5KCWA

Crystal structure of the er-alpha ligand-binding domain (y537s) in complex with an n-trifluoroethyl obhs-n derivative
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
245
structure length
233
Chain Sequence
NSLALSLTADQMVSALLDAEPPILYSEYTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLSDLLLEMLDAHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Estrogen receptor
publication title Full antagonism of the estrogen receptor without a prototypical ligand side chain.
pubmed doi rcsb
source organism Homo sapiens
total genus 87
structure length 233
sequence length 245
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 5kcwA00
2QGTA 3AN3A 5AWKA 2YHDA 3TX7B 2PIVA 2XKWA 2XYXA 5G5WA 1UPVA 4S0SA 5G3JA 3S9SA 1M2ZA 1XDKB 3FS1A 4R2UA 1XVPB 1KNUA 3FC6B 4MG9A 3MNPA 3FALA 3SP9A 4ZI1A 2Q7LA 1T74A 4REEA 4WPFA 3W5PA 3X1HA 2PNUA 3OS9A 1RKHA 2AAXA 5AYGA 4OJ9A 2QA6A 3VHWA 2ZK2A 4OIUA 4XUHA 3OKHA 1RDTA 1FBYA 3E7CA 4MG9B 5EHJA 3OLLA 3B68A 3FALB 1N4HA 2ZMHA 4OFUA 3CS8A 4QE6A 5FQTA 1KKQA 5KCWA 4XTAA 4CI5A 1K74A 3RLJA 1N46A 2OVHA 2IOKA 3CTBA 3OS8C 5DL4A 3IXPD 1T76A 3VT5A 2HB7A 2AM9A 1L2JA 4R6SA 5E0WA 5GIDA 4RWVA 2PRGA 4P6WA 2Q1VA 3DY6A 3PBAA 3ET1A 4LTWA 3VJTA 3WWRA 5APKA 3UU7A 5GIEA 3VT8A 2ZXZA 1ILHA 3WFFA 1NHZA 3CQVA 3VRWA 3RUTA 2FVJA 3KBAA 3KMZA 4LNWA 1ZDTA 5KR9A 3GWSX 4G20A 4N1YA 4S14A 2HWQA 3F5CA 2VSTA 5FQVA 2YLPA 1PQ6A 3B65A 5DZ3A 1T7MA 4Q0AC 1ZEOA 3UU7B 5FQRA 3OLFA 4J5WC 3W0IA 1XB7A 4IA2A 3VJHA 4MGCA 3L0LA 5DIDA 3RVFA 1I7IA 1K74D 1NDEA 2NXXA 3OKIA 1G2NA 4UDDA 2NPAA 3R8AA 3U9QA 1S9PA 5KRHA 1NQ7A 3F5CB 2AO6A 2QR9A 4ITFA 4JYIA 4Q13A 4ZOMA 3X1IA 3AFRA 3MNOA 1E3GA 2AB2A 2AMBA 1S9QA 2O4RA 2Q8SA 4WVDA 5KRKA 1PRGA 1T5ZA 3G8IA 2YLOA 3OOFA 4XLDA 4PWLA 2P1VA 1T7FA 2ZK1A 1ZUCA 4LSJA 2PIWA 5DTVA 3L0EA 2AXAA 3AZ3A 1X7RA 4RZGA 5JI0D 5SYZA 5G45A 3OMOA 4OZRU 3V4AA 3VTBA 5KROA 2XHSA 4MGDA 4IS8A 5C4SA 2YATA 5HYKA 2R6WA 5KCEA 2BJ4A 2ZK6A 4RMEA 3V3QA 3WT5A 5L11A 4RUOX 3TY0A 4A4VA 2F4BA 1FM9A 3OMQA 1Z5XE 3ZR7A 2ZLCA 3AURA 4DK8A 4XAOA 2JF9A 1EREA 4J5XA 4RUPA 4RZEA 5DV8A 3E00A 5C4TA 3L3XA 2POBA 4ZO1X 4OARA 1NRLA 5LWPA 2GPVA 2ZKCA 1XJ7A 3IPQA 4G2HA 2J7XA 2J7YA 5KCFA 1GWRA 2HFPA 4MGDB 2V0VA 4OLMA 2QA8A 1SQNA 2ACLA 3AZ2A 2BJ4B 5KRAA 3VJSA 4N73A 5DUEA 2Q7KA 5DX3B 5ACCA 2G44A 2B1VA 2V7CA 3B67A 2EWPA 2OZ7A 3A9EA 5ICKA 5L7HA 3V9TA 2O9IA 1PZLA 2GPUA 5APHA 3BQDA 3DZYA 5HZCA 2IHQA 3OMMA 4FHHA 1TFCA 1S0ZA 1NUOA 2HC4A 2ACLB 2QA8B 2ZMIA 3AX8A 3A2JA 4CSJA 4PRGA 5HYRA 4OKBA 1XAPA 2R6YA 1FM9D 5DLRA 1I7GA 4WLBA 3ET0A 2GL8A 5KCUA 3E00D 2Q5GA 2A3IA 2HB8A 1I38A 3B0QA 2GP7A 3O1DA 3ADWA 5AZVA 2VV1A 4CI4A 1XIUA 3SP6A 2Q6SA 3M7RA 1X7BA 2B50A 3ADVA 2YLYA 2P1TA 1XZXX 4JAZA 1UPWA 2Q1HA 3FEIA 2ZK0A 3CS6A 3GWXA 3VT3A 4NY9A 2ZK3A 4MG6A 1ERRA 4K4JA 5AWJA 5KRFA 5I4VA 1HJ1A 3HODA 3CLDA 2VV1B 3DZYD 5DXMA 3P88A 4DOSA 3LBDA 1MV9A 2O4JA 2QABA 3PRGA 2ZBSA 5EI1A 5KCDA 2QXMA 2REWA 3FURA 1XVPA 2QNVA 5EC9A 5IAWA 2G0HA 2ZNNA 2ZL9A 5DWJA 5DZ1A 3R29A 3DZUD 3SZ1A 5E14A 1RKGA 2VSRA 1Y9RA 5DU5A 3W0HA 4DK7A 5L7GA 2HASA 4PLEA 1LBDA 3RY9A 4MG8A 2Q6RA 5DXPA 3OSAA 3IPUA 5DXQA 5DKGA 3OS8A 4MGBA 4E4QA 2H79A 5DMFA 2GPOA 3TKCA 3WT7A 2QW4A 5AAVA 4JL4A 3R8IA 2ATHA 4OC7A 4OH6A 3KPZA 3ADUA 3ADXA 2HVCA 3QT0A 3HLVA 3WFGA 4MG8B 5E0XA 1T73A 2ZVTA 3NSPA 3OLSA 4RMCA 2HAMA 2NV7A 1PDUA 1X7EA 1M7WA 4K7AA 2BAWA 2IOGA 4MGBB 3FLIA 3OGTA 3ERDA 4RZFA 5AAVB 1P8DA 3ZRAA 1FM6A 2OM9A 4E2JA 3L3ZA 2AX7A 4OZTE 1TXIA 1ILGA 3CJWA 3ADSA 2W8YA 1G5YA 4S15A 3AUQA 1OVLA 3X36A 3ZQTA 1LV2A 3Q95A 4A2JA 1YY4A 2ZMJA 5JJMA 1ZGYA 2AWHA 3DT3A 1G50A 1NAVA 1T79A 1U3SA 1Y0XX 3GD2A 3B66A 2OUZA 1XLSA 2FAIA 5L7EA 4J24A 1EXAA 2QGWA 4RAKA 1OVLB 1YUCA 5DV6A 3Q95B 3W5TA 5JJMB 5FQSA 3G8OA 4PXMA 4QL8A 4PPSA 1XOWA 1R20A 3TKMA 4DORA 4ZNTA 1Z5XU 2HARA 3GBKA 5DZHA 5A86A 5DVVA 3WGPA 4ONIA 1FM6D 3G9EA 4JYHA 4IA1A 1GWXA 2Z4BA 3AN4A 2Q59A 2ZFXA 4K6IA 3W0JA 3X31A 5KYJA 2PINA 3VHVA 1Y0SA 3BEJA 1P93A 3JZBA 3OZJA 5G46A 3VN2A 3VSOA 2P4YA 1PK5A 5LGAA 3OMKA 5AVLA 2QZOB 1FD0A 4OHAA 5ETHA 2OCFA 4XI3A 4E4KA 4OKTA 3E94A 3KYTA 4IA7A 1X76A 2VV4A 1QKTA 4L96A 2ZY0A 2Q59B 2J14A 3L0JA 3VHUA 4IU7A 5DXGA 1YJEA 4RMDA 5DX3A 1QKUA 5K13A 3W0CA 4DMAA 5DY8A 2QH6A 3HC6A 3VT4A 5E19A 3ZRBA 4LNXA 3GN8A 3UVVA 2XYJA 3IA6A 4OEAA 1R20D 4QJRA 4B7WA 1YOKA 5C4OA 5HJPA 5JY3A 2VV4B 5KCCA 1ZAFA 4APUA 4M8EA 5DVCA 1ZH7A 5IXKA 1YOWA 1SKXA 4Y29A 3NSQA 5AAUA 4IUIA 4NB6A 2QMVA 3PCUA 4OEDA 3VJIA 3P0UA 3UVVB 2AA2A 1NQ1A 3H52A 4M8HA 4PLDA 5HJPB 2QSEA 2G0GA 3ET2A 3PO9A 1NQ0A 3HO0A 2PIQA 1NAXA 4IVYA 1IE8A 4ZNVA 5DWGA 2HBHA 2OAXA 4X1GA 3V3EA 3D6DA 2R40A 3K22A 4ZN9A 3ERTA 3DZUA 1GWQA 3N00A 4ZNSA 3HC5A 4YNKA 3VRVA 4Q50A 4N5GA 4UDCA 2ZASA 1YP0A 4FGYA 3VT6A 4POJA 2PIRA 1XP6A 1T7TA 1OT7A 2JFAB 2LBDA 1KV6A 5KD9A 5KRCA 3UP3A 4OJ4A 4IV2A 4OIVA 3W5RA 5DIEA 3P89A 1K4WA 2P7ZA 5DI7A 3V9YA 1GS4A 3W5QA 3DCTA 3HQ5A 2NXXE 3R5MA 4UDBA 4REFA 4DM8A 4ZO1B 3KDUA 1A28A 3D90A 1MVCA 4MGAA 2Q5SA 4G1YA 3VI8A 3VSPA 1XV9A 5DV3A 1OSVA 4RE8A 3JZCA 2R40D 3OSIA 2H77A 5APJA 4EMAA 5DKBA 4PVUA 4BCRA 2I4PA 1PCGA 2FSZA 4FN9A 5GT4A 4IA3A 1UOMA 2ZNPA 1XP9A 3GYUA 5C4UA 1T7RA 2I4ZA 3V49A 4YPQA 4MGAB 2XYWA 3LMPA 3B0TA 3FUGA 4FHIA 1XV9B 4KZMA 5AZTA 4PF3A 2AA7A 5B5BA 3R2AA 3VRUA 3VRTA 4OJBA 1U3RA 5E1CA 5KRMA 4MDDA 4TV1B 2ZXNA 2YJDA 3L03A 1XP1A 5DYBA 2P7GA 3T03A 3W0GA 5DUHA 3A3ZX 4ZJRA 2GTKA 3HZFA 3RLLA 2OVMA 3ILZA 1R1KD 2QTUA 3B0WA 3VTCA 4ZNHA 4L98A 5EITA 2P54A 5DUGA 2PITA 4JGVA 5DZIA 5F9BA 2JJ3A 4G21A 3H0AA 5DRJA 5HJSA 2Q7JA 4X1FA 4J5WA 3VTDA 2QE4A 4WQPA 2POGA 1S0XA 3K23A 4OK1A 1FCYA 2I0GA 2Q61A 4YMQA 1UHLA 4NUFA 3R8DA 4XT9A 5AVIA 3IMYA 1H9UA 4IW6A 2Q7IA 2QPYA 5IZ0A 3KMRA 4DQMA 4ZNWA 4G1ZA 2PIOA 5DK9A 1QKNA 5E7VA 4P6XA 1E3KA 4ZN7A 3WT6A 2YLQA 3FEJA 3F7DA 3K8SA 3OAPA 4XHDA 1XQCA 1SJ0A 3R5NA 4RUJA 1FCZA 1UHLB 1ZKYA 2PIUA 3MNEA 2QZOA 1ZDUA 3L1BA 2Q5PA 3NOAA 4IW8A 3UUCA 4NQAB 1M13A 4JYGA 3H0AD 2ZNQA 4R06A 2P7AA 5DXKA 4HLWA 5H1EA 3OMPA 5FQPA 5G43A 1YMTA 4LBDA 2I4JA 3B1MA 2PIXA 1A52A 4G2IA 1L2IA 3P8XA 3V9VA 3UUAA 4ITEA 1Z95A 2HWRA 1SR7A 3ET3A 2Q6JA 3FXVA 2ZXMA 4PPPA 2PIPL 4OH5A 5DXEA 5B41A 1X78A 4RFWA 4PP3A 5KYAA 1RDTD 1U3QA 1EXXA 3KWYA 1RK3A 3OOKA 2P1UA 4ZNUA 1R6GA 2Q60A 1YIMA 3B0RA 5G44A 3UUAB 1BSXA 4KZIA 2VV3A 1NYXA 3AUNA 1N83A 3DR1A 4EM9A 1G1UA 4QM0A 5DKSA 4DM6A 5KRIA 4IQRA 4MG5A 5KRJA 2AA5A 4S0TA 4XUMA 2YJAB 3DCUA 1S19A 1YINA 1PQ9A 2Q3YA 2J4AA 4ZJWA 3BC5A 2I0JA 5DYDA 4NIEA 3CS4A 2AX6A 4QE8A 1R5KA 2ZNOA 4O8FA 5DWIA 5GICA 4OKWA 5G42A 2GWXA 3A2IA 1XNNA 3W0YA 