5KD9A

Crystal structure of the er-alpha ligand-binding domain (y537s) in complex with an n-trifluoroethyl 4-chlorobenzyl obhs-n derivative
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
244
structure length
235
Chain Sequence
SLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLSDLLLEMLDAHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Estrogen receptor
publication title Full antagonism of the estrogen receptor without a prototypical ligand side chain.
pubmed doi rcsb
source organism Homo sapiens
total genus 88
structure length 235
sequence length 244
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00104 Hormone_recep Ligand-binding domain of nuclear hormone receptor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.565.10 Mainly Alpha Orthogonal Bundle Retinoid X Receptor Retinoid X Receptor 5kd9A00
1RK3A 4OHAA 4PP6A 5DX3A 3CJWA 3FUGA 4IA1A 3ET2A 2BAWA 2ZK1A 4UDBA 1PQ6A 4ZO1X 2ZBSA 1R1KD 1R20A 1FCZA 3VTBA 3PCUA 3P0UA 4YPQA 3CLDA 5GIEA 1QKNA 4XI3A 2B1VA 3K8SA 1ZDUA 3HC6A 3P8XA 3V4AA 4Y29A 5KRKA 1A28A 1XVPB 1XV9B 4YT1A 5GT4A 2JJ3A 4DK8A 4MGAB 5K13A 5KROA 1T79A 5APKA 5AZTA 1X7BA 5EITA 1PRGA 4LTWA 4APUA 3A78A 5DXMA 3AZ1A 1FBYA 4NB6A 2P1UA 3KBAA 5DSHA 5L7EA 3CWDA 1X7RA 4TV1B 1HJ1A 4NIEA 4QE8A 3W5RA 1XVPA 1M7WA 5DV3A 1XV9A 3MNPA 3DCTA 2ABIA 2J14A 3HO0A 4MGAA 5DXEA 5KRFA 1R1KA 2R6WA 1GS4A 4OJBA 2F4BA 5DVVA 3KMZA 3X36A 2BJ4A 3ZRAA 1PCGA 5CJ6A 3HVLA 3W0AA 3K6PA 1T7FA 4ZNHA 1QKUA 5A86A 3IA6A 5C4UA 2Q6JA 1E3KA 2PNUA 4G1DA 3GZ9A 4TV1A 3WJ5A 5DZ1A 5ETHA 3G8OA 1ZUCA 4K6IA 3VRWA 1XP6A 2FAIA 2O9IA 3RLLA 2ZNNA 2YATA 3B68A 2I4JA 3MNOA 5B41A 3LMPA 4JYHA 3CS8A 3NSQA 4J5XA 5DKEA 3FALB 2AX6A 4OKBA 2VV1B 1QKMA 1PQCA 4OH5A 4WQPA 4JL4A 5LGAA 2YFEA 1G2NA 3V3QA 3D6DA 3HQ5A 3OS8A 5KCFA 5KCWA 4M8HA 1DKFB 4QL8A 2OCFA 3W0HA 3SP9A 4E4QA 3S9SA 2AYRA 1YUCA 1I7GA 2PKLA 4JAZA 4G1YA 2ZMHA 2Q7LA 4OGHA 2ZK0A 4RFWA 3FALA 3V49A 2VV1A 4B7WA 