3A9EB 4G21A 4XI3A 2OUZA 5DXRA 2EWPA 3VRUA 2FVJA 4IV4A 5DXKA 1R1KD 4JGVA 1DB1A 4J26A 4RUJA 2PIOA 4ZO1B 2PIUA 1FM9D 1RKHA 3F5CA 4OKXA 4QM0A 5DXBA 3OSAA 2PNUA 5G5WA 3FXVA 3FALA 5L7HA 4OKBA 1P93A 3V9TA 2G0GA 5DWEA 2NW4A 3K23A 5L7GA 5HJPA 3ERDA 1H9UA 4N5GA 3GZ9A 3FEIA 2OVHA 5AZTA 1XVPB 2ZXZA 2I4JA 5JJMA 3VTDA 5B5BA 3EYBA 3WJ5A 1DKFA 2AXAA 3VT8A 1LBDA 1XV9B 1XOWA 4EM9A 2AA5A 5SYZA 5JI0D 4RAKA 4PF3A 3D5FA 4P6XA 1OSHA 3GN8A 3LMPA 4BCRA 5DWLA 1GS4A 4IW6A 1UOMA 3ZR7A 5EGVA 3GWXA 4OFRA 4IA3A 4OH6A 5AWKA 5KRKA 2ZNNA 5FQRA 3AUNA 3H52A 1NAXA 2ZK4A 2HBHA 4J5XC 4WPFA 3FUGA 4OZTE 3W5QA 3VJTA 3D57A 2HWRA 1YINA 4OEAA 1K74D 2J7YA 3L0EA 4TV1A 3QT0A 1L2JA 1QKTA 4JL4A 4TUZB 5DYBA 5DXEA 1SJ0A 4DORA 3P89A 2J4AA
chains in the Genus database with same CATH topology
5KRCA 2PIPL 4QJRA 1XQCA 2QA6A 5L11A 1I7GA 1Q4XA 3B67A 3GBKA 5FQTA 1I7IA 2ZBSA 1HG4A 3AZ1A 4JYIA 3UUAA 3VT9A 1BSXA 5C4OA 1MV9A 1YUCA 5DV6A 4PPPA 3FURA 3M7RA 4OZTU 5DWIA 5DKGA 2P15A 3IXPD 3P8XA 3RY9A 3VT6A 3ET1A 2QTUA 1NYXA 1N4HA 1Y0XX 2REWA 3B66A 3IPUA 3K22A 3L03A 3UUDB 4DK7A 3O1EA 5EJVA 1T74A 4IUIA 2VV1B 4RMEA 3OLFA 5DXMA 5CJ6A 2XHSA 3D90A 3KPZA 1R20A 4JYHA 4MGDB 1RK3A 2VV4B 2O4JA 3OMQA 1PDUA 5DKSA 3SP6A 4OZRE 4XLDA 2GWXA 4OILA 3V3QA 3OKHA 2G0HA 4ZI1A 4L96A 3V3EA 3UVVA 4NIEA 2QA8A 2YLQA 5DU5A 4CSJA 5E0XA 3VJIA 3WFFA 1OSVA 4WHFA 2AO6A 2P1TA 5DK9A 5KRLA 1L2IA 2ZK0A 5DY8A 3AN4A 2JJ3A 5G3JA 4OH5A 1FCYA 2OM9A 2AAXA 4X1FA 3OMKA 3R5MA 2ZXNA 3G8OA 3DZYD 2HB8A 4OHAA 3A3ZX 1PQCA 1FM9A 2ZMHA 3PCUA 4KZIA 5KROA 1ZGYA 2Q5SA 2ZMIA 4IQRA 2HASA 5DXGA 2AA6A 5L7EA 1YY4A 1QKUA 1XP6A 3MNEA 3KWYA 4DM6A 3TKMA 2PIVA 3R8IA 5C4SA 3X1IA 1Z95A 2PIQA 3RVFA 1R6GA 4CI5A 1NQ7A 2G5OA 5DX3B 2HARA 2OVMA 3W0YA 3GWSX 3OKIA 1MVCA 4XAOA 3DY6A 2ZFXA 1NDEA 1Z5XU 3HM1A 3OOKA 4OFUA 3WTQA 4APUA 5IXKA 2VV3A 2ABIA 4R06A 2P7AA 3DR1A 3X36A 4DMAA 3UP0A 3FS1A 4G1ZA 2Z4BA 4OJ4A 4RUPA 4OJBA 4G1DA 4WHGA 1G1UA 5A86A 2Q8SA 3VHVA 3UU7A 5DI7A 5KRHA 5KYJA 4K6IA 3PBAA 5KCFA 3E00A 1ZDTA 2H79A 1G2NA 1K7LA 1YOWA 2R40A 3L0LA 4REEA 1M7WA 1ZH7A 3ERTA 4MG8B 4UDAA 4ZO1X 5DKBA 3WWRA 2P1UA 5ETHA 1K74A 2AA2A 2ZMJA 1NUOA 1XDKA 5C4TA 3KYTA 1PQ9A 2B1ZA 2AX8A 1K4WA 5JY3A 4IVYA 2I4PA 5ICKA 4X1GA 3SP9A 2HB7A 3W0GA 2QGWA 2OZ7A 3AZ3A 4ZNTA 2P1VA 2PRGA 2B1VA 1YA3A 2ZL9A 5AK2A 2Q59A 5KCEA 1TFCA 1X7BA 3KMGA 5DUEA 3RLJA 1FD0A 2P7ZA 3IXPA 4S0SA 1YP0A 4MDDA 5DXQA 2JFAB 3ADWA 4MGAB 1T7RA 2ZY0A 3B5RA 3Q95A 4MG6A 2VSRA 4IWFA 5DZ1A 4R2UA 1KKQA 3L3XA 3W0IA 4MG9A 1U3SA 1I37A 3OS8A 5E0WA 5APKA 4ZOMA 4Q50A 5DRJA 1E3GA 2IOKA 1XP9A 2QXMA 2J7XA 1KV6A 3B1MA 1PCGA 3IPQA 4FGYA 4DQMA 5HYRA 2QZOB 4ITEA 3L1BA 3OMPA 5APJA 5AZVA 4FN9A 1T73A 2QR9A 4Q0AC 1OVLA 4EMAA 4OEZA 3R8DA 4XHDA 1X7EA 3L3ZA 4E4KA 2B50A 4IWCA 4MGCA 5ACCA 2ZASA 3VHWA 3DT3A 3IA6A 4IU7A 5DZIA 3WT7A 4J24A 5DXPA 1T76A 1YMTA 4XT9A 4N8RA 5DWGA 4QE6A 2Q1HA 3DZYA 2J14A 4WVDA 2ACLA 1FCXA 5GT4A 3E00D 5AAUA 1XB7A 4POHA 5I4VA 3KFCA 3MNPA 2F4BA 2R40D 4PLDA 4RZGA 2AB2A 4QL8A 3UUCA 1PRGA 3E94A 1HJ1A 2NV7A 2ZLCA 4K4JA 4RFWA 2PJLA 3P88A 4IA2A 1XP1A 3FC6A 4J5WA 2XKWA 4S15A 3B68A 2I0JA 3CQVA 5AVLA 2O9IA 4S14A 1X76A 4ZN7A 3A2HA 1MZNA 1ZDUA 3KMZA 4RZFA 3WT6A 4IW8A 5AAVB 1WM0X 2AX6A 5GICA 3ADXA 3X31A 5KCWA 4L98A 5G46A 1S9PA 2ZVTA 5DRMA 1ZEOA 3CS4A 1T7FA 2PIRA 3L0JA 1S0ZA 3U9QA 4KZMA 3TKCA 5EITA 3KBAA 4WQPA 4A4WA 2E2RA 2QABA 4OARA 1RJKA 4UDBA 1QKNA 3T03A 5C4UA 4YT1A 2BJ4A 5DIGA 3B0RA 2GPUA 3V9VA 1T5ZA 4LTWA 5E7VA 3BQDA 1R5KA 2GPPA 3B65A 3F5CB 3KDTA 5DXBB 5HJSA 4CI4A 3VTCA 5DKEA 3R8AA 2W8YA 3FALB 3KDUA 4ZNHA 5KYAA 2HAMA 3NSQA 5DVCA 4PXMA 3OMMA 5HJPB 2ZK6A 4ONIA 2IHQA 3O1DA 4NQAB 3JZBA 2ZK5A 3GYTA 1FBYA 5IAWA 2V0VA 1ILGA 5JJMB 5G42A 5AYGA 1X7RA 2AYRA 1A52A 3A2IA 3A9EA 5HZCA 4JYGA 1Z5XE 1GWQA 3W0AA 3RUTA 4LNWA 4R6SA 1NQ2A 2XYXA 5KCCA 1XJ7A 4DOSA 2HFPA 3LBDA 2VSTA 2G44A 5KRIA 3FEJA 3NSPA 1I38A 1T65A 4PPSA 5EC9A 1RDTD 2GP7A 3HODA 5KR9A 2PITA 1ZKYA 3G9EA 4RMCA 3VT3A 4G2IA 2ZKCA 1T7MA 4IS8A 5IZ0A 2H77A 3WJ4A 1N46A 5DMCA 1EXAA 4E2JA 1OT7A 2YHDA 5FQSA 3ZQTA 3CS8A 2QZOA 1NRLA 2VV2A 3D24A 4HEEX 1XVPA 4RE8A 1T7TA 1T63A 1XLSA 2ZK3A 4FNEA 3OS8C 2GPVA 3OSIA 4TV1B 3GD2A 2AX9A 2HVCA 4OKTA 1SQNA 2GIUA 3RLLA 3RUUA 2Z4JA 2P7GA 4OGHA 1RKGA 1XV9A 4OIVA 3VT5A 3S9SA 4ZN9A 4XTAA 3VRTA 2QW4A 3UUAB 3PRGA 3DZUA 3OS9A 4B7WA 4O8FA 5DZHA 1UPWA 1GWXA 5G45A 5DV3A 4YMQA 5DMFA 3OAPA 1PK5A 4MG7B 2FSZA 1QKMA 2BAWA 3W5RA 1ZAFA 1UHLB 2VV0A 5DIDA 3P0UA 2Q60A 3R5NA 3VT7A 2ZNQA 2QXSA 1Y9RA 4OKWA 3PEQA 4TUZA 2GPOA 4MGBA 1ERRA 1XAPA 4PWLA 2ZNOA 3ADUA 4PRGA 3UVVB 3CS6A 2AMBA 2QA8B 4K7AA 4PLEA 5LGAA 4XUMA 1X7JA 2PIWA 2Q5PA 3B3KA 3G0WA 2AA7A 3PO9A 1S0XA 1M2ZA 2PIXA 1PZLA 2ZK2A 3VI8A 4JAZA 5AWJA 3UUDA 2VV1A 2NPAA 2ZNPA 4F9MA 2HCDA 4G20A 1U3RA 5E19A 3HO0A 4MGDA 5KRAA 1NHZA 2VV4A 3E7CA 5DYDA 3ZRBA 1P8DA 3OOFA 1KNUA 4G1YA 