4POHA 5M96A 2PJLA 4OILA 1OSHA 3ADTA 4HEEX 3A40X 3UUDA 4OFRA 5DXBA 2JFAA 5E15A 3GZ9A 5DKEA 1MZNA 3CWDA 5DIGA 4YT1A 5DVSA 3RUUA 4J26A 4IWFA 2ZK4A 1FCXA 1X7JA 2AX8A 1T63A 1U9EA 4IVWA 1XLSE 3HM1A 5DZ0A 1WM0X 2E2RA 3CDSA 3K6PA 2YFEA 4FNEA 3GYTA 1DKFA 2AA6A 2QXSA 4KZJA 3O1EA 4MG7A 4PP6A 1Q4XA 3IPSA 5DXBB 3UUDB 3WJ5A 1NQ2A 3KFCA 4N8RA 4OEYA 4WHGA 2NW4A 1XPCA 4OZRE 2GPPA 2B23A 3CDPA 2AMAA 3D57A 4UDAA 2VV0A 4J5XC 5DP0A 5DXRA 3VT7A 2AYRA 2ZLAA 5DWEA 3G0WA 1I37A 1R1KA 1DKFB 2G5OA 1QKMA 4TUZA 5DMCA 4MG7B 5DWLA 3A9EB 4QK4A 1XQ3A 4F9MA 4PP5A 1IE9A 1VJBA 2Z4JA 3PEQA 5KCTA 1RJKA 1YYEA 3KMGA 3OSWA 4TV1A 3A2HA 3D24A 3VT9A 4OZTU 1T65A 5EJVA 5AK2A 4TUZB 3EYBA 3B3KA 4WHFA 3D5FA 1PQCA 2P15A 3W0AA 3WJ4A 3A78A 4A4WA 5HCVA 2ABIA 2PKLA 3WTQA 3OZ0A 2Q70A 2ZK5A 5DSHA 3UP0A 4IV4A 5KRLA 1HG4A 1XDKA 3AZ1A 1K7LA 3KDTA 3FC6A 2GIUA 1YA3A 2HCDA 3B5RA 1XNXA 2AX9A 4G1DA 2B1ZA 3HVLA 4OGHA 3PLZA 4OEZA 4IWCA 1DB1A 5DRMA 3IXPA 5CJ6A 2VV2A 5EGVA 4OKXA 3WMHA
chains in the Genus database with same CATH superfamily
2QGTA 3AN3A 5AWKA 2YHDA 3TX7B 2PIVA 2XKWA 2XYXA 5G5WA 1UPVA 4S0SA 5G3JA 3S9SA 1M2ZA 1XDKB 3FS1A 4R2UA 1XVPB 1KNUA 3FC6B 4MG9A 3MNPA 3FALA 3SP9A 4ZI1A 2Q7LA 1T74A 4REEA 4WPFA 3W5PA 3X1HA 2PNUA 3OS9A 1RKHA 2AAXA 5AYGA 4OJ9A 2QA6A 3VHWA 2ZK2A 4OIUA 4XUHA 3OKHA 1RDTA 1FBYA 3E7CA 4MG9B 5EHJA 3OLLA 3B68A 3FALB 1N4HA 2ZMHA 4OFUA 3CS8A 4QE6A 5FQTA 1KKQA 5KCWA 4XTAA 4CI5A 1K74A 3RLJA 1N46A 2OVHA 2IOKA 3CTBA 3OS8C 5DL4A 3IXPD 1T76A 3VT5A 2HB7A 2AM9A 1L2JA 4R6SA 5E0WA 5GIDA 4RWVA 2PRGA 4P6WA 2Q1VA 3DY6A 3PBAA 3ET1A 4LTWA 3VJTA 3WWRA 5APKA 3UU7A 5GIEA 3VT8A 2ZXZA 1ILHA 3WFFA 1NHZA 3CQVA 3VRWA 3RUTA 2FVJA 3KBAA 3KMZA 4LNWA 1ZDTA 5KR9A 3GWSX 4G20A 4N1YA 4S14A 2HWQA 3F5CA 2VSTA 5FQVA 2YLPA 1PQ6A 3B65A 5DZ3A 1T7MA 4Q0AC 1ZEOA 3UU7B 5FQRA 3OLFA 4J5WC 3W0IA 1XB7A 4IA2A 3VJHA 4MGCA 3L0LA 5DIDA 3RVFA 1I7IA 1K74D 1NDEA 2NXXA 3OKIA 1G2NA 4UDDA 2NPAA 3R8AA 3U9QA 1S9PA 5KRHA 1NQ7A 3F5CB 2AO6A 2QR9A 4ITFA 4JYIA 4Q13A 4ZOMA 3X1IA 3AFRA 3MNOA 1E3GA 2AB2A 2AMBA 1S9QA 2O4RA 2Q8SA 4WVDA 5KRKA 1PRGA 1T5ZA 3G8IA 2YLOA 3OOFA 4XLDA 4PWLA 2P1VA 1T7FA 2ZK1A 1ZUCA 4LSJA 2PIWA 5DTVA 3L0EA 2AXAA 3AZ3A 1X7RA 4RZGA 5JI0D 5SYZA 5G45A 3OMOA 4OZRU 3V4AA 3VTBA 5KROA 2XHSA 4MGDA 4IS8A 5C4SA 2YATA 5HYKA 2R6WA 5KCEA 2BJ4A 2ZK6A 4RMEA 3V3QA 3WT5A 5L11A 4RUOX 3TY0A 4A4VA 2F4BA 1FM9A 3OMQA 1Z5XE 3ZR7A 2ZLCA 3AURA 4DK8A 4XAOA 2JF9A 1EREA 4J5XA 4RUPA 4RZEA 5DV8A 3E00A 5C4TA 3L3XA 2POBA 4ZO1X 4OARA 1NRLA 5LWPA 2GPVA 2ZKCA 1XJ7A 3IPQA 4G2HA 2J7XA 2J7YA 5KCFA 1GWRA 2HFPA 4MGDB 2V0VA 4OLMA 2QA8A 1SQNA 2ACLA 3AZ2A 2BJ4B 5KRAA 3VJSA 4N73A 5DUEA 2Q7KA 5DX3B 5ACCA 2G44A 2B1VA 2V7CA 3B67A 2EWPA 2OZ7A 3A9EA 5ICKA 5L7HA 3V9TA 2O9IA 1PZLA 2GPUA 5APHA 3BQDA 3DZYA 5HZCA 2IHQA 3OMMA 4FHHA 1TFCA 1S0ZA 1NUOA 2HC4A 2ACLB 2QA8B 2ZMIA 3AX8A 3A2JA 4CSJA 4PRGA 5HYRA 4OKBA 1XAPA 2R6YA 1FM9D 5DLRA 1I7GA 4WLBA 3ET0A 2GL8A 5KCUA 3E00D 2Q5GA 2A3IA 2HB8A 1I38A 3B0QA 2GP7A 3O1DA 3ADWA 5AZVA 2VV1A 4CI4A 1XIUA 3SP6A 2Q6SA 3M7RA 1X7BA 2B50A 3ADVA 2YLYA 2P1TA 1XZXX 4JAZA 1UPWA 2Q1HA 3FEIA 2ZK0A 3CS6A 3GWXA 3VT3A 4NY9A 2ZK3A 4MG6A 1ERRA 4K4JA 5AWJA 5KRFA 5I4VA 1HJ1A 3HODA 3CLDA 2VV1B 3DZYD 5DXMA 3P88A 4DOSA 3LBDA 1MV9A 2O4JA 2QABA 3PRGA 2ZBSA 5EI1A 5KCDA 2QXMA 2REWA 3FURA 1XVPA 2QNVA 5EC9A 5IAWA 2G0HA 2ZNNA 2ZL9A 5DWJA 5DZ1A 3R29A 3DZUD 3SZ1A 5E14A 1RKGA 2VSRA 1Y9RA 5DU5A 3W0HA 4DK7A 5L7GA 2HASA 4PLEA 1LBDA 3RY9A 4MG8A 2Q6RA 5DXPA 3OSAA 3IPUA 5DXQA 5DKGA 3OS8A 4MGBA 4E4QA 2H79A 5DMFA 2GPOA 3TKCA 3WT7A 2QW4A 5AAVA 4JL4A 3R8IA 2ATHA 4OC7A 4OH6A 3KPZA 3ADUA 3ADXA 2HVCA 3QT0A 3HLVA 3WFGA 4MG8B 5E0XA 1T73A 2ZVTA 3NSPA 3OLSA 4RMCA 2HAMA 2NV7A 1PDUA 1X7EA 1M7WA 4K7AA 2BAWA 2IOGA 4MGBB 3FLIA 3OGTA 3ERDA 4RZFA 5AAVB 1P8DA 3ZRAA 1FM6A 2OM9A 4E2JA 3L3ZA 2AX7A 4OZTE 1TXIA 1ILGA 3CJWA 3ADSA 2W8YA 1G5YA 4S15A 3AUQA 1OVLA 3X36A 3ZQTA 1LV2A 3Q95A 4A2JA 1YY4A 2ZMJA 5JJMA 1ZGYA 2AWHA 3DT3A 1G50A 1NAVA 1T79A 1U3SA 1Y0XX 3GD2A 3B66A 2OUZA 1XLSA 2FAIA 5L7EA 4J24A 1EXAA 2QGWA 4RAKA 1OVLB 1YUCA 5DV6A 3Q95B 3W5TA 5JJMB 5FQSA 3G8OA 4PXMA 4QL8A 4PPSA 1XOWA 1R20A 3TKMA 4DORA 4ZNTA 1Z5XU 2HARA 3GBKA 5DZHA 5A86A 5DVVA 3WGPA 4ONIA 1FM6D 3G9EA 4JYHA 4IA1A 1GWXA 2Z4BA 3AN4A 2Q59A 2ZFXA 4K6IA 3W0JA 3X31A 5KYJA 2PINA 3VHVA 1Y0SA 3BEJA 1P93A 3JZBA 3OZJA 5G46A 3VN2A 3VSOA 2P4YA 1PK5A 5LGAA 3OMKA 5AVLA 2QZOB 1FD0A 4OHAA 5ETHA 2OCFA 4XI3A 4E4KA 4OKTA 3E94A 3KYTA 4IA7A 1X76A 2VV4A 1QKTA 4L96A 2ZY0A 2Q59B 2J14A 3L0JA 3VHUA 4IU7A 5DXGA 1YJEA 4RMDA 5DX3A 1QKUA 5K13A 3W0CA 4DMAA 5DY8A 2QH6A 3HC6A 3VT4A 5E19A 3ZRBA 4LNXA 3GN8A 3UVVA 2XYJA 3IA6A 4OEAA 1R20D 4QJRA 4B7WA 1YOKA 5C4OA 5HJPA 5JY3A 2VV4B 5KCCA 1ZAFA 4APUA 4M8EA 5DVCA 1ZH7A 5IXKA 1YOWA 1SKXA 4Y29A 3NSQA 5AAUA 4IUIA 4NB6A 2QMVA 3PCUA 4OEDA 3VJIA 3P0UA 3UVVB 2AA2A 1NQ1A 3H52A 4M8HA 4PLDA 5HJPB 2QSEA 2G0GA 3ET2A 3PO9A 1NQ0A 3HO0A 2PIQA 1NAXA 4IVYA 1IE8A 4ZNVA 5DWGA 2HBHA 2OAXA 4X1GA 3V3EA 3D6DA 2R40A 3K22A 4ZN9A 3ERTA 3DZUA 1GWQA 3N00A 4ZNSA 3HC5A 4YNKA 3VRVA 4Q50A 4N5GA 4UDCA 2ZASA 1YP0A 4FGYA 3VT6A 4POJA 2PIRA 1XP6A 1T7TA 1OT7A 2JFAB 2LBDA 1KV6A 5KD9A 5KRCA 3UP3A 4OJ4A 4IV2A 4OIVA 3W5RA 5DIEA 3P89A 1K4WA 2P7ZA 5DI7A 3V9YA 1GS4A 3W5QA 3DCTA 3HQ5A 2NXXE 3R5MA 4UDBA 4REFA 4DM8A 4ZO1B 3KDUA 1A28A 3D90A 1MVCA 4MGAA 2Q5SA 4G1YA 3VI8A 3VSPA 1XV9A 5DV3A 1OSVA 4RE8A 3JZCA 2R40D 3OSIA 2H77A 5APJA 4EMAA 5DKBA 4PVUA 4BCRA 2I4PA 1PCGA 2FSZA 4FN9A 5GT4A 4IA3A 1UOMA 2ZNPA 1XP9A 3GYUA 5C4UA 1T7RA 2I4ZA 3V49A 4YPQA 4MGAB 2XYWA 3LMPA 3B0TA 3FUGA 4FHIA 1XV9B 4KZMA 5AZTA 4PF3A 2AA7A 5B5BA 3R2AA 3VRUA 3VRTA 4OJBA 1U3RA 5E1CA 5KRMA 4MDDA 4TV1B 2ZXNA 2YJDA 3L03A 1XP1A 5DYBA 2P7GA 3T03A 3W0GA 5DUHA 3A3ZX 4ZJRA 2GTKA 3HZFA 3RLLA 2OVMA 3ILZA 1R1KD 2QTUA 3B0WA 3VTCA 4ZNHA 4L98A 5EITA 2P54A 5DUGA 2PITA 4JGVA 5DZIA 5F9BA 2JJ3A 4G21A 3H0AA 5DRJA 5HJSA 2Q7JA 4X1FA 4J5WA 3VTDA 2QE4A 4WQPA 2POGA 1S0XA 3K23A 4OK1A 1FCYA 2I0GA 2Q61A 4YMQA 1UHLA 4NUFA 3R8DA 4XT9A 5AVIA 3IMYA 1H9UA 4IW6A 2Q7IA 2QPYA 5IZ0A 3KMRA 4DQMA 4ZNWA 4G1ZA 2PIOA 5DK9A 1QKNA 5E7VA 4P6XA 1E3KA 4ZN7A 3WT6A 2YLQA 3FEJA 3F7DA 3K8SA 3OAPA 4XHDA 1XQCA 1SJ0A 3R5NA 4RUJA 1FCZA 1UHLB 1ZKYA 2PIUA 3MNEA 2QZOA 1ZDUA 3L1BA 2Q5PA 3NOAA 4IW8A 3UUCA 4NQAB 1M13A 4JYGA 3H0AD 2ZNQA 4R06A 2P7AA 5DXKA 4HLWA 5H1EA 3OMPA 5FQPA 5G43A 1YMTA 4LBDA 2I4JA 3B1MA 2PIXA 1A52A 4G2IA 1L2IA 3P8XA 3V9VA 3UUAA 4ITEA 1Z95A 2HWRA 1SR7A 3ET3A 2Q6JA 3FXVA 2ZXMA 4PPPA 2PIPL 4OH5A 5DXEA 5B41A 1X78A 4RFWA 4PP3A 5KYAA 1RDTD 1U3QA 1EXXA 