3V3EA 5AYGA 4KZMA 1N4HA 3ZRBA 4DK7A 2AAXA 2OUZA 1I7IA 5ACCA 1S9QA 1DKFA 2Q6RA 1T7RA 2Z4JA 5DUHA 5FQRA 3OKHA 5DXQA 3W5TA 1G5YA 2YLOA 2ZNPA 3R29A 2VV2A 4ZNUA 4RZEA 2QXMA 5DRMA 5KRIA 3KDTA 3DY6A 2Q1HA 3ILZA 2VV3A 1UHLB 2I0JA 2PIOA 5KD9A 3AZ2A 3G9EA 3B0WA 2G44A 3GBKA 3GWSX 1TFCA 5DYDA 4ZN9A 5KCDA 4X1FA 4NY9A 4M8EA 2QMVA 1VJBA 3L03A 2GTKA 1HG4A 2QR9A 5FQTA 2IHQA 3N00A 2OM9A 1UHLA 2Q60A 3G0WA 2QH6A 1Y0XX 1M13A 5EJVA 4ZOMA 4ZNSA 5DVCA 2GL8A 2P7AA 1RDTA 5HYRA 4J24A 5DKSA 2QE4A 3TKMA 4G2IA 1U3SA 4N73A 5L7GA 3ADTA 1RKGA 2NXXA 3CQVA 1UOMA 4XLDA 4R2UA 4ITFA 1T7TA 4CI4A 2PIUA 3BQDA 2OZ7A 1T76A 3NSPA 3PRGA 3FEJA 4PP3A 3PBAA 4J5WC 3V9VA 2R6YA 4BCRA 3DR1A 2H79A 4ZNTA 4NQAB 2ACLB 2Q7IA 1P8DA 3NOAA 5DIEA 2Q7KA 4PPSA 1X78A 3OKIA 5DZ3A 2GPVA 3R5MA 4ZNVA 3VT9A 4POHA 2AXAA 4IWFA 1NQ0A 5E7VA 5KYAA 1L2JA 4UDAA 3GD2A 2ACLA 2FSZA 4DMAA 2VV4B 2NV7A 3MNEA 4ZN7A 3X31A 1S9PA 2HFPA 3HLVA 3R5NA 4MDDA 4OJ9A 1YA3A 2HBHA 3WTQA 5E0XA 1GWRA 4PF3A 1MZNA 1OT7A 4XHDA 3OMMA 1Y9RA 4WHFA 4OJ4A 5DZIA 4RZFA 3R8AA 3VT6A 3W0IA 1FCXA 5KCUA 3W0CA 2AWHA 3A3ZX 2VV4A 4RUJA 3FEIA 1U3QA 2ZMJA 5C4SA 5APJA 2GPUA 4S15A 3B66A 3WT6A 2ZVTA 3IMYA 3OLSA 1RJKA 2AA2A 5EC9A 4EMAA 3A2IA 4RMDA 5L7HA 2ZLCA 4G1ZA 3WWRA 1XB7A 4ZO1B 5G43A 2QXSA 1EXAA 2W8YA 5DVSA 4IV4A 5JI0D 5E15A 1NQ1A 1TXIA 1YOKA 2HWQA 2PRGA 2Q1VA 4WVDA 4L98A 2QGTA 3AZ3A 5DXPA 4P6WA 1DB1A 1T74A 3CS6A 1XNXA 2Q5SA 2Q59B 5C4TA 2Q8SA 3HM1A 3G8IA 3X1HA 1FM6D 3AURA 2QABA 2BJ4B 1OSVA 4IW6A 3TY0A 5AAVB 1I38A 3DZUD 3B0RA 2J4AA 2YLYA 3D57A 3OMPA 5DUGA 1XDKB 5DRJA 4UDCA 3IPSA 1XQCA 2Q3YA 2ZY0A 5H1EA 2Q59A 4PP5A 3OSAA 1Z5XE 4G2HA 4CI5A 2A3IA 1PDUA 2I4PA 3KYTA 5AAVA 2P7GA 3R8IA 5GICA 2QA8B 1ZKYA 4F9MA 1XDKA 4OEDA 2GIUA 2HAMA 4DORA 5EHJA 5AWKA 1YOWA 4OEYA 3SZ1A 1YYEA 2JF9A 3D24A 3E94A 3ERDA 4PVUA 2QA8A 1FM6A 1EXXA 4OKXA 4PXMA 4ZJWA 4UDDA 5KCCA 3UP3A 3DZUA 2ZK6A 3DT3A 4WPFA 2Q61A 3K22A 3IXPD 5DL4A 2VSRA 4LBDA 2HARA 4OFRA 3KPZA 2P1TA 1X76A 