2LBDA 3OLLA 4PP5A 2AM9A 5DUHA 4LNXA 4IA1A 2YLYA 1GWRA 5DL4A 3VHUA 4OLMA 2GTKA 2QMVA 2OAXA 3OGTA 2YJDA 1IE9A 3CTBA 3NOAA 2QNVA 2PINA 4ZJWA 3DZUD 5DLRA 1S19A 3VN2A 5DIEA 1FCZA 3WMHA 2Q6JA 4DM8A 3F7DA 3VTBA 1A28A 3K8SA 2FAIA 5HYKA 3W0JA 3H0AD 2R6YA 4NY9A 2QH6A 5K13A 5KCUA 3VT4A 1RDTA 4FHHA 1ILHA 1XNXA 5E15A 2GL8A 3OZJA 1FM6D 2Q7IA 3UU7B 3AURA 2I0GA 4KZJA 1IE8A 3G8IA 4MGBB 4S0TA 2V7CA 4IA7A 1XQ3A 4RWVA 2YATA 3CWDA 2Q61A 1YJEA 3CDSA 1XNNA 1XDKB 2OCFA 3BEJA 5DX3A 2B23A 3AN3A 3X1HA 5KCTA 4M8EA 2Q5GA 1XLSE 4PVUA 5DZ3A 3IPSA 4UDDA 1NQ0A 5M96A 2POGA 3WFGA 4HLWA 1G50A 2IOGA 2NXXE 4Q13A 2Q59B 3ADVA 1M13A 4N73A 3VRWA 3JZCA 3WGPA 2P54A 1G5YA 2ATHA 3OMOA 3SZ1A 2O4RA 2Q7KA 3CDPA 5G43A 3W0HA 2Q7LA 5EI1A 4A4VA 4E4QA 4RMDA 4YPQA 5KCDA 3Q95B 2AX7A 4PP3A 3W5TA 1VJBA 4IVWA 2HC4A 3B0QA 4XUHA 3ADSA 4MG8A 4MG9B 2ZK1A 4MG7A 5E14A 1YOKA 1SR7A 2AMAA 3ET2A 2HWQA 4REFA 2YJAB 1UPVA 2R6WA 1UHLA 3IMYA 4NB6A 4QE8A 2XYWA 2Q3YA 3TY0A 5DZ0A 3HZFA 1XPCA 4ZNWA 4NUFA 1DKFB 1OVLB 3HC6A 3OSWA 2PKLA 4POJA 2YLPA 3AZ2A 4M8HA 4A2JA 1N83A 3A40X 2POBA 4OEDA 5FQVA 3UP3A 3V9YA 3AFRA 1PQ6A 2AWHA 4N1YA 2P4YA 3DCUA 3KMRA 5DV8A 2JFAA 4J5XA 4MGAA 2QPYA 2I4ZA 3B0TA 2A3IA 3BC5A 4OIUA 5DTVA 5GIDA 3PLZA 5FQPA 5H1EA 3A2JA 3HLVA 4OC7A 3R29A 2QSEA 5KRFA 3AX8A 3ET3A 4RUOX 1U3QA 1YYEA 2ACLB 4YNKA 5DSHA 3R2AA 2XYJA 4OEYA 2ZLAA 3VSOA 5KRJA 2YFEA 5APHA 3VJSA 5KD9A 1EXXA 5DWJA 1R1KA 3CJWA 4OZRU 3ILZA 4QK4A 5DVSA 1NAVA 4LSJA 4WLBA 4ZNSA 5GIEA 3FC6B 3GYUA 5DUGA 2NXXA 2YLOA 1SKXA 4IV2A 1XIUA 3TX7B 3VRVA 3V49A 1XZXX 4ITFA 1LV2A 3OZ0A 3B0WA 4Y29A 3DCTA 5E1CA 3CLDA 2JF9A 4OJ9A 3A78A 3OLSA 3VJHA 3HVLA 4FHIA 1S9QA 4PP6A 3H0AA 5DP0A 5KRMA 2Q6SA 3ADTA 4UDCA 3HQ5A 4LBDA 4ZJRA 1FM6A 3ET0A 4MG5A 3D6DA 4OK1A 2Q7JA 2QE4A 3MNOA 1ZUCA 2BJ4B 3N00A 1Y0SA 4ZNUA 4DK8A 2ZXMA 1R20D 5AAVA 5G44A 1TXIA 5DVVA 3AUQA 4J5WC 4RZEA 1U9EA 2Q1VA 4ZNVA 3V4AA 2QGTA 3FLIA 3W5PA 2Q6RA 1EREA 1T79A 5B41A 1NQ1A 5F9BA 5AVIA 3W0CA 1E3KA 4P6WA 5LWPA 4G2HA 3K6PA 2Q70A 5HCVA 3ZRAA 1YIMA 3HC5A 1X78A 3WT5A 5EHJA 3VSPA 3A9EB 4G21A 4XI3A 2OUZA 5DXRA 2EWPA 3VRUA 2FVJA 4IV4A 5DXKA 1R1KD 4JGVA 1DB1A 4J26A 4RUJA 2PIOA 4ZO1B 2PIUA 1FM9D 1RKHA 3F5CA 4OKXA 4QM0A 5DXBA 3OSAA 2PNUA 5G5WA 3FXVA 3FALA 5L7HA 4OKBA 1P93A 3V9TA 2G0GA 5DWEA 2NW4A 3K23A 5L7GA 5HJPA 3ERDA 1H9UA 4N5GA 3GZ9A 3FEIA 2OVHA 5AZTA 1XVPB 2ZXZA 2I4JA 5JJMA 3VTDA 5B5BA 3EYBA 3WJ5A 1DKFA 2AXAA 3VT8A 1LBDA 1XV9B 1XOWA 4EM9A 2AA5A 5SYZA 5JI0D 4RAKA 4PF3A 3D5FA 4P6XA 1OSHA 3GN8A 3LMPA 4BCRA 5DWLA 1GS4A 4IW6A 1UOMA 3ZR7A 5EGVA 3GWXA 4OFRA 4IA3A 4OH6A 5AWKA 5KRKA 2ZNNA 5FQRA 3AUNA 3H52A 1NAXA 2ZK4A 2HBHA 4J5XC 4WPFA 3FUGA 4OZTE 3W5QA 3VJTA 3D57A 2HWRA 1YINA 4OEAA 1K74D 2J7YA 3L0EA 4TV1A 3QT0A 1L2JA 1QKTA 4JL4A 4TUZB 5DYBA 5DXEA 1SJ0A 4DORA 3P89A 2J4AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KRC A;  2PIP L;  4QJR A;  1XQC A;  2QA6 A;  5L11 A;  1I7G A;  1Q4X A;  3B67 A;  3GBK A;  5FQT A;  1I7I A;  2ZBS A;  1HG4 A;  3AZ1 A;  4JYI A;  3UUA A;  3VT9 A;  1BSX A;  5C4O A;  1MV9 A;  1YUC A;  5DV6 A;  4PPP A;  3FUR A;  3M7R A;  4OZT U;  5DWI A;  5DKG A;  2P15 A;  3IXP D;  3P8X A;  3RY9 A;  3VT6 A;  3ET1 A;  2QTU A;  1NYX A;  1N4H A;  1Y0X X;  2REW A;  3B66 A;  3IPU A;  3K22 A;  3L03 A;  3UUD B;  4DK7 A;  3O1E A;  5EJV A;  1T74 A;  4IUI A;  2VV1 B;  4RME A;  3OLF A;  5DXM A;  5CJ6 A;  2XHS A;  3D90 A;  3KPZ A;  1R20 A;  4JYH A;  4MGD B;  1RK3 A;  2VV4 B;  2O4J A;  3OMQ A;  1PDU A;  5DKS A;  3SP6 A;  4OZR E;  4XLD A;  2GWX A;  4OIL A;  3V3Q A;  3OKH A;  2G0H A;  4ZI1 A;  4L96 A;  3V3E A;  3UVV A;  4NIE A;  2QA8 A;  2YLQ A;  5DU5 A;  4CSJ A;  5E0X A;  3VJI A;  3WFF A;  1OSV A;  4WHF A;  2AO6 A;  2P1T A;  5DK9 A;  5KRL A;  1L2I A;  2ZK0 A;  5DY8 A;  3AN4 A;  2JJ3 A;  5G3J A;  4OH5 A;  1FCY A;  2OM9 A;  2AAX A;  4X1F A;  3OMK A;  3R5M A;  2ZXN A;  3G8O A;  3DZY D;  2HB8 A;  4OHA A;  3A3Z X;  1PQC A;  1FM9 A;  2ZMH A;  3PCU A;  4KZI A;  5KRO A;  1ZGY A;  2Q5S A;  2ZMI A;  4IQR A;  2HAS A;  5DXG A;  2AA6 A;  5L7E A;  1YY4 A;  1QKU A;  1XP6 A;  3MNE A;  3KWY A;  4DM6 A;  3TKM A;  2PIV A;  3R8I A;  5C4S A;  3X1I A;  1Z95 A;  2PIQ A;  3RVF A;  1R6G A;  4CI5 A;  1NQ7 A;  2G5O A;  5DX3 B;  2HAR A;  2OVM A;  3W0Y A;  3GWS X;  3OKI A;  1MVC A;  4XAO A;  3DY6 A;  2ZFX A;  1NDE A;  1Z5X U;  3HM1 A;  3OOK A;  4OFU A;  3WTQ A;  4APU A;  5IXK A;  2VV3 A;  2ABI A;  4R06 A;  2P7A A;  3DR1 A;  3X36 A;  4DMA A;  3UP0 A;  3FS1 A;  4G1Z A;  2Z4B A;  4OJ4 A;  4RUP A;  4OJB A;  4G1D A;  4WHG A;  1G1U A;  5A86 A;  2Q8S A;  3VHV A;  3UU7 A;  5DI7 A;  5KRH A;  5KYJ A;  4K6I A;  3PBA A;  5KCF A;  3E00 A;  1ZDT A;  2H79 A;  1G2N A;  1K7L A;  1YOW A;  2R40 A;  3L0L A;  4REE A;  1M7W A;  1ZH7 A;  3ERT A;  4MG8 B;  4UDA A;  4ZO1 X;  5DKB A;  3WWR