3KWYA 1RK3A 3OOKA 2P1UA 4ZNUA 1R6GA 2Q60A 1YIMA 3B0RA 5G44A 3UUAB 1BSXA 4KZIA 2VV3A 1NYXA 3AUNA 1N83A 3DR1A 4EM9A 1G1UA 4QM0A 5DKSA 4DM6A 5KRIA 4IQRA 4MG5A 5KRJA 2AA5A 4S0TA 4XUMA 2YJAB 3DCUA 1S19A 1YINA 1PQ9A 2Q3YA 2J4AA 4ZJWA 3BC5A 2I0JA 5DYDA 4NIEA 3CS4A 2AX6A 4QE8A 1R5KA 2ZNOA 4O8FA 5DWIA 5GICA 4OKWA 5G42A 2GWXA 3A2IA 1XNNA 3W0YA 4POHA 5M96A 2PJLA 4OILA 1OSHA 3ADTA 4HEEX 3A40X 3UUDA 4OFRA 5DXBA 2JFAA 5E15A 3GZ9A 5DKEA 1MZNA 3CWDA 5DIGA 4YT1A 5DVSA 3RUUA 4J26A 4IWFA 2ZK4A 1FCXA 1X7JA 2AX8A 1T63A 1U9EA 4IVWA 1XLSE 3HM1A 5DZ0A 1WM0X 2E2RA 3CDSA 3K6PA 2YFEA 4FNEA 3GYTA 1DKFA 2AA6A 2QXSA 4KZJA 3O1EA 4MG7A 4PP6A 1Q4XA 3IPSA 5DXBB 3UUDB 3WJ5A 1NQ2A 3KFCA 4N8RA 4OEYA 4WHGA 2NW4A 1XPCA 4OZRE 2GPPA 2B23A 3CDPA 2AMAA 3D57A 4UDAA 2VV0A 4J5XC 5DP0A 5DXRA 3VT7A 2AYRA 2ZLAA 5DWEA 3G0WA 1I37A 1R1KA 1DKFB 2G5OA 1QKMA 4TUZA 5DMCA 4MG7B 5DWLA 3A9EB 4QK4A 1XQ3A 4F9MA 4PP5A 1IE9A 1VJBA 2Z4JA 3PEQA 5KCTA 1RJKA 1YYEA 3KMGA 3OSWA 4TV1A 3A2HA 3D24A 3VT9A 4OZTU 1T65A 5EJVA 5AK2A 4TUZB 3EYBA 3B3KA 4WHFA 3D5FA 1PQCA 2P15A 3W0AA 3WJ4A 3A78A 4A4WA 5HCVA 2ABIA 2PKLA 3WTQA 3OZ0A 2Q70A 2ZK5A 5DSHA 3UP0A 4IV4A 5KRLA 1HG4A 1XDKA 3AZ1A 1K7LA 3KDTA 3FC6A 2GIUA 1YA3A 2HCDA 3B5RA 1XNXA 2AX9A 4G1DA 2B1ZA 3HVLA 4OGHA 3PLZA 4OEZA 4IWCA 1DB1A 5DRMA 3IXPA 5CJ6A 2VV2A 5EGVA 4OKXA 3WMHA
chains in the Genus database with same CATH topology
2QGTA 3AN3A 5AWKA 2YHDA 3TX7B 2PIVA 2XKWA 2XYXA 5G5WA 1UPVA 4S0SA 5G3JA 3S9SA 1M2ZA 1XDKB 3FS1A 4R2UA 1XVPB 1KNUA 3FC6B 4MG9A 3MNPA 3FALA 3SP9A 4ZI1A 2Q7LA 1T74A 4REEA 4WPFA 3W5PA 3X1HA 2PNUA 3OS9A 1RKHA 2AAXA 5AYGA 4OJ9A 2QA6A 3VHWA 2ZK2A 4OIUA 4XUHA 3OKHA 1RDTA 1FBYA 3E7CA 4MG9B 5EHJA 3OLLA 3B68A 3FALB 1N4HA 2ZMHA 4OFUA 3CS8A 4QE6A 5FQTA 1KKQA 5KCWA 4XTAA 4CI5A 1K74A 3RLJA 1N46A 2OVHA 2IOKA 3CTBA 3OS8C 5DL4A 3IXPD 1T76A 3VT5A 2HB7A 2AM9A 1L2JA 4R6SA 5E0WA 5GIDA 4RWVA 2PRGA 4P6WA 2Q1VA 3DY6A 3PBAA 3ET1A 4LTWA 3VJTA 3WWRA 5APKA 3UU7A 5GIEA 3VT8A 2ZXZA 1ILHA 3WFFA 1NHZA 3CQVA 3VRWA 3RUTA 2FVJA 3KBAA 3KMZA 4LNWA 1ZDTA 5KR9A 3GWSX 4G20A 4N1YA 4S14A 2HWQA 3F5CA 2VSTA 5FQVA 2YLPA 1PQ6A 3B65A 5DZ3A 1T7MA 4Q0AC 1ZEOA 3UU7B 5FQRA 3OLFA 4J5WC 3W0IA 1XB7A 4IA2A 3VJHA 4MGCA 3L0LA 5DIDA 3RVFA 1I7IA 1K74D 1NDEA 2NXXA 3OKIA 1G2NA 4UDDA 2NPAA 3R8AA 3U9QA 1S9PA 5KRHA 1NQ7A 3F5CB 2AO6A 2QR9A 4ITFA 4JYIA 4Q13A 4ZOMA 3X1IA 3AFRA 3MNOA 1E3GA 2AB2A 2AMBA 1S9QA 2O4RA 2Q8SA 4WVDA 5KRKA 1PRGA 1T5ZA 3G8IA 2YLOA 3OOFA 4XLDA 4PWLA 2P1VA 1T7FA 2ZK1A 1ZUCA 4LSJA 2PIWA 5DTVA 3L0EA 2AXAA 3AZ3A 1X7RA 4RZGA 5JI0D 5SYZA 5G45A 3OMOA 4OZRU 3V4AA 3VTBA 5KROA 2XHSA 4MGDA 4IS8A 5C4SA 2YATA 5HYKA 2R6WA 5KCEA 2BJ4A 2ZK6A 4RMEA 3V3QA 3WT5A 5L11A 4RUOX 3TY0A 4A4VA 2F4BA 1FM9A 3OMQA 1Z5XE 3ZR7A 2ZLCA 3AURA 4DK8A 4XAOA 2JF9A 1EREA 4J5XA 4RUPA 4RZEA 5DV8A 3E00A 5C4TA 3L3XA 2POBA 4ZO1X 4OARA 1NRLA 5LWPA 2GPVA 2ZKCA 1XJ7A 3IPQA 4G2HA 2J7XA 2J7YA 5KCFA 1GWRA 2HFPA 4MGDB 2V0VA 4OLMA 2QA8A 1SQNA 2ACLA 3AZ2A 2BJ4B 5KRAA 3VJSA 4N73A 5DUEA 2Q7KA 5DX3B 5ACCA 2G44A 2B1VA 2V7CA 3B67A 2EWPA 2OZ7A 3A9EA 5ICKA 5L7HA 3V9TA 2O9IA 1PZLA 2GPUA 5APHA 3BQDA 3DZYA 5HZCA 2IHQA 3OMMA 4FHHA 1TFCA 1S0ZA 1NUOA 2HC4A 2ACLB 2QA8B 2ZMIA 3AX8A 3A2JA 4CSJA 4PRGA 5HYRA 4OKBA 1XAPA 2R6YA 1FM9D 5DLRA 1I7GA 4WLBA 3ET0A 2GL8A 5KCUA 3E00D 2Q5GA 2A3IA 2HB8A 1I38A 3B0QA 2GP7A 3O1DA 3ADWA 5AZVA 2VV1A 4CI4A 1XIUA 3SP6A 2Q6SA 3M7RA 1X7BA 2B50A 3ADVA 2YLYA 2P1TA 1XZXX 4JAZA 1UPWA 2Q1HA 3FEIA 2ZK0A 3CS6A 3GWXA 3VT3A 4NY9A 2ZK3A 4MG6A 1ERRA 4K4JA 5AWJA 5KRFA 5I4VA 1HJ1A 3HODA 3CLDA 2VV1B 3DZYD 5DXMA 3P88A 4DOSA 3LBDA 1MV9A 2O4JA 2QABA 3PRGA 2ZBSA 5EI1A 5KCDA 2QXMA 2REWA 3FURA 1XVPA 2QNVA 5EC9A 5IAWA 2G0HA 2ZNNA 2ZL9A 5DWJA 5DZ1A 3R29A 3DZUD 3SZ1A 5E14A 1RKGA 2VSRA 1Y9RA 5DU5A 3W0HA 4DK7A 5L7GA 2HASA 4PLEA 1LBDA 3RY9A 4MG8A 2Q6RA 5DXPA 3OSAA 3IPUA 5DXQA 5DKGA 3OS8A 4MGBA 4E4QA 2H79A 5DMFA 2GPOA 3TKCA 3WT7A 2QW4A 5AAVA 4JL4A 3R8IA 2ATHA 4OC7A 4OH6A 3KPZA 3ADUA 3ADXA 2HVCA 3QT0A 3HLVA 3WFGA 4MG8B 5E0XA 1T73A 2ZVTA 3NSPA 3OLSA 4RMCA 2HAMA 2NV7A 1PDUA 1X7EA 1M7WA 4K7AA 2BAWA 2IOGA 4MGBB 3FLIA 3OGTA 3ERDA 4RZFA 5AAVB 1P8DA 3ZRAA 1FM6A 2OM9A 4E2JA 3L3ZA 2AX7A 4OZTE 1TXIA 1ILGA 3CJWA 3ADSA 2W8YA 1G5YA 4S15A 3AUQA 1OVLA 3X36A 3ZQTA 1LV2A 3Q95A 4A2JA 1YY4A 2ZMJA 5JJMA 1ZGYA 2AWHA 3DT3A 1G50A 1NAVA 1T79A 1U3SA 1Y0XX 3GD2A 3B66A 2OUZA 1XLSA 2FAIA 5L7EA 4J24A 1EXAA 2QGWA 4RAKA 1OVLB 1YUCA 5DV6A 3Q95B 3W5TA 5JJMB 5FQSA 3G8OA 4PXMA 4QL8A 4PPSA 1XOWA 1R20A 3TKMA 4DORA 4ZNTA 1Z5XU 2HARA 3GBKA 5DZHA 5A86A 5DVVA 3WGPA 4ONIA 1FM6D 3G9EA 4JYHA 4IA1A 1GWXA 2Z4BA 3AN4A 2Q59A 2ZFXA 4K6IA 3W0JA 3X31A 5KYJA 2PINA 3VHVA 1Y0SA 3BEJA 1P93A 3JZBA 3OZJA 5G46A 3VN2A 3VSOA 2P4YA 1PK5A 5LGAA 3OMKA 5AVLA 2QZOB 1FD0A 4OHAA 5ETHA 2OCFA 4XI3A 4E4KA 4OKTA 3E94A 3KYTA 4IA7A 1X76A 2VV4A 1QKTA 4L96A 2ZY0A 2Q59B 2J14A 3L0JA 3VHUA 4IU7A 5DXGA 1YJEA 4RMDA 5DX3A 1QKUA 5K13A 3W0CA 4DMAA 5DY8A 2QH6A 3HC6A 3VT4A 5E19A 3ZRBA 4LNXA 3GN8A 3UVVA 2XYJA 3IA6A 4OEAA 1R20D 4QJRA 4B7WA 1YOKA 5C4OA 5HJPA 5JY3A 2VV4B 5KCCA 1ZAFA 4APUA 4M8EA 5DVCA 1ZH7A 5IXKA 1YOWA 1SKXA 4Y29A 3NSQA 5AAUA 4IUIA 4NB6A 2QMVA 3PCUA 4OEDA 3VJIA 3P0UA 3UVVB 2AA2A 1NQ1A 3H52A 4M8HA 4PLDA 5HJPB 2QSEA 2G0GA 3ET2A 3PO9A 1NQ0A 3HO0A 2PIQA 1NAXA 4IVYA 1IE8A 4ZNVA 5DWGA 2HBHA 2OAXA 4X1GA 3V3EA 3D6DA 2R40A 3K22A 4ZN9A 3ERTA 3DZUA 1GWQA 3N00A 4ZNSA 3HC5A 4YNKA 3VRVA 4Q50A 4N5GA 4UDCA 2ZASA 1YP0A 4FGYA 3VT6A 4POJA 2PIRA 1XP6A 1T7TA 1OT7A 2JFAB 2LBDA 1KV6A 5KD9A 5KRCA 3UP3A 4OJ4A 4IV2A 4OIVA 3W5RA 5DIEA 3P89A 1K4WA 2P7ZA 5DI7A 3V9YA 1GS4A 3W5QA 3DCTA 3HQ5A 2NXXE 3R5MA 4UDBA 4REFA 4DM8A 4ZO1B 3KDUA 1A28A 3D90A 1MVCA 4MGAA 2Q5SA 4G1YA 3VI8A 3VSPA 1XV9A 5DV3A 1OSVA 4RE8A 3JZCA 2R40D 3OSIA 2H77A 5APJA 4EMAA 5DKBA 4PVUA 4BCRA 2I4PA 1PCGA 2FSZA 4FN9A 5GT4A 4IA3A 1UOMA 2ZNPA 1XP9A 3GYUA 5C4UA 1T7RA 2I4ZA 3V49A 4YPQA 4MGAB 2XYWA 3LMPA 3B0TA 3FUGA 4FHIA 1XV9B 4KZMA 5AZTA 4PF3A 2AA7A 5B5BA 3R2AA 3VRUA 3VRTA 4OJBA 1U3RA 5E1CA 5KRMA 4MDDA 4TV1B 2ZXNA 2YJDA 3L03A 1XP1A 5DYBA 2P7GA 3T03A 3W0GA 5DUHA 3A3ZX 4ZJRA 2GTKA 3HZFA 3RLLA 2OVMA 3ILZA 1R1KD 2QTUA 3B0WA 3VTCA 4ZNHA 4L98A 5EITA 2P54A 5DUGA 2PITA 4JGVA 5DZIA 5F9BA 2JJ3A 4G21A 3H0AA 5DRJA 5HJSA 2Q7JA 4X1FA 4J5WA 3VTDA 2QE4A 4WQPA 2POGA 1S0XA 3K23A 4OK1A 1FCYA 2I0GA 2Q61A 4YMQA 1UHLA 4NUFA 3R8DA 4XT9A 5AVIA 3IMYA 1H9UA 4IW6A 2Q7IA 2QPYA 5IZ0A 3KMRA 4DQMA 4ZNWA 4G1ZA 2PIOA 5DK9A 1QKNA 5E7VA 4P6XA 1E3KA 4ZN7A 3WT6A 2YLQA 3FEJA 3F7DA 3K8SA 3OAPA 4XHDA 1XQCA 1SJ0A 3R5NA 4RUJA 1FCZA 