3RLJA 3ET3A 1U3RA 3VJSA 2ZLAA 3W5PA 1N83A 2R40D 1KKQA 3OS9A 1RDTD 4HLWA 4IVYA 5GIDA 1ILHA 3ET0A 4IA3A 3FC6B 3A9EB 3L0LA 1Z5XU 3OZ0A 4LSJA 3VHWA 1P93A 5FQPA 4DOSA 3OGTA 5IXKA 5KRJA 5EI1A 4O8FA 1XNNA 4FHIA 4OKWA 4XAOA 4A4VA 3X1IA 3VRTA 2LBDA 5IAWA 1T73A 1RKHA 4Q0AC 4R6SA 3BC5A 3RVFA 3FC6A 3A9EA 5KR9A 1XIUA 4MGCA 4OILA 5AAUA 2HB8A 5DV6A 2NW4A 4ZI1A 1FM9D 3M7RA 2PIVA 4XUHA 4E4KA 3IXPA 4XT9A 5DTVA 3UU7B 5DI7A 3E00D 4L96A 3U9QA 4FN9A 4MG8B 3CTBA 1L2IA 4S14A 4OFUA 5DWIA 4OIVA 5DXKA 5IZ0A 3HODA 4QK4A 3AUNA 3UUDA 1NRLA 2POGA 2R40A 4G21A 4OEZA 1GWQA 2ZK3A 3FURA 3OSIA 1S0ZA 3O1DA 2H77A 2P4YA 3UU7A 3D5FA 4QE6A 1K4WA 1Y0SA 2PINA 4MG8A 1SJ0A 4TUZB 5DLRA 3VTCA 5JJMB 2YJDA 3E7CA 3RUUA 3VJIA 3UUCA 3VT7A 3PEQA 2ATHA 5KCTA 1T63A 3ZR7A 3A2JA 3OMOA 3KMRA 5KCEA 3VRVA 5DIDA 3WMHA 4IV2A 1H9UA 4RMEA 4TUZA 3P88A 5JJMA 2ZXZA 1FM9A 3UVVB 3E00A 2PITA 3ADSA 2HC4A 2I4ZA 2YHDA 1IE9A 5AVLA 1ZEOA 1S0XA 3ADVA 2YLPA 2AMAA 4JYIA 5KYJA 2J7YA 4XTAA 1XP1A 2XKWA 3UVVA 3OLFA 1XQ3A 1X7JA 4RUOX 1YMTA 4DQMA 3OMQA 1ERRA 2GP7A 2ZNQA 5L11A 3CS4A 1YJEA 1X7EA 1T5ZA 3ADUA 3IPUA 4MG7A 4OIUA 3HZFA 4PWLA 3VRUA 5FQSA 4OC7A 4OZRU 3VJHA 4E2JA 3CDSA 3L3XA 3K23A 3R2AA 2ZNOA 3UUAB 2J7XA 2VV0A 5DY8A 2YJAB 1YP0A 3KWYA 1PZLA 1ZAFA 3WT7A 2AX9A 3GYUA 4R06A 2AA5A 4PLEA 2HVCA 3TKCA 2HWRA 1XJ7A 2PIRA 3ADWA 3L0JA 4N1YA 5DXGA 5AVIA 3F5CB 4IA7A 3AX8A 3W0GA 4A2JA 3JZCA 5KRMA 4Q13A 1PQ9A 4J5WA 3IPQA 5G45A 3H0AA 3B0QA 3FS1A 3PO9A 5AWJA 3UUAA 3VJTA 3OOFA 4ONIA 2P7ZA 4G20A 5E19A 3VT3A 3WT5A 3ZQTA 1S19A 2QTUA 2JFAB 4S0TA 2AO6A 1XOWA 3GWXA 3WFFA 5FQVA 3QT0A 2EWPA 2I0GA 3F5CA 4MGBB 5E0WA 5KRAA 4MG9B 2AX7A 5G44A 3FXVA 4ZNWA 3W5QA 4DM6A 1ZDTA 1SKXA 4FHHA 4IUIA 4S0SA 4CSJA 4J5XC 1YINA 4PLDA 3Q95B 4YNKA 5DK9A 5F9BA 4ZJRA 5DMCA 3VTDA 5AZVA 2GPOA 2JFAA 4JYGA 1I37A 3OS8C 2P15A 1OVLB 4X1GA 3V9YA 4MGBA 2ZK5A 3B65A 3A40X 4MG9A 5DIGA 3WJ4A 1KV6A 3VT8A 2Q70A 4RE8A 5C4OA 3Q95A 1ZH7A 2AA7A 5KRCA 1FD0A 2XHSA 5KRLA 