A;  2P1U A;  5ETH A;  1K74 A;  2AA2 A;  2ZMJ A;  1NUO A;  1XDK A;  5C4T A;  3KYT A;  1PQ9 A;  2B1Z A;  2AX8 A;  1K4W A;  5JY3 A;  4IVY A;  2I4P A;  5ICK A;  4X1G A;  3SP9 A;  2HB7 A;  3W0G A;  2QGW A;  2OZ7 A;  3AZ3 A;  4ZNT A;  2P1V A;  2PRG A;  2B1V A;  1YA3 A;  2ZL9 A;  5AK2 A;  2Q59 A;  5KCE A;  1TFC A;  1X7B A;  3KMG A;  5DUE A;  3RLJ A;  1FD0 A;  2P7Z A;  3IXP A;  4S0S A;  1YP0 A;  4MDD A;  5DXQ A;  2JFA B;  3ADW A;  4MGA B;  1T7R A;  2ZY0 A;  3B5R A;  3Q95 A;  4MG6 A;  2VSR A;  4IWF A;  5DZ1 A;  4R2U A;  1KKQ A;  3L3X A;  3W0I A;  4MG9 A;  1U3S A;  1I37 A;  3OS8 A;  5E0W A;  5APK A;  4ZOM A;  4Q50 A;  5DRJ A;  1E3G A;  2IOK A;  1XP9 A;  2QXM A;  2J7X A;  1KV6 A;  3B1M A;  1PCG A;  3IPQ A;  4FGY A;  4DQM A;  5HYR A;  2QZO B;  4ITE A;  3L1B A;  3OMP A;  5APJ A;  5AZV A;  4FN9 A;  1T73 A;  2QR9 A;  4Q0A C;  1OVL A;  4EMA A;  4OEZ A;  3R8D A;  4XHD A;  1X7E A;  3L3Z A;  4E4K A;  2B50 A;  4IWC A;  4MGC A;  5ACC A;  2ZAS A;  3VHW A;  3DT3 A;  3IA6 A;  4IU7 A;  5DZI A;  3WT7 A;  4J24 A;  5DXP A;  1T76 A;  1YMT A;  4XT9 A;  4N8R A;  5DWG A;  4QE6 A;  2Q1H A;  3DZY A;  2J14 A;  4WVD A;  2ACL A;  1FCX A;  5GT4 A;  3E00 D;  5AAU A;  1XB7 A;  4POH A;  5I4V A;  3KFC A;  3MNP A;  2F4B A;  2R40 D;  4PLD A;  4RZG A;  2AB2 A;  4QL8 A;  3UUC A;  1PRG A;  3E94 A;  1HJ1 A;  2NV7 A;  2ZLC A;  4K4J A;  4RFW A;  2PJL A;  3P88 A;  4IA2 A;  1XP1 A;  3FC6 A;  4J5W A;  2XKW A;  4S15 A;  3B68 A;  2I0J A;  3CQV A;  5AVL A;  2O9I A;  4S14 A;  1X76 A;  4ZN7 A;  3A2H A;  1MZN A;  1ZDU A;  3KMZ A;  4RZF A;  3WT6 A;  4IW8 A;  5AAV B;  1WM0 X;  2AX6 A;  5GIC A;  3ADX A;  3X31 A;  5KCW A;  4L98 A;  5G46 A;  1S9P A;  2ZVT A;  5DRM A;  1ZEO A;  3CS4 A;  1T7F A;  2PIR A;  3L0J A;  1S0Z A;  3U9Q A;  4KZM A;  3TKC A;  5EIT A;  3KBA A;  4WQP A;  4A4W A;  2E2R A;  2QAB A;  4OAR A;  1RJK A;  4UDB A;  1QKN A;  3T03 A;  5C4U A;  4YT1 A;  2BJ4 A;  5DIG A;  3B0R A;  2GPU A;  3V9V A;  1T5Z A;  4LTW A;  5E7V A;  3BQD A;  1R5K A;  2GPP A;  3B65 A;  3F5C B;  3KDT A;  5DXB B;  5HJS A;  4CI4 A;  3VTC A;  5DKE A;  3R8A A;  2W8Y A;  3FAL B;  3KDU A;  4ZNH A;  5KYA A;  2HAM A;  3NSQ A;  5DVC A;  4PXM A;  3OMM A;  5HJP B;  2ZK6 A;  4ONI A;  2IHQ A;  3O1D A;  4NQA B;  3JZB A;  2ZK5 A;  3GYT A;  1FBY A;  5IAW A;  2V0V A;  1ILG A;  5JJM B;  5G42 A;  5AYG A;  1X7R A;  2AYR A;  1A52 A;  3A2I A;  3A9E A;  5HZC A;  4JYG A;  1Z5X E;  1GWQ A;  3W0A A;  3RUT A;  4LNW A;  4R6S A;  1NQ2 A;  2XYX A;  5KCC A;  1XJ7 A;  4DOS A;  2HFP A;  3LBD A;  2VST A;  2G44 A;  5KRI A;  3FEJ A;  3NSP A;  1I38 A;  1T65 A;  4PPS A;  5EC9 A;  1RDT D;  2GP7 A;  3HOD A;  5KR9 A;  2PIT A;  1ZKY A;  3G9E A;  4RMC A;  3VT3 A;  4G2I A;  2ZKC A;  1T7M A;  4IS8 A;  5IZ0 A;  2H77 A;  3WJ4 A;  1N46 A;  5DMC A;  1EXA A;  4E2J A;  1OT7 A;  2YHD A;  5FQS A;  3ZQT A;  3CS8 A;  2QZO A;  1NRL A;  2VV2 A;  3D24 A;  4HEE X;  1XVP A;  4RE8 A;  1T7T A;  1T63 A;  1XLS A;  2ZK3 A;  4FNE A;  3OS8 C;  2GPV A;  3OSI A;  4TV1 B;  3GD2 A;  2AX9 A;  2HVC A;  4OKT A;  1SQN A;  2GIU A;  3RLL A;  3RUU A;  2Z4J A;  2P7G A;  4OGH A;  1RKG A;  1XV9 A;  4OIV A;  3VT5 A;  3S9S A;  4ZN9 A;  4XTA A;  3VRT A;  2QW4 A;  3UUA B;  3PRG A;  3DZU A;  3OS9 A;  4B7W A;  4O8F A;  5DZH A;  1UPW A;  1GWX A;  5G45 A;  5DV3 A;  4YMQ A;  5DMF A;  3OAP A;  1PK5 A;  4MG7 B;  2FSZ A;  1QKM A;  2BAW A;  3W5R A;  1ZAF A;  1UHL B;  2VV0 A;  5DID A;  3P0U A;  2Q60 A;  3R5N A;  3VT7 A;  2ZNQ A;  2QXS A;  1Y9R A;  4OKW A;  3PEQ A;  4TUZ A;  2GPO A;  4MGB A;  1ERR A;  1XAP A;  4PWL A;  2ZNO A;  3ADU A;  4PRG A;  3UVV B;  3CS6 A;  2AMB A;  2QA8 B;  4K7A A;  4PLE A;  5LGA A;  4XUM A;  1X7J A;  2PIW A;  2Q5P A;  3B3K A;  3G0W A;  2AA7 A;  3PO9 A;  1S0X A;  1M2Z A;  2PIX A;  1PZL A;  2ZK2 A;  3VI8 A;  4JAZ A;  5AWJ A;  3UUD A;  2VV1 A;  2NPA A;  2ZNP A;  4F9M A;  2HCD A;  4G20 A;  1U3R A;  5E19 A;  3HO0 A;  4MGD A;  5KRA A;  1NHZ A;  2VV4 A;  3E7C A;  5DYD A;  3ZRB A;  1P8D A;  3OOF A;  1KNU A;  4G1Y A;  2LBD A;  3OLL A;  4PP5 A;  2AM9 A;  5DUH A;  4LNX A;  4IA1 A;  2YLY A;  1GWR A;  5DL4 A;  3VHU A;  4OLM A;  2GTK A;  2QMV A;  2OAX A;  3OGT A;  2YJD A;  1IE9 A;  3CTB A;  3NOA A;  2QNV A;  2PIN A;  4ZJW A;  3DZU D;  5DLR A;  1S19 A;  3VN2 A;  5DIE A;  1FCZ A;  3WMH A;  2Q6J A;  4DM8 A;  3F7D A;  3VTB A;  1A28 A;  3K8S A;  2FAI A;  5HYK A;  3W0J A;  3H0A D;  2R6Y A;  4NY9 A;  2QH6 A;  5K13 A;  5KCU A;  3VT4 A;  1RDT A;  4FHH A;  1ILH A;  1XNX A;  5E15 A;  2GL8 A;  3OZJ A;  1FM6 D;  2Q7I A;  3UU7 B;  3AUR A;  2I0G A;  4KZJ A;  1IE8 A;  3G8I A;  4MGB B;  4S0T A;  2V7C A;  4IA7 A;  1XQ3 A;  4RWV A;  2YAT A;  3CWD A;  2Q61 A;  1YJE A;  3CDS A;  1XNN A;  1XDK B;  2OCF A;  3BEJ A;  5DX3 A;  2B23 A;  