1UHLB 1ZKYA 2PIUA 3MNEA 2QZOA 1ZDUA 3L1BA 2Q5PA 3NOAA 4IW8A 3UUCA 4NQAB 1M13A 4JYGA 3H0AD 2ZNQA 4R06A 2P7AA 5DXKA 4HLWA 5H1EA 3OMPA 5FQPA 5G43A 1YMTA 4LBDA 2I4JA 3B1MA 2PIXA 1A52A 4G2IA 1L2IA 3P8XA 3V9VA 3UUAA 4ITEA 1Z95A 2HWRA 1SR7A 3ET3A 2Q6JA 3FXVA 2ZXMA 4PPPA 2PIPL 4OH5A 5DXEA 5B41A 1X78A 4RFWA 4PP3A 5KYAA 1RDTD 1U3QA 1EXXA 3KWYA 1RK3A 3OOKA 2P1UA 4ZNUA 1R6GA 2Q60A 1YIMA 3B0RA 5G44A 3UUAB 1BSXA 4KZIA 2VV3A 1NYXA 3AUNA 1N83A 3DR1A 4EM9A 1G1UA 4QM0A 5DKSA 4DM6A 5KRIA 4IQRA 4MG5A 5KRJA 2AA5A 4S0TA 4XUMA 2YJAB 3DCUA 1S19A 1YINA 1PQ9A 2Q3YA 2J4AA 4ZJWA 3BC5A 2I0JA 5DYDA 4NIEA 3CS4A 2AX6A 4QE8A 1R5KA 2ZNOA 4O8FA 5DWIA 5GICA 4OKWA 5G42A 2GWXA 3A2IA 1XNNA 3W0YA 4POHA 5M96A 2PJLA 4OILA 1OSHA 3ADTA 4HEEX 3A40X 3UUDA 4OFRA 5DXBA 2JFAA 5E15A 3GZ9A 5DKEA 1MZNA 3CWDA 5DIGA 4YT1A 5DVSA 3RUUA 4J26A 4IWFA 2ZK4A 1FCXA 1X7JA 2AX8A 1T63A 1U9EA 4IVWA 1XLSE 3HM1A 5DZ0A 1WM0X 2E2RA 3CDSA 3K6PA 2YFEA 4FNEA 3GYTA 1DKFA 2AA6A 2QXSA 4KZJA 3O1EA 4MG7A 4PP6A 1Q4XA 3IPSA 5DXBB 3UUDB 3WJ5A 1NQ2A 3KFCA 4N8RA 4OEYA 4WHGA 2NW4A 1XPCA 4OZRE 2GPPA 2B23A 3CDPA 2AMAA 3D57A 4UDAA 2VV0A 4J5XC 5DP0A 5DXRA 3VT7A 2AYRA 2ZLAA 5DWEA 3G0WA 1I37A 1R1KA 1DKFB 2G5OA 1QKMA 4TUZA 5DMCA 4MG7B 5DWLA 3A9EB 4QK4A 1XQ3A 4F9MA 4PP5A 1IE9A 1VJBA 2Z4JA 3PEQA 5KCTA 1RJKA 1YYEA 3KMGA 3OSWA 4TV1A 3A2HA 3D24A 3VT9A 4OZTU 1T65A 5EJVA 5AK2A 4TUZB 3EYBA 3B3KA 4WHFA 3D5FA 1PQCA 2P15A 3W0AA 3WJ4A 3A78A 4A4WA 5HCVA 2ABIA 2PKLA 3WTQA 3OZ0A 2Q70A 2ZK5A 5DSHA 3UP0A 4IV4A 5KRLA 1HG4A 1XDKA 3AZ1A 1K7LA 3KDTA 3FC6A 2GIUA 1YA3A 2HCDA 3B5RA 1XNXA 2AX9A 4G1DA 2B1ZA 3HVLA 4OGHA 3PLZA 4OEZA 4IWCA 1DB1A 5DRMA 3IXPA 5CJ6A 2VV2A 5EGVA 4OKXA 3WMHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QGT A;  3AN3 A;  5AWK A;  2YHD A;  3TX7 B;  2PIV A;  2XKW A;  2XYX A;  5G5W A;  1UPV A;  4S0S A;  5G3J A;  3S9S A;  1M2Z A;  1XDK B;  3FS1 A;  4R2U A;  1XVP B;  1KNU A;  3FC6 B;  4MG9 A;  3MNP A;  3FAL A;  3SP9 A;  4ZI1 A;  2Q7L A;  1T74 A;  4REE A;  4WPF A;  3W5P A;  3X1H A;  2PNU A;  3OS9 A;  1RKH A;  2AAX A;  5AYG A;  4OJ9 A;  2QA6 A;  3VHW A;  2ZK2 A;  4OIU A;  4XUH A;  3OKH A;  1RDT A;  1FBY A;  3E7C A;  4MG9 B;  5EHJ A;  3OLL A;  3B68 A;  3FAL B;  1N4H A;  2ZMH A;  4OFU A;  3CS8 A;  4QE6 A;  5FQT A;  1KKQ A;  5KCW A;  4XTA A;  4CI5 A;  1K74 A;  3RLJ A;  1N46 A;  2OVH A;  2IOK A;  3CTB A;  3OS8 C;  5DL4 A;  3IXP D;  1T76 A;  3VT5 A;  2HB7 A;  2AM9 A;  1L2J A;  4R6S A;  5E0W A;  5GID A;  4RWV A;  2PRG A;  4P6W A;  2Q1V A;  3DY6 A;  3PBA A;  3ET1 A;  4LTW A;  3VJT A;  3WWR A;  5APK A;  3UU7 A;  5GIE A;  3VT8 A;  2ZXZ A;  1ILH A;  3WFF A;  1NHZ A;  3CQV A;  3VRW A;  3RUT A;  2FVJ A;  3KBA A;  3KMZ A;  4LNW A;  1ZDT A;  5KR9 A;  3GWS X;  4G20 A;  4N1Y A;  4S14 A;  2HWQ A;  3F5C A;  2VST A;  5FQV A;  2YLP A;  1PQ6 A;  3B65 A;  5DZ3 A;  1T7M A;  4Q0A C;  1ZEO A;  3UU7 B;  5FQR A;  3OLF A;  4J5W C;  3W0I A;  1XB7 A;  4IA2 A;  3VJH A;  4MGC A;  3L0L A;  5DID A;  3RVF A;  1I7I A;  1K74 D;  1NDE A;  2NXX A;  3OKI A;  1G2N A;  4UDD A;  2NPA A;  3R8A A;  3U9Q A;  1S9P A;  5KRH A;  1NQ7 A;  3F5C B;  2AO6 A;  2QR9 A;  4ITF A;  4JYI A;  4Q13 A;  4ZOM A;  3X1I A;  3AFR A;  3MNO A;  1E3G A;  2AB2 A;  2AMB A;  1S9Q A;  2O4R A;  2Q8S A;  4WVD A;  5KRK A;  1PRG A;  1T5Z A;  3G8I A;  2YLO A;  3OOF A;  4XLD A;  4PWL A;  2P1V A;  1T7F A;  2ZK1 A;  1ZUC A;  4LSJ A;  2PIW A;  5DTV A;  3L0E A;  2AXA A;  3AZ3 A;  1X7R A;  4RZG A;  5JI0 D;  5SYZ A;  5G45 A;  3OMO A;  4OZR U;  3V4A A;  3VTB A;  5KRO A;  2XHS A;  4MGD A;  4IS8 A;  5C4S A;  2YAT A;  5HYK A;  2R6W A;  5KCE A;  2BJ4 A;  2ZK6 A;  4RME A;  3V3Q A;  3WT5 A;  5L11 A;  4RUO X;  3TY0 A;  4A4V A;  2F4B A;  1FM9 A;  3OMQ A;  1Z5X E;  3ZR7 A;  2ZLC A;  3AUR A;  4DK8 A;  4XAO A;  2JF9 A;  1ERE A;  4J5X A;  4RUP A;  4RZE A;  5DV8 A;  3E00 A;  5C4T A;  3L3X A;  2POB A;  4ZO1 X;  4OAR A;  1NRL A;  5LWP A;  2GPV A;  2ZKC A;  1XJ7 A;  3IPQ A;  4G2H A;  2J7X A;  2J7Y A;  5KCF A;  1GWR A;  2HFP A;  4MGD B;  2V0V A;  4OLM A;  2QA8 A;  1SQN A;  2ACL A;  3AZ2 A;  2BJ4 B;  5KRA A;  3VJS A;  4N73 A;  5DUE A;  2Q7K A;  5DX3 B;  5ACC A;  2G44 A;  2B1V A;  2V7C A;  3B67 A;  2EWP A;  2OZ7 A;  3A9E A;  5ICK A;  5L7H A;  3V9T A;  2O9I A;  1PZL A;  2GPU A;  5APH A;  3BQD A;  3DZY A;  5HZC A;  2IHQ A;  3OMM A;  4FHH A;  1TFC A;  1S0Z A;  1NUO A;  2HC4 A;  2ACL B;  2QA8 B;  2ZMI A;  3AX8 A;  3A2J A;  4CSJ A;  4PRG A;  5HYR A;  4OKB A;  1XAP A;  2R6Y A;  1FM9 D;  5DLR A;  1I7G A;  4WLB A;  3ET0 A;  2GL8 A;  5KCU A;  3E00 D;  2Q5G A;  2A3I A;  2HB8 A;  1I38 A;  3B0Q A;  2GP7 A;  3O1D A;  3ADW A;  5AZV A;  2VV1 A;  4CI4 A;  1XIU A;  3SP6 A;  2Q6S A;  3M7R A;  1X7B A;  2B50 A;  3ADV A;  2YLY A;  2P1T A;  1XZX X;  4JAZ A;  1UPW A;  2Q1H A;  3FEI A;  2ZK0 A;  3CS6 A;  3GWX A;  3VT3 A;  4NY9 A;  2ZK3 A;  4MG6 A;  1ERR A;  4K4J A;  5AWJ A;  5KRF A;  5I4V A;  1HJ1 A;  3HOD A;  3CLD A;  2VV1 B;  3DZY D;  5DXM A;  3P88 A;  4DOS A;  3LBD A;  1MV9 A;  2O4J A;  2QAB A;  3PRG A;  2ZBS A;  5EI1 A;  5KCD A;  2QXM A;  2REW A;  3FUR A;  1XVP A;  2QNV A;  5EC9 A;  5IAW A;  2G0H A;  2ZNN A;  2ZL9 A;  5DWJ A;  5DZ1 A;  3R29 A;  3DZU D;  3SZ1 A;  5E14 A;  1RKG A;  2VSR A;  1Y9R A;  5DU5 A;  3W0H A;  4DK7 A;  5L7G A;  2HAS A;  4PLE A;  1LBD A;  3RY9 A;  4MG8 A;  2Q6R A;  5DXP A;  3OSA A;  3IPU A;  5DXQ A;  5DKG A;  3OS8 A;  4MGB A;  4E4Q A;  2H79 A;  5DMF A;  2GPO A;  3TKC A;  3WT7 A;  2QW4 A;  5AAV A;  4JL4 A;  3R8I A;  2ATH A;  4OC7 A;  4OH6 A;  3KPZ A;  3ADU A;  3ADX A;  2HVC A;  3QT0 A;  3HLV A;  3WFG A;  4MG8 B;  5E0X A;  1T73 A;  2ZVT A;  3NSP A;  3OLS A;  4RMC A;  2HAM A;  2NV7 A;  1PDU A;  1X7E A;  1M7W A;  4K7A A;  2BAW A;  2IOG A;  4MGB B;  3FLI A;  3OGT A;  3ERD A;  4RZF A;  5AAV B;  1P8D A;  3ZRA A;  1FM6 A;  2OM9 A;  4E2J A;  3L3Z A;  2AX7 A;  4OZT E;  1TXI A;  1ILG A;  3CJW A;  3ADS A;  2W8Y A;  1G5Y A;  4S15 A;  3AUQ A;  1OVL A;  3X36 A;  3ZQT A;  1LV2 A;  3Q95 A;  4A2J A;  1YY4 A;  2ZMJ A;  5JJM A;  1ZGY A;  2AWH A;  3DT3 A;  1G50 A;  1NAV A;  1T79 A;  1U3S A;  1Y0X X;  3GD2 A;  3B66 A;  2OUZ A;  1XLS A;  2FAI A;  5L7E A;  4J24 A;  1EXA A;  2QGW A;  4RAK A;  1OVL B;  1YUC A;  5DV6 A;  3Q95 B;  3W5T A;  5JJM B;  5FQS A;  3G8O A;  4PXM A;  4QL8 A;  4PPS A;  1XOW A;  1R20 A;  3TKM A;  4DOR A;  4ZNT A;  1Z5X U;  2HAR A;  3GBK A;  5DZH A;  5A86 A;  5DVV A;  3WGP A;  4ONI A;  1FM6 D;  3G9E A;  4JYH A;  4IA1 A;  