2HB7A 4RAKA 1OVLA 1T65A 1T7MA 3PLZA 4OZTE 4IQRA 4P6XA 3VI8A 2HASA 5JY3A 5DXRA 1XZXX 3H52A 2QZOB 1NAVA 2QSEA 4IVWA 3WFGA 3DZYD 1NHZA 2Q5GA 4A4WA 2NPAA 2PIPL 3B0TA 3JZBA 2Q6SA 3TX7B 2PJLA 2G5OA 1NUOA 2IOGA 1MVCA 2ZK4A 3R8DA 3T03A 4POJA 4RWVA 3CDPA 3HC5A 2AB2A 2POBA 2AX8A 5G42A 2QZOA 4IW8A 5E1CA 2Z4BA 2P1VA 4QJRA 3D90A 4MG6A 2Q7JA 2ZKCA 3B1MA 1KNUA 5KRHA 2XYJA 2ZK2A 3L3ZA 3VHUA 1XLSE 3OMKA 4N8RA 2ZXNA 1BSXA 5DYBA 5DV8A 4OH6A 2ZMIA 5DKBA 3A2HA 1M2ZA 3F7DA 5DWGA 4ITEA 3RUTA 5M96A 2ZASA 3UUDB 1NQ2A 2E2RA 3B67A 1U9EA 3V9TA 5B5BA 5LWPA 4KZIA 1UPWA 2OAXA 2QGWA 2REWA 4J26A 4LNXA 3GN8A 4OZTU 3VSPA 2QPYA 3DZYA 2B1ZA 2V0VA 4MGDB 5EGVA 5G3JA 5SYZA 2AA6A 1SR7A 3O1EA 3LBDA 2V7CA 3OZJA 2YLQA 1XLSA 2VSTA 5APHA 1FCYA 4K4JA 4XUMA 5DP0A 1R5KA 1A52A 2O4JA 1IE8A 5I4VA 3B3KA 4OKTA 4OLMA 5DWEA 4MGDA 2OVMA 5G46A 4HEEX 3AN4A 4JGVA 3VT5A 1NAXA 1EREA 2HCDA 2PIWA 3KFCA 4Q50A 4OZRE 3ADXA 4WHGA 1K74D 5HCVA 1NYXA 1R6GA 2IOKA 1E3GA 3EYBA 3VN2A 1NDEA 1YY4A 2NXXE 3W0JA 1XP9A 4FNEA 2OVHA 2G0GA 2ZL9A 2ZXMA 4IU7A 1G50A 2AMBA 2Q5PA 3SP6A 5HJPB 4LNWA 2B50A 4WLBA 3B5RA 1G1UA 2P54A 4QM0A 1ILGA 4PRGA 1OSHA 3KDUA 2GPPA 5DU5A 3VHVA 4OK1A 2O4RA 2PIXA 5G5WA 4OARA 1YIMA 2XYXA 5ICKA 1UPVA 4RMCA 3VSOA 4MG7B 5HJPA 4NUFA 2G0HA 2QW4A 5DMFA 3H0AD 3AN3A 1NQ7A 1Z95A 3VT4A 5HYKA 3OAPA 4REFA 2XYWA 4IS8A 5DKGA 4YMQA 3P89A 5HZCA 5DWLA 3RY9A 1XPCA 1LV2A 3L0EA 1K74A 3DCUA 4REEA 5HJSA 2GWXA 4PPPA 5DZHA 4IWCA 1WM0X 4N5GA 1GWXA 5E14A 3AUQA 2QNVA 1R20D 4RUPA 3KMGA 1LBDA 2FVJA 4K7AA 5DXBB 1K7LA 1SQNA 3OSWA 2ZFXA 3FLIA 3GYTA 3AFRA 3BEJA 3OOKA 1ZGYA 1XAPA 3ERTA 3OLLA 4MG5A 3UP0A 4IA2A 4OEAA 1QKTA 2QA6A 5DZ0A 3ET1A 3L1BA 5DWJA 4KZJA 5DX3B 3W0YA 1MV9A 5AK2A 5DXBA 2PIQA 1PK5A 4DM8A 4RZGA 2AM9A 3WGPA 1N46A 4EM9A 1Q4XA 4FGYA 5DUEA 2B23A
chains in the Genus database with same CATH superfamily