3AN3 A;  3X1H A;  5KCT A;  4M8E A;  2Q5G A;  1XLS E;  4PVU A;  5DZ3 A;  3IPS A;  4UDD A;  1NQ0 A;  5M96 A;  2POG A;  3WFG A;  4HLW A;  1G50 A;  2IOG A;  2NXX E;  4Q13 A;  2Q59 B;  3ADV A;  1M13 A;  4N73 A;  3VRW A;  3JZC A;  3WGP A;  2P54 A;  1G5Y A;  2ATH A;  3OMO A;  3SZ1 A;  2O4R A;  2Q7K A;  3CDP A;  5G43 A;  3W0H A;  2Q7L A;  5EI1 A;  4A4V A;  4E4Q A;  4RMD A;  4YPQ A;  5KCD A;  3Q95 B;  2AX7 A;  4PP3 A;  3W5T A;  1VJB A;  4IVW A;  2HC4 A;  3B0Q A;  4XUH A;  3ADS A;  4MG8 A;  4MG9 B;  2ZK1 A;  4MG7 A;  5E14 A;  1YOK A;  1SR7 A;  2AMA A;  3ET2 A;  2HWQ A;  4REF A;  2YJA B;  1UPV A;  2R6W A;  1UHL A;  3IMY A;  4NB6 A;  4QE8 A;  2XYW A;  2Q3Y A;  3TY0 A;  5DZ0 A;  3HZF A;  1XPC A;  4ZNW A;  4NUF A;  1DKF B;  1OVL B;  3HC6 A;  3OSW A;  2PKL A;  4POJ A;  2YLP A;  3AZ2 A;  4M8H A;  4A2J A;  1N83 A;  3A40 X;  2POB A;  4OED A;  5FQV A;  3UP3 A;  3V9Y A;  3AFR A;  1PQ6 A;  2AWH A;  4N1Y A;  2P4Y A;  3DCU A;  3KMR A;  5DV8 A;  2JFA A;  4J5X A;  4MGA A;  2QPY A;  2I4Z A;  3B0T A;  2A3I A;  3BC5 A;  4OIU A;  5DTV A;  5GID A;  3PLZ A;  5FQP A;  5H1E A;  3A2J A;  3HLV A;  4OC7 A;  3R29 A;  2QSE A;  5KRF A;  3AX8 A;  3ET3 A;  4RUO X;  1U3Q A;  1YYE A;  2ACL B;  4YNK A;  5DSH A;  3R2A A;  2XYJ A;  4OEY A;  2ZLA A;  3VSO A;  5KRJ A;  2YFE A;  5APH A;  3VJS A;  5KD9 A;  1EXX A;  5DWJ A;  1R1K A;  3CJW A;  4OZR U;  3ILZ A;  4QK4 A;  5DVS A;  1NAV A;  4LSJ A;  4WLB A;  4ZNS A;  5GIE A;  3FC6 B;  3GYU A;  5DUG A;  2NXX A;  2YLO A;  1SKX A;  4IV2 A;  1XIU A;  3TX7 B;  3VRV A;  3V49 A;  1XZX X;  4ITF A;  1LV2 A;  3OZ0 A;  3B0W A;  4Y29 A;  3DCT A;  5E1C A;  3CLD A;  2JF9 A;  4OJ9 A;  3A78 A;  3OLS A;  3VJH A;  3HVL A;  4FHI A;  1S9Q A;  4PP6 A;  3H0A A;  5DP0 A;  5KRM A;  2Q6S A;  3ADT A;  4UDC A;  3HQ5 A;  4LBD A;  4ZJR A;  1FM6 A;  3ET0 A;  4MG5 A;  3D6D A;  4OK1 A;  2Q7J A;  2QE4 A;  3MNO A;  1ZUC A;  2BJ4 B;  3N00 A;  1Y0S A;  4ZNU A;  4DK8 A;  2ZXM A;  1R20 D;  5AAV A;  5G44 A;  1TXI A;  5DVV A;  3AUQ A;  4J5W C;  4RZE A;  1U9E A;  2Q1V A;  4ZNV A;  3V4A A;  2QGT A;  3FLI A;  3W5P A;  2Q6R A;  1ERE A;  1T79 A;  5B41 A;  1NQ1 A;  5F9B A;  5AVI A;  3W0C A;  1E3K A;  4P6W A;  5LWP A;  4G2H A;  3K6P A;  2Q70 A;  5HCV A;  3ZRA A;  1YIM A;  3HC5 A;  1X78 A;  3WT5 A;  5EHJ A;  3VSP A;  3A9E B;  4G21 A;  4XI3 A;  2OUZ A;  5DXR A;  2EWP A;  3VRU A;  2FVJ A;  4IV4 A;  5DXK A;  1R1K D;  4JGV A;  1DB1 A;  4J26 A;  4RUJ A;  2PIO A;  4ZO1 B;  2PIU A;  1FM9 D;  1RKH A;  3F5C A;  4OKX A;  4QM0 A;  5DXB A;  3OSA A;  2PNU A;  5G5W A;  3FXV A;  3FAL A;  5L7H A;  4OKB A;  1P93 A;  3V9T A;  2G0G A;  5DWE A;  2NW4 A;  3K23 A;  5L7G A;  5HJP A;  3ERD A;  1H9U A;  4N5G A;  3GZ9 A;  3FEI A;  2OVH A;  5AZT A;  1XVP B;  2ZXZ A;  2I4J A;  5JJM A;  3VTD A;  5B5B A;  3EYB A;  3WJ5 A;  1DKF A;  2AXA A;  3VT8 A;  1LBD A;  1XV9 B;  1XOW A;  4EM9 A;  2AA5 A;  5SYZ A;  5JI0 D;  4RAK A;  4PF3 A;  3D5F A;  4P6X A;  1OSH A;  3GN8 A;  3LMP A;  4BCR A;  5DWL A;  1GS4 A;  4IW6 A;  1UOM A;  3ZR7 A;  5EGV A;  3GWX A;  4OFR A;  4IA3 A;  4OH6 A;  5AWK A;  5KRK A;  2ZNN A;  5FQR A;  3AUN A;  3H52 A;  1NAX A;  2ZK4 A;  2HBH A;  4J5X C;  4WPF A;  3FUG A;  4OZT E;  3W5Q A;  3VJT A;  3D57 A;  2HWR A;  1YIN A;  4OEA A;  1K74 D;  2J7Y A;  3L0E A;  4TV1 A;  3QT0 A;  1L2J A;  1QKT A;  4JL4 A;  4TUZ B;  5DYB A;  5DXE A;  1SJ0 A;  4DOR A;  3P89 A;  2J4A A; 
#chains in the Genus database with same CATH topology
 5KRC A;  2PIP L;  4QJR A;  1XQC A;  2QA6 A;  5L11 A;  1I7G A;  1Q4X A;  3B67 A;  3GBK A;  5FQT A;  1I7I A;  2ZBS A;  1HG4 A;  3AZ1 A;  4JYI A;  3UUA A;  3VT9 A;  1BSX A;  5C4O A;  1MV9 A;  1YUC A;  5DV6 A;  4PPP A;  3FUR A;  3M7R A;  4OZT U;  5DWI A;  5DKG A;  2P15 A;  3IXP D;  3P8X A;  3RY9 A;  3VT6 A;  3ET1 A;  2QTU A;  1NYX A;  1N4H A;  1Y0X X;  2REW A;  3B66 A;  3IPU A;  3K22 A;  3L03 A;  3UUD B;  4DK7 A;  3O1E A;  5EJV A;  1T74 A;  4IUI A;  2VV1 B;  4RME A;  3OLF A;  5DXM A;  5CJ6 A;  2XHS A;  3D90 A;  3KPZ A;  1R20 A;  4JYH A;  4MGD B;  1RK3 A;  2VV4 B;  2O4J A;  3OMQ A;  1PDU A;  5DKS A;  3SP6 A;  4OZR E;  4XLD A;  2GWX A;  4OIL A;  3V3Q A;  3OKH A;  2G0H A;  4ZI1 A;  4L96 A;  3V3E A;  3UVV A;  4NIE A;  2QA8 A;  2YLQ A;  5DU5 A;  4CSJ A;  5E0X A;  3VJI A;  3WFF A;  1OSV A;  4WHF A;  2AO6 A;  2P1T A;  5DK9 A;  5KRL A;  1L2I A;  2ZK0 A;  5DY8 A;  3AN4 A;  2JJ3 A;  5G3J A;  4OH5 A;  1FCY A;  2OM9 A;  2AAX A;  4X1F A;  3OMK A;  3R5M A;  2ZXN A;  3G8O A;  3DZY D;  2HB8 A;  4OHA A;  3A3Z X;  1PQC A;  1FM9 A;  2ZMH A;  3PCU A;  4KZI A;  5KRO A;  1ZGY A;  2Q5S A;  2ZMI A;  4IQR A;  2HAS A;  5DXG A;  2AA6 A;  5L7E A;  1YY4 A;  1QKU A;  1XP6 A;  3MNE A;  3KWY A;  4DM6 A;  3TKM A;  2PIV A;  3R8I A;  5C4S A;  3X1I