1GWX A;  2Z4B A;  3AN4 A;  2Q59 A;  2ZFX A;  4K6I A;  3W0J A;  3X31 A;  5KYJ A;  2PIN A;  3VHV A;  1Y0S A;  3BEJ A;  1P93 A;  3JZB A;  3OZJ A;  5G46 A;  3VN2 A;  3VSO A;  2P4Y A;  1PK5 A;  5LGA A;  3OMK A;  5AVL A;  2QZO B;  1FD0 A;  4OHA A;  5ETH A;  2OCF A;  4XI3 A;  4E4K A;  4OKT A;  3E94 A;  3KYT A;  4IA7 A;  1X76 A;  2VV4 A;  1QKT A;  4L96 A;  2ZY0 A;  2Q59 B;  2J14 A;  3L0J A;  3VHU A;  4IU7 A;  5DXG A;  1YJE A;  4RMD A;  5DX3 A;  1QKU A;  5K13 A;  3W0C A;  4DMA A;  5DY8 A;  2QH6 A;  3HC6 A;  3VT4 A;  5E19 A;  3ZRB A;  4LNX A;  3GN8 A;  3UVV A;  2XYJ A;  3IA6 A;  4OEA A;  1R20 D;  4QJR A;  4B7W A;  1YOK A;  5C4O A;  5HJP A;  5JY3 A;  2VV4 B;  5KCC A;  1ZAF A;  4APU A;  4M8E A;  5DVC A;  1ZH7 A;  5IXK A;  1YOW A;  1SKX A;  4Y29 A;  3NSQ A;  5AAU A;  4IUI A;  4NB6 A;  2QMV A;  3PCU A;  4OED A;  3VJI A;  3P0U A;  3UVV B;  2AA2 A;  1NQ1 A;  3H52 A;  4M8H A;  4PLD A;  5HJP B;  2QSE A;  2G0G A;  3ET2 A;  3PO9 A;  1NQ0 A;  3HO0 A;  2PIQ A;  1NAX A;  4IVY A;  1IE8 A;  4ZNV A;  5DWG A;  2HBH A;  2OAX A;  4X1G A;  3V3E A;  3D6D A;  2R40 A;  3K22 A;  4ZN9 A;  3ERT A;  3DZU A;  1GWQ A;  3N00 A;  4ZNS A;  3HC5 A;  4YNK A;  3VRV A;  4Q50 A;  4N5G A;  4UDC A;  2ZAS A;  1YP0 A;  4FGY A;  3VT6 A;  4POJ A;  2PIR A;  1XP6 A;  1T7T A;  1OT7 A;  2JFA B;  2LBD A;  1KV6 A;  5KD9 A;  5KRC A;  3UP3 A;  4OJ4 A;  4IV2 A;  4OIV A;  3W5R A;  5DIE A;  3P89 A;  1K4W A;  2P7Z A;  5DI7 A;  3V9Y A;  1GS4 A;  3W5Q A;  3DCT A;  3HQ5 A;  2NXX E;  3R5M A;  4UDB A;  4REF A;  4DM8 A;  4ZO1 B;  3KDU A;  1A28 A;  3D90 A;  1MVC A;  4MGA A;  2Q5S A;  4G1Y A;  3VI8 A;  3VSP A;  1XV9 A;  5DV3 A;  1OSV A;  4RE8 A;  3JZC A;  2R40 D;  3OSI A;  2H77 A;  5APJ A;  4EMA A;  5DKB A;  4PVU A;  4BCR A;  2I4P A;  1PCG A;  2FSZ A;  4FN9 A;  5GT4 A;  4IA3 A;  1UOM A;  2ZNP A;  1XP9 A;  3GYU A;  5C4U A;  1T7R A;  2I4Z A;  3V49 A;  4YPQ A;  4MGA B;  2XYW A;  3LMP A;  3B0T A;  3FUG A;  4FHI A;  1XV9 B;  4KZM A;  5AZT A;  4PF3 A;  2AA7 A;  5B5B A;  3R2A A;  3VRU A;  3VRT A;  4OJB A;  1U3R A;  5E1C A;  5KRM A;  4MDD A;  4TV1 B;  2ZXN A;  2YJD A;  3L03 A;  1XP1 A;  5DYB A;  2P7G A;  3T03 A;  3W0G A;  5DUH A;  3A3Z X;  4ZJR A;  2GTK A;  3HZF A;  3RLL A;  2OVM A;  3ILZ A;  1R1K D;  2QTU A;  3B0W A;  3VTC A;  4ZNH A;  4L98 A;  5EIT A;  2P54 A;  5DUG A;  2PIT A;  4JGV A;  5DZI A;  5F9B A;  2JJ3 A;  4G21 A;  3H0A A;  5DRJ A;  5HJS A;  2Q7J A;  4X1F A;  4J5W A;  3VTD A;  2QE4 A;  4WQP A;  2POG A;  1S0X A;  3K23 A;  4OK1 A;  1FCY A;  2I0G A;  2Q61 A;  4YMQ A;  1UHL A;  4NUF A;  3R8D A;  4XT9 A;  5AVI A;  3IMY A;  1H9U A;  4IW6 A;  2Q7I A;  2QPY A;  5IZ0 A;  3KMR A;  4DQM A;  4ZNW A;  4G1Z A;  2PIO A;  5DK9 A;  1QKN A;  5E7V A;  4P6X A;  1E3K A;  4ZN7 A;  3WT6 A;  2YLQ A;  3FEJ A;  3F7D A;  3K8S A;  3OAP A;  4XHD A;  1XQC A;  1SJ0 A;  3R5N A;  4RUJ A;  1FCZ A;  1UHL B;  1ZKY A;  2PIU A;  3MNE A;  2QZO A;  1ZDU A;  3L1B A;  2Q5P A;  3NOA A;  4IW8 A;  3UUC A;  4NQA B;  1M13 A;  4JYG A;  3H0A D;  2ZNQ A;  4R06 A;  2P7A A;  5DXK A;  4HLW A;  5H1E A;  3OMP A;  5FQP A;  5G43 A;  1YMT A;  4LBD A;  2I4J A;  3B1M A;  2PIX A;  1A52 A;  4G2I A;  1L2I A;  3P8X A;  3V9V A;  3UUA A;  4ITE A;  1Z95 A;  2HWR A;  1SR7 A;  3ET3 A;  2Q6J A;  3FXV A;  2ZXM A;  4PPP A;  2PIP L;  4OH5 A;  5DXE A;  5B41 A;  1X78 A;  4RFW A;  4PP3 A;  5KYA A;  1RDT D;  1U3Q A;  1EXX A;  3KWY A;  1RK3 A;  3OOK A;  2P1U A;  4ZNU A;  1R6G A;  2Q60 A;  1YIM A;  3B0R A;  5G44 A;  3UUA B;  1BSX A;  4KZI A;  2VV3 A;  1NYX A;  3AUN A;  1N83 A;  3DR1 A;  4EM9 A;  1G1U A;  4QM0 A;  5DKS A;  4DM6 A;  5KRI A;  4IQR A;  4MG5 A;  5KRJ A;  2AA5 A;  4S0T A;  4XUM A;  2YJA B;  3DCU A;  1S19 A;  1YIN A;  1PQ9 A;  2Q3Y A;  2J4A A;  4ZJW A;  3BC5 A;  2I0J A;  5DYD A;  4NIE A;  3CS4 A;  2AX6 A;  4QE8 A;  1R5K A;  2ZNO A;  4O8F A;  5DWI A;  5GIC A;  4OKW A;  5G42 A;  2GWX A;  3A2I A;  1XNN A;  3W0Y A;  4POH A;  5M96 A;  2PJL A;  4OIL A;  1OSH A;  3ADT A;  4HEE X;  3A40 X;  3UUD A;  4OFR A;  5DXB A;  2JFA A;  5E15 A;  3GZ9 A;  5DKE A;  1MZN A;  3CWD A;  5DIG A;  4YT1 A;  5DVS A;  3RUU A;  4J26 A;  4IWF A;  2ZK4 A;  1FCX A;  1X7J A;  2AX8 A;  1T63 A;  1U9E A;  4IVW A;  1XLS E;  3HM1 A;  5DZ0 A;  1WM0 X;  2E2R A;  3CDS A;  3K6P A;  2YFE A;  4FNE A;  3GYT A;  1DKF A;  2AA6 A;  2QXS A;  4KZJ A;  3O1E A;  4MG7 A;  4PP6 A;  1Q4X A;  3IPS A;  5DXB B;  3UUD B;  3WJ5 A;  1NQ2 A;  3KFC A;  4N8R A;  4OEY A;  4WHG A;  2NW4 A;  1XPC A;  4OZR E;  2GPP A;  2B23 A;  3CDP A;  2AMA A;  3D57 A;  4UDA A;  2VV0 A;  4J5X C;  5DP0 A;  5DXR A;  3VT7 A;  2AYR A;  2ZLA A;  5DWE A;  3G0W A;  1I37 A;  1R1K A;  1DKF B;  2G5O A;  1QKM A;  4TUZ A;  5DMC A;  4MG7 B;  5DWL A;  3A9E B;  4QK4 A;  1XQ3 A;  4F9M A;  4PP5 A;  1IE9 A;  1VJB A;  2Z4J A;  3PEQ A;  5KCT A;  1RJK A;  1YYE A;  3KMG A;  3OSW A;  4TV1 A;  3A2H A;  3D24 A;  3VT9 A;  4OZT U;  1T65 A;  5EJV A;  5AK2 A;  4TUZ B;  3EYB A;  3B3K A;  4WHF A;  3D5F A;  1PQC A;  2P15 A;  3W0A A;  3WJ4 A;  3A78 A;  4A4W A;  5HCV A;  2ABI A;  2PKL A;  3WTQ A;  3OZ0 A;  2Q70 A;  2ZK5 A;  5DSH A;  3UP0 A;  4IV4 A;  5KRL A;  1HG4 A;  1XDK A;  3AZ1 A;  1K7L A;  3KDT A;  3FC6 A;  2GIU A;  1YA3 A;  2HCD A;  3B5R A;  1XNX A;  2AX9 A;  4G1D A;  2B1Z A;  3HVL A;  4OGH A;  3PLZ A;  4OEZ A;  4IWC A;  1DB1 A;  5DRM A;  3IXP A;  5CJ6 A;  2VV2 A;  5EGV A;  4OKX A;  3WMH A; 
#chains in the Genus database with same CATH topology
 2QGT A;  3AN3 A;  5AWK A;  2YHD A;  3TX7 B;  2PIV A;  2XKW A;  2XYX A;  5G5W A;  1UPV A;  4S0S A;  5G3J A;  3S9S A;  1M2Z A;  1XDK B;  3FS1 A;  4R2U A;  1XVP B;  1KNU A;  3FC6 B;  4MG9 A;  3MNP A;  3FAL A;  3SP9 A;  4ZI1 A;  2Q7L A;  1T74 A;  4REE A;  4WPF A;  3W5P A;  3X1H A;  2PNU A;  3OS9 A;  1RKH A;  2AAX A;  5AYG A;  4OJ9 A;  2QA6 A;  3VHW A;  2ZK2 A;  4OIU A;  4XUH A;  3OKH A;  1RDT A;  1FBY A;  3E7C A;  4MG9 B;  5EHJ A;  3OLL A;  3B68 A;  3FAL B;  1N4H A;  2ZMH A;  4OFU A;  3CS8 A;  4QE6 A;  5FQT A;  1KKQ A;  5KCW A;  4XTA A;  4CI5 A;  1K74 A;  3RLJ A;  1N46 A;  2OVH A;  2IOK A;  3CTB A;  3OS8 C;  5DL4 A;  3IXP D;  1T76 A;  3VT5 A;  2HB7 A;  2AM9 A;  1L2J A;  4R6S A;  5E0W A;  5GID A;  4RWV A;  2PRG A;  4P6W A;  2Q1V A;  3DY6 A;  3PBA A;  3ET1 A;  4LTW A;  3VJT A;  3WWR A;  5APK A;  3UU7 A;  5GIE A;  3VT8 A;  2ZXZ A;  1ILH A;  3WFF A;  1NHZ A;  3CQV A;  3VRW A;  3RUT A;  2FVJ A;  3KBA A;  3KMZ A;  4LNW A;  1ZDT A;  5KR9 A;  3GWS X;  4G20 A;  4N1Y A;  4S14 A;  2HWQ A;  3F5C A;  2VST A;  5FQV A;  2YLP A;  1PQ6 A;  3B65 A;  5DZ3 A;  1T7M A;  4Q0A C;  1ZEO A;  3UU7 B;  5FQR A;  3OLF A;  4J5W C;  3W0I A;  1XB7 A;  4IA2 A;  3VJH A;  4MGC A;  3L0L A;  5DID A;  3RVF A;  1I7I A;  1K74 D;  1NDE A;  2NXX A;  3OKI A;  1G2N A;  4UDD A;  2NPA A;  3R8A A;  3U9Q A;  1S9P A;  5KRH A;  1NQ7 A;  3F5C B;  2AO6 A;  2QR9 A;  4ITF A;  4JYI A;  4Q13 A;  4ZOM A;  3X1I A;  3AFR A;  3MNO A;  1E3G A;  2AB2 A;  2AMB A;  1S9Q A;  2O4R A;  2Q8S A;  4WVD A;  5KRK A;  1PRG A;  1T5Z A;  3G8I A;  2YLO A;  3OOF A;  4XLD A;  4PWL A;  2P1V A;  1T7F A;  2ZK1 A;  1ZUC A;  4LSJ A;  2PIW A;  5DTV A;  3L0E A;  2AXA A;  3AZ3 A;  1X7R A;  4RZG A;  5JI0 D;  5SYZ A;  5G45 A;  3OMO A;  4OZR U;  3V4A A;  3VTB A;  5KRO A;  2XHS A;  4MGD A;  4IS8 A;  5C4S A;  2YAT A;  5HYK A;  2R6W A;  5KCE A;  2BJ4 A;  2ZK6 A;  4RME A;  3V3Q A;  3WT5 A;  5L11 A;  4RUO X;  3TY0 A;  4A4V A;  2F4B A;  1FM9 A;  3OMQ A;  1Z5X E;  3ZR7 A;  2ZLC A;  3AUR A;  4DK8 A;  4XAO A;  2JF9 A;  1ERE A;  4J5X A;  4RUP A;  4RZE A;  5DV8 A;  3E00 A;  5C4T A;  3L3X A;  2POB A;  4ZO1 X;  4OAR A;  1NRL A;  5LWP A;  2GPV A;  2ZKC A;  1XJ7 A;  3IPQ A;  4G2H A;  2J7X A;  2J7Y A;  5KCF A;  1GWR A;  2HFP A;  4MGD B;  2V0V A;  4OLM A;  2QA8 A;  1SQN A;  2ACL A;  3AZ2 A;  2BJ4 B;  5KRA A;  3VJS A;  4N73 A;  5DUE A;  2Q7K A;  5DX3 B;  5ACC A;  2G44 A;  2B1V A;  2V7C A;  3B67 A;  2EWP A;  2OZ7 A;  3A9E A;  5ICK A;  5L7H A;  3V9T A;  2O9I A;  1PZL A;  2GPU A;  5APH A;  3BQD A;  3DZY A;  5HZC A;  2IHQ A;  3OMM A;  4FHH A;  1TFC A;  1S0Z A;  1NUO A;  2HC4 A;  2ACL B;  2QA8 B;  2ZMI A;  3AX8 A;  3A2J A;  4CSJ A;  4PRG A;  5HYR A;  4OKB A;  1XAP A;  2R6Y A;  1FM9 D;  5DLR A;  1I7G A;  4WLB A;  3ET0 A;  2GL8 A;  5KCU A;  3E00 D;  2Q5G A;  2A3I A;  2HB8 A;  1I38 A;  3B0Q A;  2GP7 A;  3O1D A;  3ADW A;  5AZV A;  2VV1 A;  4CI4 A;  1XIU A;  3SP6 A;  2Q6S A;  3M7R A;  1X7B A;  2B50 A;  3ADV A;  2YLY A;  2P1T A;  1XZX X;  4JAZ A;  1UPW A;  2Q1H A;  3FEI A;  2ZK0 A;  3CS6 A;  3GWX A;  3VT3 A;  4NY9 A;  2ZK3 A;  4MG6 A;  1ERR A;  4K4J A;  5AWJ A;  5KRF A;  5I4V A;  1HJ1 A;  3HOD A;  3CLD A;  2VV1 B;  3DZY D;  5DXM A;  3P88 A;  4DOS A;  3LBD A;  1MV9 A;  2O4J A;  2QAB A;  3PRG A;  2ZBS A;  5EI1 A;  5KCD A;  2QXM A;  2REW A;  3FUR A;  1XVP A;  2QNV A;  5EC9 A;  5IAW A;  2G0H A;  2ZNN A;  2ZL9 A;  5DWJ A;  5DZ1 A;  3R29 A;  3DZU D;  3SZ1 A;  5E14 A;  1RKG A;  2VSR A;  1Y9R A;  5DU5 A;  3W0H A;  4DK7 A;  5L7G A;  2HAS A;  4PLE A;  1LBD A;  3RY9 A;  4MG8 A;  2Q6R A;  5DXP A;  3OSA A;  3IPU A;  5DXQ A;  5DKG A;  3OS8 A;  4MGB A;  4E4Q A;  2H79 A;  5DMF A;  2GPO A;  3TKC A;  3WT7 A;  2QW4 A;  5AAV A;  4JL4 A;  3R8I A;  2ATH A;  4OC7 A;  4OH6 A;  3KPZ A;  3ADU A;  3ADX A;  2HVC A;  3QT0 A;  3HLV A;  3WFG A;  4MG8 B;  5E0X A;  1T73 A;  2ZVT A;  3NSP A;  3OLS A;  4RMC A;  2HAM A;  2NV7 A;  1PDU A;  1X7E A;  1M7W A;  4K7A A;  2BAW A;  2IOG A;  4MGB B;  3FLI A;  3OGT A;  3ERD A;  4RZF A;  5AAV B;  1P8D A;  3ZRA A;  1FM6 A;  2OM9 A;  4E2J A;  3L3Z A;  2AX7 A;  4OZT E;  1TXI A;  1ILG A;  3CJW A;  3ADS A;  2W8Y A;  1G5Y A;  4S15 A;  3AUQ A;  1OVL A;  3X36 A;  3ZQT A;  1LV2 A;  3Q95 A;  4A2J A;  1YY4 A;  2ZMJ A;  5JJM A;  1ZGY A;  2AWH A;  3DT3 A;  1G50 A;  1NAV A;  1T79 A;  1U3S A;  1Y0X X;  3GD2 A;  3B66 A;  2OUZ A;  1XLS A;  2FAI A;  5L7E A;  4J24 A;  1EXA A;  2QGW A;  4RAK A;  1OVL B;  1YUC A;  5DV6 A;  3Q95 B;  3W5T A;  5JJM B;  5FQS A;  3G8O A;  4PXM A;  4QL8 A;  4PPS A;  1XOW A;  1R20 A;  3TKM A;  4DOR A;  4ZNT A;  1Z5X U;  2HAR A;  3GBK A;  5DZH A;  5A86 A;  5DVV A;  3WGP A;  4ONI A;  1FM6 D;  3G9E A;  4JYH A;  4IA1 A;  1GWX A;  2Z4B A;  3AN4 A;  2Q59 A;  2ZFX A;  4K6I A;  3W0J A;  3X31 A;  5KYJ A;  2PIN A;  3VHV A;  1Y0S A;  3BEJ A;  1P93 A;  3JZB A;  3OZJ A;  5G46 A;  3VN2 A;  3VSO A;  2P4Y A;  1PK5 A;  5LGA A;  3OMK A;  5AVL A;  2QZO B;  1FD0 A;  4OHA A;  5ETH A;  2OCF A;  4XI3 A;  4E4K A;  4OKT A;  3E94 A;  3KYT A;  4IA7 A;  1X76 A;  2VV4 A;  1QKT A;  4L96 A;  2ZY0 A;  2Q59 B;  2J14 A;  3L0J A;  3VHU A;  4IU7 A;  5DXG A;  1YJE A;  4RMD A;  5DX3 A;  1QKU A;  5K13 A;  3W0C A;  4DMA A;  5DY8 A;  2QH6 A;  3HC6 A;  3VT4 A;  5E19 A;  3ZRB A;  4LNX A;  3GN8 A;  3UVV A;  2XYJ A;  3IA6 A;  4OEA A;  1R20 D;  4QJR A;  4B7W A;  1YOK A;  5C4O A;  5HJP A;  5JY3 A;  2VV4 B;  5KCC A;  1ZAF A;  4APU A;  4M8E A;  5DVC A;  1ZH7 A;  5IXK A;  1YOW A;  1SKX A;  4Y29 A;  3NSQ A;  5AAU A;  4IUI A;  4NB6 A;  2QMV A;  3PCU A;  4OED A;  3VJI A;  3P0U A;  3UVV B;  2AA2 A;  1NQ1 A;  3H52 A;  4M8H A;  4PLD A;  5HJP B;  2QSE A;  2G0G A;  3ET2 A;  3PO9 A;  1NQ0 A;  3HO0 A;  2PIQ A;  1NAX A;  4IVY A;  1IE8 A;  4ZNV A;  5DWG A;  2HBH A;  2OAX A;  4X1G A;  3V3E A;  3D6D A;  2R40 A;  3K22 A;  4ZN9 A;  3ERT A;  3DZU A;  1GWQ A;  3N00 A;  4ZNS A;  3HC5 A;  4YNK A;  3VRV A;  4Q50 A;  4N5G A;  4UDC A;  2ZAS A;  1YP0 A;  4FGY A;  3VT6 A;  4POJ A;  2PIR A;  1XP6 A;  1T7T A;  1OT7 A;  2JFA B;  2LBD A;  1KV6 A;  5KD9 A;  5KRC A;  3UP3 A;  4OJ4 A;  4IV2 A;  4OIV A;  3W5R A;  5DIE A;  3P89 A;  1K4W A;  2P7Z A;  5DI7 A;  3V9Y A;  1GS4 A;  3W5Q A;  3DCT A;  3HQ5 A;  2NXX E;  3R5M A;  4UDB A;  4REF A;  4DM8 A;  4ZO1 B;  3KDU A;  1A28 A;  3D90 A;  1MVC A;  4MGA A;  2Q5S A;  4G1Y A;  3VI8 A;  3VSP A;  1XV9 A;  5DV3 A;  1OSV A;  4RE8 A;  3JZC A;  2R40 D;  3OSI A;  2H77 A;  5APJ A;  4EMA A;  5DKB A;  4PVU A;  4BCR A;  2I4P A;  1PCG A;  2FSZ A;  4FN9 A;  5GT4 A;  4IA3 A;  1UOM A;  2ZNP A;  1XP9 A;  3GYU A;  5C4U A;  1T7R A;  2I4Z A;  3V49 A;  4YPQ A;  4MGA B;  2XYW A;  3LMP A;  3B0T A;  3FUG A;  4FHI A;  1XV9 B;  4KZM A;  5AZT A;  4PF3 A;  2AA7 A;  5B5B A;  3R2A A;  3VRU A;  3VRT A;  4OJB A;  1U3R A;  5E1C A;  5KRM A;  4MDD A;  4TV1 B;  2ZXN A;  2YJD A;  3L03 A;  1XP1 A;  5DYB A;  2P7G A;  3T03 A;  3W0G A;  5DUH A;  3A3Z X;  4ZJR A;  2GTK A;  3HZF A;  3RLL A;  2OVM A;  3ILZ A;  1R1K D;  2QTU A;  3B0W A;  3VTC A;  4ZNH A;  4L98 A;  5EIT A;  2P54 A;  5DUG A;  2PIT A;  4JGV A;  5DZI A;  5F9B A;  2JJ3 A;  4G21 A;  3H0A A;  5DRJ A;  5HJS A;  2Q7J A;  4X1F A;  4J5W A;  3VTD A;  2QE4 A;  4WQP A;  2POG A;  1S0X A;  3K23 A;  4OK1 A;  1FCY A;  2I0G A;  2Q61 A;  4YMQ A;  1UHL A;  4NUF A;  3R8D A;  4XT9 A;  5AVI A;  3IMY A;  1H9U A;  4IW6 A;  2Q7I A;  2QPY A;  5IZ0 A;  3KMR A;  4DQM A;  4ZNW A;  4G1Z A;  2PIO A;  5DK9 A;  1QKN