A;  1Z95 A;  2PIQ A;  3RVF A;  1R6G A;  4CI5 A;  1NQ7 A;  2G5O A;  5DX3 B;  2HAR A;  2OVM A;  3W0Y A;  3GWS X;  3OKI A;  1MVC A;  4XAO A;  3DY6 A;  2ZFX A;  1NDE A;  1Z5X U;  3HM1 A;  3OOK A;  4OFU A;  3WTQ A;  4APU A;  5IXK A;  2VV3 A;  2ABI A;  4R06 A;  2P7A A;  3DR1 A;  3X36 A;  4DMA A;  3UP0 A;  3FS1 A;  4G1Z A;  2Z4B A;  4OJ4 A;  4RUP A;  4OJB A;  4G1D A;  4WHG A;  1G1U A;  5A86 A;  2Q8S A;  3VHV A;  3UU7 A;  5DI7 A;  5KRH A;  5KYJ A;  4K6I A;  3PBA A;  5KCF A;  3E00 A;  1ZDT A;  2H79 A;  1G2N A;  1K7L A;  1YOW A;  2R40 A;  3L0L A;  4REE A;  1M7W A;  1ZH7 A;  3ERT A;  4MG8 B;  4UDA A;  4ZO1 X;  5DKB A;  3WWR A;  2P1U A;  5ETH A;  1K74 A;  2AA2 A;  2ZMJ A;  1NUO A;  1XDK A;  5C4T A;  3KYT A;  1PQ9 A;  2B1Z A;  2AX8 A;  1K4W A;  5JY3 A;  4IVY A;  2I4P A;  5ICK A;  4X1G A;  3SP9 A;  2HB7 A;  3W0G A;  2QGW A;  2OZ7 A;  3AZ3 A;  4ZNT A;  2P1V A;  2PRG A;  2B1V A;  1YA3 A;  2ZL9 A;  5AK2 A;  2Q59 A;  5KCE A;  1TFC A;  1X7B A;  3KMG A;  5DUE A;  3RLJ A;  1FD0 A;  2P7Z A;  3IXP A;  4S0S A;  1YP0 A;  4MDD A;  5DXQ A;  2JFA B;  3ADW A;  4MGA B;  1T7R A;  2ZY0 A;  3B5R A;  3Q95 A;  4MG6 A;  2VSR A;  4IWF A;  5DZ1 A;  4R2U A;  1KKQ A;  3L3X A;  3W0I A;  4MG9 A;  1U3S A;  1I37 A;  3OS8 A;  5E0W A;  5APK A;  4ZOM A;  4Q50 A;  5DRJ A;  1E3G A;  2IOK A;  1XP9 A;  2QXM A;  2J7X A;  1KV6 A;  3B1M A;  1PCG A;  3IPQ A;  4FGY A;  4DQM A;  5HYR A;  2QZO B;  4ITE A;  3L1B A;  3OMP A;  5APJ A;  5AZV A;  4FN9 A;  1T73 A;  2QR9 A;  4Q0A C;  1OVL A;  4EMA A;  4OEZ A;  3R8D A;  4XHD A;  1X7E A;  3L3Z A;  4E4K A;  2B50 A;  4IWC A;  4MGC A;  5ACC A;  2ZAS A;  3VHW A;  3DT3 A;  3IA6 A;  4IU7 A;  5DZI A;  3WT7 A;  4J24 A;  5DXP A;  1T76 A;  1YMT A;  4XT9 A;  4N8R A;  5DWG A;  4QE6 A;  2Q1H A;  3DZY A;  2J14 A;  4WVD A;  2ACL A;  1FCX A;  5GT4 A;  3E00 D;  5AAU A;  1XB7 A;  4POH A;  5I4V A;  3KFC A;  3MNP A;  2F4B A;  2R40 D;  4PLD A;  4RZG A;  2AB2 A;  4QL8 A;  3UUC A;  1PRG A;  3E94 A;  1HJ1 A;  2NV7 A;  2ZLC A;  4K4J A;  4RFW A;  2PJL A;  3P88 A;  4IA2 A;  1XP1 A;  3FC6 A;  4J5W A;  2XKW A;  4S15 A;  3B68 A;  2I0J A;  3CQV A;  5AVL A;  2O9I A;  4S14 A;  1X76 A;  4ZN7 A;  3A2H A;  1MZN A;  1ZDU A;  3KMZ A;  4RZF A;  3WT6 A;  4IW8 A;  5AAV B;  1WM0 X;  2AX6 A;  5GIC A;  3ADX A;  3X31 A;  5KCW A;  4L98 A;  5G46 A;  1S9P A;  2ZVT A;  5DRM A;  1ZEO A;  3CS4 A;  1T7F A;  2PIR A;  3L0J A;  1S0Z A;  3U9Q A;  4KZM A;  3TKC A;  5EIT A;  3KBA A;  4WQP A;  4A4W A;  2E2R A;  2QAB A;  4OAR A;  1RJK A;  4UDB A;  1QKN A;  3T03 A;  5C4U A;  4YT1 A;  2BJ4 A;  5DIG A;  3B0R A;  2GPU A;  3V9V A;  1T5Z A;  4LTW A;  5E7V A;  3BQD A;  1R5K A;  2GPP A;  3B65 A;  3F5C B;  3KDT A;  5DXB B;  5HJS A;  4CI4 A;  3VTC A;  5DKE A;  3R8A A;  2W8Y A;  3FAL B;  3KDU A;  4ZNH A;  5KYA A;  2HAM A;  3NSQ A;  5DVC A;  4PXM A;  3OMM A;  5HJP B;  2ZK6 A;  4ONI A;  2IHQ A;  3O1D A;  4NQA B;  3JZB A;  2ZK5 A;  3GYT A;  1FBY A;  5IAW A;  2V0V A;  1ILG A;  5JJM B;  5G42 A;  5AYG A;  1X7R A;  2AYR A;  1A52 A;  3A2I A;  3A9E A;  5HZC A;  4JYG A;  1Z5X E;  1GWQ A;  3W0A A;  3RUT A;  4LNW A;  4R6S A;  1NQ2 A;  2XYX A;  5KCC A;  1XJ7 A;  4DOS A;  2HFP A;  3LBD A;  2VST A;  2G44 A;  5KRI A;  3FEJ A;  3NSP A;  1I38 A;  1T65 A;  4PPS A;  5EC9 A;  1RDT D;  2GP7 A;  3HOD A;  5KR9 A;  2PIT A;  1ZKY A;  3G9E A;  4RMC A;  3VT3 A;  4G2I A;  2ZKC A;  1T7M A;  4IS8 A;  5IZ0 A;  2H77 A;  3WJ4 A;  1N46 A;  5DMC A;  1EXA A;  4E2J A;  1OT7 A;  2YHD A;  5FQS A;  3ZQT A;  3CS8 A;  2QZO A;  1NRL A;  2VV2 A;  3D24 A;  4HEE X;  1XVP A;  4RE8 A;  1T7T A;  1T63 A;  1XLS A;  2ZK3 A;  4FNE A;  3OS8 C;  2GPV A;  3OSI A;  4TV1 B;  3GD2 A;  2AX9 A;  2HVC A;  4OKT A;  1SQN A;  2GIU A;  3RLL A;  3RUU A;  2Z4J A;  2P7G A;  4OGH A;  1RKG A;  1XV9 A;  4OIV A;  3VT5 A;  3S9S A;  4ZN9 A;  4XTA A;  3VRT A;  2QW4 A;  3UUA B;  3PRG A;  3DZU A;  3OS9 A;  4B7W A;  4O8F A;  5DZH A;  1UPW A;  1GWX A;  5G45 A;  5DV3 A;  4YMQ A;  5DMF A;  3OAP A;  1PK5 A;  4MG7 B;  2FSZ A;  1QKM A;  2BAW A;  3W5R A;  1ZAF A;  1UHL B;  2VV0 A;  5DID A;  3P0U A;  2Q60 A;  3R5N A;  3VT7 A;  2ZNQ A;  2QXS A;  1Y9R A;  4OKW A;  3PEQ A;  4TUZ A;  2GPO A;  4MGB A;  1ERR A;  1XAP A;  4PWL A;  2ZNO A;  3ADU A;  4PRG A;  3UVV B;  3CS6 A;  2AMB A;  2QA8 B;  4K7A A;  4PLE A;  5LGA A;  4XUM A;  1X7J A;  2PIW A;  2Q5P A;  3B3K A;  3G0W A;  2AA7 A;  3PO9 A;  1S0X A;  1M2Z A;  2PIX A;  1PZL A;  2ZK2 A;  3VI8 A;  4JAZ A;  5AWJ A;  3UUD A;  2VV1 A;  2NPA A;  2ZNP A;  4F9M A;  2HCD A;  4G20 A;  1U3R A;  5E19 A;  3HO0 A;  4MGD A;  5KRA A;  1NHZ A;  2VV4 A;  3E7C A;  5DYD A;  3ZRB A;  1P8D A;  3OOF A;  1KNU A;  4G1Y A;  2LBD A;  3OLL A;  4PP5 A;  2AM9 A;  5DUH A;  4LNX A;  4IA1 A;  2YLY A;  1GWR A;  5DL4 