A;  5E7V A;  4P6X A;  1E3K A;  4ZN7 A;  3WT6 A;  2YLQ A;  3FEJ A;  3F7D A;  3K8S A;  3OAP A;  4XHD A;  1XQC A;  1SJ0 A;  3R5N A;  4RUJ A;  1FCZ A;  1UHL B;  1ZKY A;  2PIU A;  3MNE A;  2QZO A;  1ZDU A;  3L1B A;  2Q5P A;  3NOA A;  4IW8 A;  3UUC A;  4NQA B;  1M13 A;  4JYG A;  3H0A D;  2ZNQ A;  4R06 A;  2P7A A;  5DXK A;  4HLW A;  5H1E A;  3OMP A;  5FQP A;  5G43 A;  1YMT A;  4LBD A;  2I4J A;  3B1M A;  2PIX A;  1A52 A;  4G2I A;  1L2I A;  3P8X A;  3V9V A;  3UUA A;  4ITE A;  1Z95 A;  2HWR A;  1SR7 A;  3ET3 A;  2Q6J A;  3FXV A;  2ZXM A;  4PPP A;  2PIP L;  4OH5 A;  5DXE A;  5B41 A;  1X78 A;  4RFW A;  4PP3 A;  5KYA A;  1RDT D;  1U3Q A;  1EXX A;  3KWY A;  1RK3 A;  3OOK A;  2P1U A;  4ZNU A;  1R6G A;  2Q60 A;  1YIM A;  3B0R A;  5G44 A;  3UUA B;  1BSX A;  4KZI A;  2VV3 A;  1NYX A;  3AUN A;  1N83 A;  3DR1 A;  4EM9 A;  1G1U A;  4QM0 A;  5DKS A;  4DM6 A;  5KRI A;  4IQR A;  4MG5 A;  5KRJ A;  2AA5 A;  4S0T A;  4XUM A;  2YJA B;  3DCU A;  1S19 A;  1YIN A;  1PQ9 A;  2Q3Y A;  2J4A A;  4ZJW A;  3BC5 A;  2I0J A;  5DYD A;  4NIE A;  3CS4 A;  2AX6 A;  4QE8 A;  1R5K A;  2ZNO A;  4O8F A;  5DWI A;  5GIC A;  4OKW A;  5G42 A;  2GWX A;  3A2I A;  1XNN A;  3W0Y A;  4POH A;  5M96 A;  2PJL A;  4OIL A;  1OSH A;  3ADT A;  4HEE X;  3A40 X;  3UUD A;  4OFR A;  5DXB A;  2JFA A;  5E15 A;  3GZ9 A;  5DKE A;  1MZN A;  3CWD A;  5DIG A;  4YT1 A;  5DVS A;  3RUU A;  4J26 A;  4IWF A;  2ZK4 A;  1FCX A;  1X7J A;  2AX8 A;  1T63 A;  1U9E A;  4IVW A;  1XLS E;  3HM1 A;  5DZ0 A;  1WM0 X;  2E2R A;  3CDS A;  3K6P A;  2YFE A;  4FNE A;  3GYT A;  1DKF A;  2AA6 A;  2QXS A;  4KZJ A;  3O1E A;  4MG7 A;  4PP6 A;  1Q4X A;  3IPS A;  5DXB B;  3UUD B;  3WJ5 A;  1NQ2 A;  3KFC A;  4N8R A;  4OEY A;  4WHG A;  2NW4 A;  1XPC A;  4OZR E;  2GPP A;  2B23 A;  3CDP A;  2AMA A;  3D57 A;  4UDA A;  2VV0 A;  4J5X C;  5DP0 A;  5DXR A;  3VT7 A;  2AYR A;  2ZLA A;  5DWE A;  3G0W A;  1I37 A;  1R1K A;  1DKF B;  2G5O A;  1QKM A;  4TUZ A;  5DMC A;  4MG7 B;  5DWL A;  3A9E B;  4QK4 A;  1XQ3 A;  4F9M A;  4PP5 A;  1IE9 A;  1VJB A;  2Z4J A;  3PEQ A;  5KCT A;  1RJK A;  1YYE A;  3KMG A;  3OSW A;  4TV1 A;  3A2H A;  3D24 A;  3VT9 A;  4OZT U;  1T65 A;  5EJV A;  5AK2 A;  4TUZ B;  3EYB A;  3B3K A;  4WHF A;  3D5F A;  1PQC A;  2P15 A;  3W0A A;  3WJ4 A;  3A78 A;  4A4W A;  5HCV A;  2ABI A;  2PKL A;  3WTQ A;  3OZ0 A;  2Q70 A;  2ZK5 A;  5DSH A;  3UP0 A;  4IV4 A;  5KRL A;  1HG4 A;  1XDK A;  3AZ1 A;  1K7L A;  3KDT A;  3FC6 A;  2GIU A;  1YA3 A;  2HCD A;  3B5R A;  1XNX A;  2AX9 A;  4G1D A;  2B1Z A;  3HVL A;  4OGH A;  3PLZ A;  4OEZ A;  4IWC A;  1DB1 A;  5DRM A;  3IXP A;  5CJ6 A;  2VV2 A;  5EGV A;  4OKX A;  3WMH A; 
#chains in the Genus database with same CATH homology
 2QGT A;  3AN3 A;  5AWK A;  2YHD A;  3TX7 B;  2PIV A;  2XKW A;  2XYX A;  5G5W A;  1UPV A;  4S0S A;  5G3J A;  3S9S A;  1M2Z A;  1XDK B;  3FS1 A;  4R2U A;  1XVP B;  1KNU A;  3FC6 B;  4MG9 A;  3MNP A;  3FAL A;  3SP9 A;  4ZI1 A;  2Q7L A;  1T74 A;  4REE A;  4WPF A;  3W5P A;  3X1H A;  2PNU A;  3OS9 A;  1RKH A;  2AAX A;  5AYG A;  4OJ9 A;  2QA6 A;  3VHW A;  2ZK2 A;  4OIU A;  4XUH A;  3OKH A;  1RDT A;  1FBY A;  3E7C A;  4MG9 B;  5EHJ A;  3OLL A;  3B68 A;  3FAL B;  1N4H A;  2ZMH A;  4OFU A;  3CS8 A;  4QE6 A;  5FQT A;  1KKQ A;  5KCW A;  4XTA A;  4CI5 A;  1K74 A;  3RLJ A;  1N46 A;  2OVH A;  2IOK A;  3CTB A;  3OS8 C;  5DL4 A;  3IXP D;  1T76 A;  3VT5 A;  2HB7 A;  2AM9 A;  1L2J A;  4R6S A;  5E0W A;  5GID A;  4RWV A;  2PRG A;  4P6W A;  2Q1V A;  3DY6 A;  3PBA A;  3ET1 A;  4LTW A;  3VJT A;  3WWR A;  5APK A;  3UU7 A;  5GIE A;  3VT8 A;  2ZXZ A;  1ILH A;  3WFF A;  1NHZ A;  3CQV A;  3VRW A;  3RUT A;  2FVJ A;  3KBA A;  3KMZ A;  4LNW A;  1ZDT A;  5KR9 A;  3GWS X;  4G20 A;  4N1Y A;  4S14 A;  2HWQ A;  3F5C A;  2VST A;  5FQV A;  2YLP A;  1PQ6 A;  3B65 A;  5DZ3 A;  1T7M A;  4Q0A C;  1ZEO A;  3UU7 B;  5FQR A;  3OLF A;  4J5W C;  3W0I A;  1XB7 A;  4IA2 A;  3VJH A;  4MGC A;  3L0L A;  5DID A;  3RVF A;  1I7I A;  1K74 D;  1NDE A;  2NXX A;  3OKI A;  1G2N A;  4UDD A;  2NPA A;  3R8A A;  3U9Q A;  1S9P A;  5KRH A;  1NQ7 A;  3F5C B;  2AO6 A;  2QR9 A;  4ITF A;  4JYI A;  4Q13 A;  4ZOM A;  3X1I A;  3AFR A;  3MNO A;  1E3G A;  2AB2 A;  2AMB A;  1S9Q A;  2O4R A;  2Q8S A;  4WVD A;  5KRK A;  1PRG A;  1T5Z A;  3G8I A;  2YLO A;  3OOF A;  4XLD A;  4PWL A;  2P1V A;  1T7F A;  2ZK1 A;  1ZUC A;  4LSJ A;  2PIW A;  5DTV A;  3L0E A;  2AXA A;  3AZ3 A;  1X7R A;  4RZG A;  5JI0 D;  5SYZ A;  5G45 A;  3OMO A;  4OZR U;  3V4A A;  3VTB A;  5KRO A;  2XHS A;  4MGD A;  4IS8 A;  5C4S A;  2YAT A;  5HYK A;  2R6W A;  5KCE A;  2BJ4 A;  2ZK6 A;  4RME A;  3V3Q A;  3WT5 A;  5L11 A;  4RUO X;  3TY0 A;  4A4V A;  2F4B A;  1FM9 A;  3OMQ A;  1Z5X E;  3ZR7 A;  2ZLC A;  3AUR A;  4DK8 A;  4XAO A;  2JF9 A;  1ERE A;  4J5X A;  4RUP A;  4RZE A;  5DV8 A;  3E00 A;  5C4T A;  3L3X A;  2POB A;  4ZO1 X;  4OAR A;  1NRL A;  5LWP A;  2GPV A;  2ZKC A;  1XJ7 A;  3IPQ A;  4G2H A;  2J7X A;  2J7Y A;  5KCF A;  1GWR A;  2HFP A;  4MGD B;  2V0V A;  4OLM A;  2QA8 A;  1SQN A;  2ACL A;  3AZ2 A;  2BJ4 B;  5KRA A;  3VJS A;  4N73 A;  5DUE A;  2Q7K A;  5DX3 B;  5ACC A;  2G44 A;  2B1V A;  2V7C A;  3B67 A;  2EWP A;  2OZ7 A;  3A9E A;  5ICK A;  5L7H A;  3V9T A;  2O9I A;  1PZL A;  2GPU A;  5APH A;  3BQD A;  3DZY A;  5HZC A;  2IHQ A;  3OMM A;  4FHH A;  1TFC A;  1S0Z A;  1NUO A;  2HC4 A;  2ACL B;  2QA8 B;  2ZMI A;  3AX8 A;  3A2J A;  4CSJ A;  4PRG A;  5HYR A;  4OKB A;  1XAP A;  2R6Y A;  1FM9 D;  5DLR A;  1I7G A;  4WLB A;  3ET0 A;  2GL8 A;  5KCU A;  3E00 D;  2Q5G A;  2A3I A;  2HB8 A;  1I38 A;  3B0Q A;  2GP7 A;  3O1D A;  3ADW A;  5AZV A;  2VV1 A;  4CI4 A;  1XIU A;  3SP6 A;  2Q6S A;  3M7R A;  1X7B A;  2B50 A;  3ADV A;  2YLY A;  2P1T A;  1XZX X;  4JAZ A;  1UPW A;  2Q1H A;  3FEI A;  2ZK0 A;  3CS6 A;  3GWX A;  3VT3 A;  4NY9 A;  2ZK3 A;  4MG6 A;  1ERR A;  4K4J A;  5AWJ A;  5KRF A;  5I4V A;  1HJ1 A;  3HOD A;  3CLD A;  2VV1 B;  3DZY D;  5DXM A;  3P88 A;  4DOS A;  3LBD A;  1MV9 A;  2O4J A;  2QAB A;  3PRG A;  2ZBS A;  5EI1 A;  5KCD A;  2QXM A;  2REW A;  3FUR A;  1XVP A;  2QNV A;  5EC9 A;  5IAW A;  2G0H A;  2ZNN A;  2ZL9 A;  5DWJ A;  5DZ1 A;  3R29 A;  3DZU D;  3SZ1 A;  5E14 A;  1RKG A;  2VSR A;  1Y9R A;  5DU5 A;  3W0H A;  4DK7 A;  5L7G A;  2HAS A;  4PLE A;  1LBD A;  3RY9 A;  4MG8 A;  2Q6R A;  5DXP A;  3OSA A;  3IPU A;  5DXQ A;  5DKG A;  3OS8 A;  4MGB A;  4E4Q A;  2H79 A;  5DMF A;  2GPO A;  3TKC A;  3WT7 A;  2QW4 