A;  3VHU A;  4OLM A;  2GTK A;  2QMV A;  2OAX A;  3OGT A;  2YJD A;  1IE9 A;  3CTB A;  3NOA A;  2QNV A;  2PIN A;  4ZJW A;  3DZU D;  5DLR A;  1S19 A;  3VN2 A;  5DIE A;  1FCZ A;  3WMH A;  2Q6J A;  4DM8 A;  3F7D A;  3VTB A;  1A28 A;  3K8S A;  2FAI A;  5HYK A;  3W0J A;  3H0A D;  2R6Y A;  4NY9 A;  2QH6 A;  5K13 A;  5KCU A;  3VT4 A;  1RDT A;  4FHH A;  1ILH A;  1XNX A;  5E15 A;  2GL8 A;  3OZJ A;  1FM6 D;  2Q7I A;  3UU7 B;  3AUR A;  2I0G A;  4KZJ A;  1IE8 A;  3G8I A;  4MGB B;  4S0T A;  2V7C A;  4IA7 A;  1XQ3 A;  4RWV A;  2YAT A;  3CWD A;  2Q61 A;  1YJE A;  3CDS A;  1XNN A;  1XDK B;  2OCF A;  3BEJ A;  5DX3 A;  2B23 A;  3AN3 A;  3X1H A;  5KCT A;  4M8E A;  2Q5G A;  1XLS E;  4PVU A;  5DZ3 A;  3IPS A;  4UDD A;  1NQ0 A;  5M96 A;  2POG A;  3WFG A;  4HLW A;  1G50 A;  2IOG A;  2NXX E;  4Q13 A;  2Q59 B;  3ADV A;  1M13 A;  4N73 A;  3VRW A;  3JZC A;  3WGP A;  2P54 A;  1G5Y A;  2ATH A;  3OMO A;  3SZ1 A;  2O4R A;  2Q7K A;  3CDP A;  5G43 A;  3W0H A;  2Q7L A;  5EI1 A;  4A4V A;  4E4Q A;  4RMD A;  4YPQ A;  5KCD A;  3Q95 B;  2AX7 A;  4PP3 A;  3W5T A;  1VJB A;  4IVW A;  2HC4 A;  3B0Q A;  4XUH A;  3ADS A;  4MG8 A;  4MG9 B;  2ZK1 A;  4MG7 A;  5E14 A;  1YOK A;  1SR7 A;  2AMA A;  3ET2 A;  2HWQ A;  4REF A;  2YJA B;  1UPV A;  2R6W A;  1UHL A;  3IMY A;  4NB6 A;  4QE8 A;  2XYW A;  2Q3Y A;  3TY0 A;  5DZ0 A;  3HZF A;  1XPC A;  4ZNW A;  4NUF A;  1DKF B;  1OVL B;  3HC6 A;  3OSW A;  2PKL A;  4POJ A;  2YLP A;  3AZ2 A;  4M8H A;  4A2J A;  1N83 A;  3A40 X;  2POB A;  4OED A;  5FQV A;  3UP3 A;  3V9Y A;  3AFR A;  1PQ6 A;  2AWH A;  4N1Y A;  2P4Y A;  3DCU A;  3KMR A;  5DV8 A;  2JFA A;  4J5X A;  4MGA A;  2QPY A;  2I4Z A;  3B0T A;  2A3I A;  3BC5 A;  4OIU A;  5DTV A;  5GID A;  3PLZ A;  5FQP A;  5H1E A;  3A2J A;  3HLV A;  4OC7 A;  3R29 A;  2QSE A;  5KRF A;  3AX8 A;  3ET3 A;  4RUO X;  1U3Q A;  1YYE A;  2ACL B;  4YNK A;  5DSH A;  3R2A A;  2XYJ A;  4OEY A;  2ZLA A;  3VSO A;  5KRJ A;  2YFE A;  5APH A;  3VJS A;  5KD9 A;  1EXX A;  5DWJ A;  1R1K A;  3CJW A;  4OZR U;  3ILZ A;  4QK4 A;  5DVS A;  1NAV A;  4LSJ A;  4WLB A;  4ZNS A;  5GIE A;  3FC6 B;  3GYU A;  5DUG A;  2NXX A;  2YLO A;  1SKX A;  4IV2 A;  1XIU A;  3TX7 B;  3VRV A;  3V49 A;  1XZX X;  4ITF A;  1LV2 A;  3OZ0 A;  3B0W A;  4Y29 A;  3DCT A;  5E1C A;  3CLD A;  2JF9 A;  4OJ9 A;  3A78 A;  3OLS A;  3VJH A;  3HVL A;  4FHI A;  1S9Q A;  4PP6 A;  3H0A A;  5DP0 A;  5KRM A;  2Q6S A;  3ADT A;  4UDC A;  3HQ5 A;  4LBD A;  4ZJR A;  1FM6 A;  3ET0 A;  4MG5 A;  3D6D A;  4OK1 A;  2Q7J A;  2QE4 A;  3MNO A;  1ZUC A;  2BJ4 B;  3N00 A;  1Y0S A;  4ZNU A;  4DK8 A;  2ZXM A;  1R20 D;  5AAV A;  5G44 A;  1TXI A;  5DVV A;  3AUQ A;  4J5W C;  4RZE A;  1U9E A;  2Q1V A;  4ZNV A;  3V4A A;  2QGT A;  3FLI A;  3W5P A;  2Q6R A;  1ERE A;  1T79 A;  5B41 A;  1NQ1 A;  5F9B A;  5AVI A;  3W0C A;  1E3K A;  4P6W A;  5LWP A;  4G2H A;  3K6P A;  2Q70 A;  5HCV A;  3ZRA A;  1YIM A;  3HC5 A;  1X78 A;  3WT5 A;  5EHJ A;  3VSP A;  3A9E B;  4G21 A;  4XI3 A;  2OUZ A;  5DXR A;  2EWP A;  3VRU A;  2FVJ A;  4IV4 A;  5DXK A;  1R1K D;  4JGV A;  1DB1 A;  4J26 A;  4RUJ A;  2PIO A;  4ZO1 B;  2PIU A;  1FM9 D;  1RKH A;  3F5C A;  4OKX A;  4QM0 A;  5DXB A;  3OSA A;  2PNU A;  5G5W A;  3FXV A;  3FAL A;  5L7H A;  4OKB A;  1P93 A;  3V9T A;  2G0G A;  5DWE A;  2NW4 A;  3K23 A;  5L7G A;  5HJP A;  3ERD A;  1H9U A;  4N5G A;  3GZ9 A;  3FEI A;  2OVH A;  5AZT A;  1XVP B;  2ZXZ A;  2I4J A;  5JJM A;  3VTD A;  5B5B A;  3EYB A;  3WJ5 A;  1DKF A;  2AXA A;  3VT8 A;  1LBD A;  1XV9 B;  1XOW A;  4EM9 A;  2AA5 A;  5SYZ A;  5JI0 D;  4RAK A;  4PF3 A;  3D5F A;  4P6X A;  1OSH A;  3GN8 A;  3LMP A;  4BCR A;  5DWL A;  1GS4 A;  4IW6 A;  1UOM A;  3ZR7 A;  5EGV A;  3GWX A;  4OFR A;  4IA3 A;  4OH6 A;  5AWK A;  5KRK A;  2ZNN A;  5FQR A;  3AUN A;  3H52 A;  1NAX A;  2ZK4 A;  2HBH A;  4J5X C;  4WPF A;  3FUG A;  4OZT E;  3W5Q A;  3VJT A;  3D57 A;  2HWR A;  1YIN A;  4OEA A;  1K74 D;  2J7Y A;  3L0E A;  4TV1 A;  3QT0 A;  1L2J A;  1QKT A;  4JL4 A;  4TUZ B;  5DYB A;  5DXE A;  1SJ0 A;  4DOR A;  3P89 A;  2J4A A; 
#chains in the Genus database with same CATH homology