A;  5AAV A;  4JL4 A;  3R8I A;  2ATH A;  4OC7 A;  4OH6 A;  3KPZ A;  3ADU A;  3ADX A;  2HVC A;  3QT0 A;  3HLV A;  3WFG A;  4MG8 B;  5E0X A;  1T73 A;  2ZVT A;  3NSP A;  3OLS A;  4RMC A;  2HAM A;  2NV7 A;  1PDU A;  1X7E A;  1M7W A;  4K7A A;  2BAW A;  2IOG A;  4MGB B;  3FLI A;  3OGT A;  3ERD A;  4RZF A;  5AAV B;  1P8D A;  3ZRA A;  1FM6 A;  2OM9 A;  4E2J A;  3L3Z A;  2AX7 A;  4OZT E;  1TXI A;  1ILG A;  3CJW A;  3ADS A;  2W8Y A;  1G5Y A;  4S15 A;  3AUQ A;  1OVL A;  3X36 A;  3ZQT A;  1LV2 A;  3Q95 A;  4A2J A;  1YY4 A;  2ZMJ A;  5JJM A;  1ZGY A;  2AWH A;  3DT3 A;  1G50 A;  1NAV A;  1T79 A;  1U3S A;  1Y0X X;  3GD2 A;  3B66 A;  2OUZ A;  1XLS A;  2FAI A;  5L7E A;  4J24 A;  1EXA A;  2QGW A;  4RAK A;  1OVL B;  1YUC A;  5DV6 A;  3Q95 B;  3W5T A;  5JJM B;  5FQS A;  3G8O A;  4PXM A;  4QL8 A;  4PPS A;  1XOW A;  1R20 A;  3TKM A;  4DOR A;  4ZNT A;  1Z5X U;  2HAR A;  3GBK A;  5DZH A;  5A86 A;  5DVV A;  3WGP A;  4ONI A;  1FM6 D;  3G9E A;  4JYH A;  4IA1 A;  1GWX A;  2Z4B A;  3AN4 A;  2Q59 A;  2ZFX A;  4K6I A;  3W0J A;  3X31 A;  5KYJ A;  2PIN A;  3VHV A;  1Y0S A;  3BEJ A;  1P93 A;  3JZB A;  3OZJ A;  5G46 A;  3VN2 A;  3VSO A;  2P4Y A;  1PK5 A;  5LGA A;  3OMK A;  5AVL A;  2QZO B;  1FD0 A;  4OHA A;  5ETH A;  2OCF A;  4XI3 A;  4E4K A;  4OKT A;  3E94 A;  3KYT A;  4IA7 A;  1X76 A;  2VV4 A;  1QKT A;  4L96 A;  2ZY0 A;  2Q59 B;  2J14 A;  3L0J A;  3VHU A;  4IU7 A;  5DXG A;  1YJE A;  4RMD A;  5DX3 A;  1QKU A;  5K13 A;  3W0C A;  4DMA A;  5DY8 A;  2QH6 A;  3HC6 A;  3VT4 A;  5E19 A;  3ZRB A;  4LNX A;  3GN8 A;  3UVV A;  2XYJ A;  3IA6 A;  4OEA A;  1R20 D;  4QJR A;  4B7W A;  1YOK A;  5C4O A;  5HJP A;  5JY3 A;  2VV4 B;  5KCC A;  1ZAF A;  4APU A;  4M8E A;  5DVC A;  1ZH7 A;  5IXK A;  1YOW A;  1SKX A;  4Y29 A;  3NSQ A;  5AAU A;  4IUI A;  4NB6 A;  2QMV A;  3PCU A;  4OED A;  3VJI A;  3P0U A;  3UVV B;  2AA2 A;  1NQ1 A;  3H52 A;  4M8H A;  4PLD A;  5HJP B;  2QSE A;  2G0G A;  3ET2 A;  3PO9 A;  1NQ0 A;  3HO0 A;  2PIQ A;  1NAX A;  4IVY A;  1IE8 A;  4ZNV A;  5DWG A;  2HBH A;  2OAX A;  4X1G A;  3V3E A;  3D6D A;  2R40 A;  3K22 A;  4ZN9 A;  3ERT A;  3DZU A;  1GWQ A;  3N00 A;  4ZNS A;  3HC5 A;  4YNK A;  3VRV A;  4Q50 A;  4N5G A;  4UDC A;  2ZAS A;  1YP0 A;  4FGY A;  3VT6 A;  4POJ A;  2PIR A;  1XP6 A;  1T7T A;  1OT7 A;  2JFA B;  2LBD A;  1KV6 A;  5KD9 A;  5KRC A;  3UP3 A;  4OJ4 A;  4IV2 A;  4OIV A;  3W5R A;  5DIE A;  3P89 A;  1K4W A;  2P7Z A;  5DI7 A;  3V9Y A;  1GS4 A;  3W5Q A;  3DCT A;  3HQ5 A;  2NXX E;  3R5M A;  4UDB A;  4REF A;  4DM8 A;  4ZO1 B;  3KDU A;  1A28 A;  3D90 A;  1MVC A;  4MGA A;  2Q5S A;  4G1Y A;  3VI8 A;  3VSP A;  1XV9 A;  5DV3 A;  1OSV A;  4RE8 A;  3JZC A;  2R40 D;  3OSI A;  2H77 A;  5APJ A;  4EMA A;  5DKB A;  4PVU A;  4BCR A;  2I4P A;  1PCG A;  2FSZ A;  4FN9 A;  5GT4 A;  4IA3 A;  1UOM A;  2ZNP A;  1XP9 A;  3GYU A;  5C4U A;  1T7R A;  2I4Z A;  3V49 A;  4YPQ A;  4MGA B;  2XYW A;  3LMP A;  3B0T A;  3FUG A;  4FHI A;  1XV9 B;  4KZM A;  5AZT A;  4PF3 A;  2AA7 A;  5B5B A;  3R2A A;  3VRU A;  3VRT A;  4OJB A;  1U3R A;  5E1C A;  5KRM A;  4MDD A;  4TV1 B;  2ZXN A;  2YJD A;  3L03 A;  1XP1 A;  5DYB A;  2P7G A;  3T03 A;  3W0G A;  5DUH A;  3A3Z X;  4ZJR A;  2GTK A;  3HZF A;  3RLL A;  2OVM A;  3ILZ A;  1R1K D;  2QTU A;  3B0W A;  3VTC A;  4ZNH A;  4L98 A;  5EIT A;  2P54 A;  5DUG A;  2PIT A;  4JGV A;  5DZI A;  5F9B A;  2JJ3 A;  4G21 A;  3H0A A;  5DRJ A;  5HJS A;  2Q7J A;  4X1F A;  4J5W A;  3VTD A;  2QE4 A;  4WQP A;  2POG A;  1S0X A;  3K23 A;  4OK1 A;  1FCY A;  2I0G A;  2Q61 A;  4YMQ A;  1UHL A;  4NUF A;  3R8D A;  4XT9 A;  5AVI A;  3IMY A;  1H9U A;  4IW6 A;  2Q7I A;  2QPY A;  5IZ0 A;  3KMR A;  4DQM A;  4ZNW A;  4G1Z A;  2PIO A;  5DK9 A;  1QKN A;  5E7V A;  4P6X A;  1E3K A;  4ZN7 A;  3WT6 A;  2YLQ A;  3FEJ A;  3F7D A;  3K8S A;  3OAP A;  4XHD A;  1XQC A;  1SJ0 A;  3R5N A;  4RUJ A;  1FCZ A;  1UHL B;  1ZKY A;  2PIU A;  3MNE A;  2QZO A;  1ZDU A;  3L1B A;  2Q5P A;  3NOA A;  4IW8 A;  3UUC A;  4NQA B;  1M13 A;  4JYG A;  3H0A D;  2ZNQ A;  4R06 A;  2P7A A;  5DXK A;  4HLW A;  5H1E A;  3OMP A;  5FQP A;  5G43 A;  1YMT A;  4LBD A;  2I4J A;  3B1M A;  2PIX A;  1A52 A;  4G2I A;  1L2I A;  3P8X A;  3V9V A;  3UUA A;  4ITE A;  1Z95 A;  2HWR A;  1SR7 A;  3ET3 A;  2Q6J A;  3FXV A;  2ZXM A;  4PPP A;  2PIP L;  4OH5 A;  5DXE A;  5B41 A;  1X78 A;  4RFW A;  4PP3 A;  5KYA A;  1RDT D;  1U3Q A;  1EXX A;  3KWY A;  1RK3 A;  3OOK A;  2P1U A;  4ZNU A;  1R6G A;  2Q60 A;  1YIM A;  3B0R A;  5G44 A;  3UUA B;  1BSX A;  4KZI A;  2VV3 A;  1NYX A;  3AUN A;  1N83 A;  3DR1 A;  4EM9 A;  1G1U A;  4QM0 A;  5DKS A;  4DM6 A;  5KRI A;  4IQR A;  4MG5 A;  5KRJ A;  2AA5 A;  4S0T A;  4XUM A;  2YJA B;  3DCU A;  1S19 A;  1YIN A;  1PQ9 A;  2Q3Y A;  2J4A A;  4ZJW A;  3BC5 A;  2I0J A;  5DYD A;  4NIE A;  3CS4 A;  2AX6 A;  4QE8 A;  1R5K A;  2ZNO A;  4O8F A;  5DWI A;  5GIC A;  4OKW A;  5G42 A;  2GWX A;  3A2I A;  1XNN A;  3W0Y A;  4POH A;  5M96 A;  2PJL A;  4OIL A;  1OSH A;  3ADT A;  4HEE X;  3A40 X;  3UUD A;  4OFR A;  5DXB A;  2JFA A;  5E15 A;  3GZ9 A;  5DKE A;  1MZN A;  3CWD A;  5DIG A;  4YT1 A;  5DVS A;  3RUU A;  4J26 A;  4IWF A;  2ZK4 A;  1FCX A;  1X7J A;  2AX8 A;  1T63 A;  1U9E A;  4IVW A;  1XLS E;  3HM1 A;  5DZ0 A;  1WM0 X;  2E2R A;  3CDS A;  3K6P A;  2YFE A;  4FNE A;  3GYT A;  1DKF A;  2AA6 A;  2QXS A;  4KZJ A;  3O1E A;  4MG7 A;  4PP6 A;  1Q4X A;  3IPS A;  5DXB B;  3UUD B;  3WJ5 A;  1NQ2 A;  3KFC A;  4N8R A;  4OEY A;  4WHG A;  2NW4 A;  1XPC A;  4OZR E;  2GPP A;  2B23 A;  3CDP A;  2AMA A;  3D57 A;  4UDA A;  2VV0 A;  4J5X C;  5DP0 A;  5DXR A;  3VT7 A;  2AYR A;  2ZLA A;  5DWE A;  3G0W A;  1I37 A;  1R1K A;  1DKF B;  2G5O A;  1QKM A;  4TUZ A;  5DMC A;  4MG7 B;  5DWL A;  3A9E B;  4QK4 A;  1XQ3 A;  4F9M A;  4PP5 A;  1IE9 A;  1VJB A;  2Z4J A;  3PEQ A;  5KCT A;  1RJK A;  1YYE A;  3KMG A;  3OSW A;  4TV1 A;  3A2H A;  3D24 A;  3VT9 A;  4OZT U;  1T65 A;  5EJV A;  5AK2 A;  4TUZ B;  3EYB A;  3B3K A;  4WHF A;  3D5F A;  1PQC A;  2P15 A;  3W0A A;  3WJ4 A;  3A78 A;  4A4W A;  5HCV A;  2ABI A;  2PKL A;  3WTQ A;  3OZ0 A;  2Q70 A;  2ZK5 A;  5DSH A;  3UP0 A;  4IV4 A;  5KRL A;  1HG4 A;  1XDK A;  3AZ1 A;  1K7L A;  3KDT A;  3FC6 A;  2GIU A;  1YA3 A;  2HCD A;  3B5R A;  1XNX A;  2AX9 A;  4G1D A;  2B1Z A;  3HVL A;  4OGH A;  3PLZ A;  4OEZ A;  4IWC A;  1DB1 A;  5DRM A;  3IXP A;  5CJ6 A;  2VV2 A;  5EGV A;  4OKX A;  3WMH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...