 5KRC A;  2PIP L;  4QJR A;  1XQC A;  2QA6 A;  5L11 A;  1I7G A;  1Q4X A;  3B67 A;  3GBK A;  5FQT A;  1I7I A;  2ZBS A;  1HG4 A;  3AZ1 A;  4JYI A;  3UUA A;  3VT9 A;  1BSX A;  5C4O A;  1MV9 A;  1YUC A;  5DV6 A;  4PPP A;  3FUR A;  3M7R A;  4OZT U;  5DWI A;  5DKG A;  2P15 A;  3IXP D;  3P8X A;  3RY9 A;  3VT6 A;  3ET1 A;  2QTU A;  1NYX A;  1N4H A;  1Y0X X;  2REW A;  3B66 A;  3IPU A;  3K22 A;  3L03 A;  3UUD B;  4DK7 A;  3O1E A;  5EJV A;  1T74 A;  4IUI A;  2VV1 B;  4RME A;  3OLF A;  5DXM A;  5CJ6 A;  2XHS A;  3D90 A;  3KPZ A;  1R20 A;  4JYH A;  4MGD B;  1RK3 A;  2VV4 B;  2O4J A;  3OMQ A;  1PDU A;  5DKS A;  3SP6 A;  4OZR E;  4XLD A;  2GWX A;  4OIL A;  3V3Q A;  3OKH A;  2G0H A;  4ZI1 A;  4L96 A;  3V3E A;  3UVV A;  4NIE A;  2QA8 A;  2YLQ A;  5DU5 A;  4CSJ A;  5E0X A;  3VJI A;  3WFF A;  1OSV A;  4WHF A;  2AO6 A;  2P1T A;  5DK9 A;  5KRL A;  1L2I A;  2ZK0 A;  5DY8 A;  3AN4 A;  2JJ3 A;  5G3J A;  4OH5 A;  1FCY A;  2OM9 A;  2AAX A;  4X1F A;  3OMK A;  3R5M A;  2ZXN A;  3G8O A;  3DZY D;  2HB8 A;  4OHA A;  3A3Z X;  1PQC A;  1FM9 A;  2ZMH A;  3PCU A;  4KZI A;  5KRO A;  1ZGY A;  2Q5S A;  2ZMI A;  4IQR A;  2HAS A;  5DXG A;  2AA6 A;  5L7E A;  1YY4 A;  1QKU A;  1XP6 A;  3MNE A;  3KWY A;  4DM6 A;  3TKM A;  2PIV A;  3R8I A;  5C4S A;  3X1I A;  1Z95 A;  2PIQ A;  3RVF A;  1R6G A;  4CI5 A;  1NQ7 A;  2G5O A;  5DX3 B;  2HAR A;  2OVM A;  3W0Y A;  3GWS X;  3OKI A;  1MVC A;  4XAO A;  3DY6 A;  2ZFX A;  1NDE A;  1Z5X U;  3HM1 A;  3OOK A;  4OFU A;  3WTQ A;  4APU A;  5IXK A;  2VV3 A;  2ABI A;  4R06 A;  2P7A A;  3DR1 A;  3X36 A;  4DMA A;  3UP0 A;  3FS1 A;  4G1Z A;  2Z4B A;  4OJ4 A;  4RUP A;  4OJB A;  4G1D A;  4WHG A;  1G1U A;  5A86 A;  2Q8S A;  3VHV A;  3UU7 A;  5DI7 A;  5KRH A;  5KYJ A;  4K6I A;  3PBA A;  5KCF A;  3E00 A;  1ZDT A;  2H79 A;  1G2N A;  1K7L A;  1YOW A;  2R40 A;  3L0L A;  4REE A;  1M7W A;  1ZH7 A;  3ERT A;  4MG8 B;  4UDA A;  4ZO1 X;  5DKB A;  3WWR A;  2P1U A;  5ETH A;  1K74 A;  2AA2 A;  2ZMJ A;  1NUO A;  1XDK A;  5C4T A;  3KYT A;  1PQ9 A;  2B1Z A;  2AX8 A;  1K4W A;  5JY3 A;  4IVY A;  2I4P A;  5ICK A;  4X1G A;  3SP9 A;  2HB7 A;  3W0G A;  2QGW A;  2OZ7 A;  3AZ3 A;  4ZNT A;  2P1V A;  2PRG A;  2B1V A;  1YA3 A;  2ZL9 A;  5AK2 A;  2Q59 A;  5KCE A;  1TFC A;  1X7B A;  3KMG A;  5DUE A;  3RLJ A;  1FD0 A;  2P7Z A;  3IXP A;  4S0S A;  1YP0 A;  4MDD A;  5DXQ A;  2JFA B;  3ADW A;  4MGA B;  1T7R A;  2ZY0 A;  3B5R A;  3Q95 A;  4MG6 A;  2VSR A;  4IWF A;  5DZ1 A;  4R2U A;  1KKQ A;  3L3X A;  3W0I A;  4MG9 A;  1U3S A;  1I37 A;  3OS8 A;  5E0W A;  5APK A;  4ZOM A;  4Q50 A;  5DRJ A;  1E3G A;  2IOK A;  1XP9 A;  2QXM A;  2J7X A;  1KV6 A;  3B1M A;  1PCG A;  3IPQ A;  4FGY A;  4DQM A;  5HYR A;  2QZO B;  4ITE A;  3L1B A;  3OMP A;  5APJ A;  5AZV A;  4FN9 A;  1T73 A;  2QR9 A;  4Q0A C;  1OVL A;  4EMA A;  4OEZ A;  3R8D A;  4XHD A;  1X7E A;  3L3Z A;  4E4K A;  2B50 A;  4IWC A;  4MGC A;  5ACC A;  2ZAS A;  3VHW A;  3DT3 A;  3IA6 A;  4IU7 A;  5DZI A;  3WT7 A;  4J24 A;  5DXP A;  1T76 A;  1YMT A;  4XT9 A;  4N8R A;  5DWG A;  4QE6 A;  2Q1H A;  3DZY A;  2J14 A;  4WVD A;  2ACL A;  1FCX A;  5GT4 A;  3E00 D;  5AAU A;  1XB7 A;  4POH A;  5I4V A;  3KFC A;  3MNP A;  2F4B A;  2R40 D;  4PLD A;  4RZG A;  2AB2 A;  4QL8 A;  3UUC A;  1PRG A;  3E94 A;  1HJ1 A;  2NV7 A;  2ZLC A;  4K4J A;  4RFW A;  2PJL A;  3P88 A;  4IA2 A;  1XP1 A;  3FC6 A;  4J5W A;  2XKW A;  4S15 A;  3B68 A;  2I0J A;  3CQV A;  5AVL A;  2O9I A;  4S14 A;  1X76 A;  4ZN7 A;  3A2H A;  1MZN A;  1ZDU A;  3KMZ A;  4RZF A;  3WT6 A;  4IW8 A;  5AAV B;  1WM0 X;  2AX6 A;  5GIC A;  3ADX A;  3X31 A;  5KCW A;  4L98 A;  5G46 A;  1S9P A;  2ZVT A;  5DRM A;  1ZEO A;  3CS4 A;  1T7F A;  2PIR A;  3L0J A;  1S0Z A;  3U9Q A;  4KZM A;  3TKC A;  5EIT A;  3KBA A;  4WQP A;  4A4W A;  2E2R A;  2QAB A;  4OAR A;  1RJK A;  4UDB A;  1QKN A;  3T03 A;  5C4U A;  4YT1 A;  2BJ4 A;  5DIG A;  3B0R A;  2GPU A;  3V9V A;  1T5Z A;  4LTW A;  5E7V A;  3BQD A;  1R5K A;  2GPP A;  3B65 A;  3F5C B;  3KDT A;  5DXB B;  5HJS A;  4CI4 A;  3VTC A;  5DKE A;  3R8A A;  2W8Y A;  3FAL B;  3KDU A;  4ZNH A;  5KYA A;  2HAM A;  3NSQ A;  5DVC A;  4PXM A;  3OMM A;  5HJP B;  2ZK6 A;  4ONI A;  2IHQ A;  3O1D A;  4NQA B;  3JZB A;  2ZK5 A;  3GYT A;  1FBY A;  5IAW A;  2V0V A;  1ILG A;  5JJM B;  5G42 A;  5AYG A;  1X7R A;  2AYR A;  1A52 A;  3A2I A;  3A9E A;  5HZC A;  4JYG A;  1Z5X E;  1GWQ A;  3W0A A;  3RUT A;  4LNW A;  4R6S A;  1NQ2 A;  2XYX A;  5KCC A;  1XJ7 A;  4DOS A;  2HFP A;  3LBD A;  2VST A;  2G44 A;  5KRI A;  3FEJ A;  3NSP A;  1I38 A;  1T65 A;  4PPS A;  5EC9 A;  1RDT D;  2GP7 A;  3HOD A;  5KR9 A;  2PIT A;  1ZKY A;  3G9E A;  4RMC A;  3VT3 A;  4G2I A;  2ZKC A;  1T7M A;  4IS8 A;  5IZ0 A;  2H77 A;  3WJ4 A;  1N46 A;  5DMC A;  1EXA A;  4E2J A;  1OT7 A;  2YHD A;  5FQS A;  3ZQT A;  3CS8 A;  2QZO A;  1NRL A;  2VV2 A;  3D24 A;  4HEE X;  1XVP A;  4RE8 A;  1T7T A;  1T63 A;  1XLS A;  2ZK3 A;  4FNE A;  3OS8 C;  2GPV A;  3OSI A;  4TV1 B;  3GD2 A;  2AX9 A;  2HVC A;  4OKT A;  1SQN A;  2GIU A;  3RLL A;  3RUU A;  2Z4J A;  2P7G A;  4OGH A;  1RKG A;  1XV9 A;  4OIV A;  3VT5 A;  3S9S A;  4ZN9 A;  4XTA A;  3VRT A;  2QW4 A;  3UUA B;  3PRG A;  3DZU A;  3OS9 A;  4B7W A;  4O8F A;  5DZH A;  1UPW A;  1GWX A;  5G45 A;  5DV3 A;  4YMQ A;  5DMF A;  3OAP A;  1PK5 A;  4MG7 B;  2FSZ A;  1QKM A;  2BAW A;  3W5R A;  1ZAF A;  1UHL B;  2VV0 A;  5DID A;  3P0U A;  2Q60 A;  3R5N A;  3VT7 A;  2ZNQ A;  2QXS A;  1Y9R A;  4OKW A;  3PEQ A;  4TUZ A;  2GPO A;  4MGB A;  1ERR A;  1XAP A;  4PWL A;  2ZNO A;  3ADU A;  4PRG A;  3UVV B;  3CS6 A;  2AMB A;  2QA8 B;  4K7A A;  4PLE A;  5LGA A;  4XUM A;  1X7J A;  2PIW A;  2Q5P A;  3B3K A;  3G0W A;  2AA7 A;  3PO9 A;  1S0X A;  1M2Z A;  2PIX A;  1PZL A;  2ZK2 A;  3VI8 A;  4JAZ A;  5AWJ A;  3UUD A;  2VV1 A;  2NPA A;  2ZNP A;  4F9M A;  2HCD A;  4G20 A;  1U3R A;  5E19 A;  3HO0 A;  4MGD A;  5KRA A;  1NHZ A;  2VV4 A;  3E7C A;  5DYD A;  3ZRB A;  1P8D A;  3OOF A;  1KNU A;  4G1Y A;  2LBD A;  3OLL A;  4PP5 A;  2AM9 A;  5DUH A;  4LNX A;  4IA1 A;  2YLY A;  1GWR A;  5DL4 A;  3VHU A;  4OLM A;  2GTK A;  2QMV A;  2OAX A;  3OGT A;  2YJD A;  1IE9 A;  3CTB A;  3NOA A;  2QNV A;  2PIN A;  4ZJW A;  3DZU D;  5DLR A;  1S19 A;  3VN2 A;  5DIE A;  1FCZ A;  3WMH A;  2Q6J A;  4DM8 A;  3F7D A;  3VTB A;  1A28 A;  3K8S A;  2FAI A;  5HYK A;  3W0J A;  3H0A D;  2R6Y A;  4NY9 A;  2QH6 A;  5K13 A;  5KCU A;  3VT4 A;  1RDT A;  4FHH A;  1ILH A;  1XNX A;  5E15 A;  2GL8 A;  3OZJ A;  1FM6 D;  2Q7I A;  3UU7 B;  3AUR A;  2I0G A;  4KZJ A;  1IE8 A;  3G8I A;  4MGB B;  4S0T A;  2V7C A;  4IA7 A;  1XQ3 A;  4RWV A;  2YAT A;  3CWD A;  2Q61 A;  1YJE A;  3CDS A;  1XNN A;  1XDK B;  2OCF A;  3BEJ A;  5DX3 A;  2B23 A;  3AN3 A;  3X1H A;  5KCT A;  4M8E A;  2Q5G A;  1XLS E;  4PVU A;  5DZ3 A;  3IPS A;  4UDD A;  1NQ0 A;  5M96 A;  2POG A;  3WFG A;  4HLW A;  1G50 A;  2IOG A;  2NXX E;  4Q13 A;  2Q59 B;  3ADV A;  1M13 A;  4N73 A;  3VRW A;  3JZC A;  3WGP A;  2P54 A;  1G5Y A;  2ATH A;  3OMO A;  3SZ1 A;  2O4R A;  2Q7K A;  3CDP A;  5G43 A;  3W0H A;  2Q7L A;  5EI1 A;  4A4V A;  4E4Q A;  4RMD A;  4YPQ A;  5KCD A;  3Q95 B;  2AX7 A;  4PP3 A;  3W5T A;  1VJB A;  4IVW A;  2HC4 A;  3B0Q A;  4XUH A;  3ADS A;  4MG8 A;  4MG9 B;  2ZK1 A;  4MG7 A;  5E14 A;  1YOK A;  1SR7 A;  2AMA A;  3ET2 A;  2HWQ A;  4REF A;  2YJA B;  1UPV A;  2R6W A;  1UHL A;  3IMY A;  4NB6 A;  4QE8 A;  2XYW A;  2Q3Y A;  3TY0 A;  5DZ0 A;  3HZF A;  1XPC A;  4ZNW A;  4NUF A;  1DKF B;  1OVL B;  3HC6 A;  3OSW A;  2PKL A;  4POJ A;  2YLP A;  3AZ2 A;  4M8H A;  4A2J A;  1N83 A;  3A40 X;  2POB A;  4OED A;  5FQV A;  3UP3 A;  3V9Y A;  3AFR A;  1PQ6 A;  2AWH A;  4N1Y A;  2P4Y A;  3DCU A;  3KMR A;  5DV8 A;  2JFA A;  4J5X A;  4MGA A;  2QPY A;  2I4Z A;  3B0T A;  2A3I A;  3BC5 A;  4OIU A;  5DTV A;  5GID A;  3PLZ A;  5FQP A;  5H1E A;  3A2J A;  3HLV A;  4OC7 A;  3R29 A;  2QSE A;  5KRF A;  3AX8 A;  3ET3 A;  4RUO X;  1U3Q A;  1YYE A;  2ACL B;  4YNK A;  5DSH A;  3R2A A;  2XYJ A;  4OEY A;  2ZLA A;  3VSO A;  5KRJ A;  2YFE A;  5APH A;  3VJS A;  5KD9 A;  1EXX A;  5DWJ A;  1R1K A;  3CJW A;  4OZR U;  3ILZ A;  4QK4 A;  5DVS A;  1NAV A;  4LSJ A;  4WLB A;  4ZNS A;  5GIE A;  3FC6 B;  3GYU A;  5DUG A;  2NXX A;  2YLO A;  1SKX A;  4IV2 A;  1XIU A;  3TX7 B;  3VRV A;  3V49 A;  1XZX X;  4ITF A;  1LV2 A;  3OZ0 A;  3B0W A;  4Y29 A;  3DCT A;  5E1C A;  3CLD A;  2JF9 A;  4OJ9 A;  3A78 A;  3OLS A;  3VJH A;  3HVL A;  4FHI A;  1S9Q A;  4PP6 A;  3H0A A;  5DP0 A;  5KRM A;  2Q6S A;  3ADT A;  4UDC A;  3HQ5 A;  4LBD A;  4ZJR A;  1FM6 A;  3ET0 A;  4MG5 A;  3D6D A;  4OK1 A;  2Q7J A;  2QE4 A;  3MNO A;  1ZUC A;  2BJ4 B;  3N00 A;  1Y0S A;  4ZNU A;  4DK8 A;  2ZXM A;  1R20 D;  5AAV A;  5G44 A;  1TXI A;  5DVV A;  3AUQ A;  4J5W C;  4RZE A;  1U9E A;  2Q1V A;  4ZNV A;  3V4A A;  2QGT A;  3FLI A;  3W5P A;  2Q6R A;  1ERE A;  1T79 A;  5B41 A;  1NQ1 A;  5F9B A;  5AVI A;  3W0C A;  1E3K A;  4P6W A;  5LWP A;  4G2H A;  3K6P A;  2Q70 A;  5HCV A;  3ZRA A;  1YIM A;  3HC5 A;  1X78 A;  3WT5 A;  5EHJ A;  3VSP A;  3A9E B;  4G21 A;  4XI3 A;  2OUZ A;  5DXR A;  2EWP A;  3VRU A;  2FVJ A;  4IV4 A;  5DXK A;  1R1K D;  4JGV A;  1DB1 A;  4J26 A;  4RUJ A;  2PIO A;  4ZO1 B;  2PIU A;  1FM9 D;  1RKH A;  3F5C A;  4OKX A;  4QM0 A;  5DXB A;  3OSA A;  2PNU A;  5G5W A;  3FXV A;  3FAL A;  5L7H A;  4OKB A;  1P93 A;  3V9T A;  2G0G A;  5DWE A;  2NW4 A;  3K23 A;  5L7G A;  5HJP A;  3ERD A;  1H9U A;  4N5G A;  3GZ9 A;  3FEI A;  2OVH A;  5AZT A;  1XVP B;  2ZXZ A;  2I4J A;  5JJM A;  3VTD A;  5B5B A;  3EYB A;  3WJ5 A;  1DKF A;  2AXA A;  3VT8 A;  1LBD A;  1XV9 B;  1XOW A;  4EM9 A;  2AA5 A;  5SYZ A;  5JI0 D;  4RAK A;  4PF3 A;  3D5F A;  4P6X A;  1OSH A;  3GN8 A;  3LMP A;  4BCR A;  5DWL A;  1GS4 A;  4IW6 A;  1UOM A;  3ZR7 A;  5EGV A;  3GWX A;  4OFR A;  4IA3 A;  4OH6 A;  5AWK A;  5KRK A;  2ZNN A;  5FQR A;  3AUN A;  3H52 A;  1NAX A;  2ZK4 A;  2HBH A;  4J5X C;  4WPF A;  3FUG A;  4OZT E;  3W5Q A;  3VJT A;  3D57 A;  2HWR A;  1YIN A;  4OEA A;  1K74 D;  2J7Y A;  3L0E A;  4TV1 A;  3QT0 A;  1L2J A;  1QKT A;  4JL4 A;  4TUZ B;  5DYB A;  5DXE A;  1SJ0 A;  4DOR A;  3P89 A;  2J4A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...