1RK3A 4OHAA 4PP6A 5DX3A 3CJWA 3FUGA 4IA1A 3ET2A 2BAWA 2ZK1A 4UDBA 1PQ6A 4ZO1X 2ZBSA 1R1KD 1R20A 1FCZA 3VTBA 3PCUA 3P0UA 4YPQA 3CLDA 5GIEA 1QKNA 4XI3A 2B1VA 3K8SA 1ZDUA 3HC6A 3P8XA 3V4AA 4Y29A 5KRKA 1A28A 1XVPB 1XV9B 4YT1A 5GT4A 2JJ3A 4DK8A 4MGAB 5K13A 5KROA 1T79A 5APKA 5AZTA 1X7BA 5EITA 1PRGA 4LTWA 4APUA 3A78A 5DXMA 3AZ1A 1FBYA 4NB6A 2P1UA 3KBAA 5DSHA 5L7EA 3CWDA 1X7RA 4TV1B 1HJ1A 4NIEA 4QE8A 3W5RA 1XVPA 1M7WA 5DV3A 1XV9A 3MNPA 3DCTA 2ABIA 2J14A 3HO0A 4MGAA 5DXEA 5KRFA 1R1KA 2R6WA 1GS4A 4OJBA 2F4BA 5DVVA 3KMZA 3X36A 2BJ4A 3ZRAA 1PCGA 5CJ6A 3HVLA 3W0AA 3K6PA 1T7FA 4ZNHA 1QKUA 5A86A 3IA6A 5C4UA 2Q6JA 1E3KA 2PNUA 4G1DA 3GZ9A 4TV1A 3WJ5A 5DZ1A 5ETHA 3G8OA 1ZUCA 4K6IA 3VRWA 1XP6A 2FAIA 2O9IA 3RLLA 2ZNNA 2YATA 3B68A 2I4JA 3MNOA 5B41A 3LMPA 4JYHA 3CS8A 3NSQA 4J5XA 5DKEA 3FALB 2AX6A 4OKBA 2VV1B 1QKMA 1PQCA 4OH5A 4WQPA 4JL4A 5LGAA 2YFEA 1G2NA 3V3QA 3D6DA 3HQ5A 3OS8A 5KCFA 5KCWA 4M8HA 1DKFB 4QL8A 2OCFA 3W0HA 3SP9A 4E4QA 3S9SA 2AYRA 1YUCA 1I7GA 2PKLA 4JAZA 4G1YA 2ZMHA 2Q7LA 4OGHA 2ZK0A 4RFWA 3FALA 3V49A 2VV1A 4B7WA 3V3EA 5AYGA 4KZMA 1N4HA 3ZRBA 4DK7A 2AAXA 2OUZA 1I7IA 5ACCA 1S9QA 1DKFA 2Q6RA 1T7RA 2Z4JA 5DUHA 5FQRA 3OKHA 5DXQA 3W5TA 1G5YA 2YLOA 2ZNPA 3R29A 2VV2A 4ZNUA 4RZEA 2QXMA 5DRMA 5KRIA 3KDTA 3DY6A 2Q1HA 3ILZA 2VV3A 1UHLB 2I0JA 2PIOA 5KD9A 3AZ2A 3G9EA 3B0WA 2G44A 3GBKA 3GWSX 1TFCA 5DYDA 4ZN9A 5KCDA 4X1FA 4NY9A 4M8EA 2QMVA 1VJBA 3L03A 2GTKA 1HG4A 2QR9A 5FQTA 2IHQA 3N00A 2OM9A 1UHLA 2Q60A 3G0WA 2QH6A 1Y0XX 1M13A 5EJVA 4ZOMA 4ZNSA 5DVCA 2GL8A 2P7AA 1RDTA 5HYRA 4J24A 5DKSA 2QE4A 3TKMA 4G2IA 1U3SA 4N73A 5L7GA 3ADTA 1RKGA 2NXXA 3CQVA 1UOMA 4XLDA 4R2UA 4ITFA 1T7TA 4CI4A 2PIUA 3BQDA 2OZ7A 1T76A 3NSPA 3PRGA 3FEJA 4PP3A 3PBAA 4J5WC 3V9VA 2R6YA 4BCRA 3DR1A 2H79A 4ZNTA 4NQAB 2ACLB 2Q7IA 1P8DA 3NOAA 5DIEA 2Q7KA 4PPSA 1X78A 3OKIA 5DZ3A 2GPVA 3R5MA 4ZNVA 3VT9A 4POHA 2AXAA 4IWFA 1NQ0A 5E7VA 5KYAA 1L2JA 4UDAA 3GD2A 2ACLA 2FSZA 4DMAA 2VV4B 2NV7A 3MNEA 4ZN7A 3X31A 1S9PA 2HFPA 3HLVA 3R5NA 4MDDA 4OJ9A 1YA3A 2HBHA 3WTQA 5E0XA 1GWRA 4PF3A 1MZNA 1OT7A 4XHDA 3OMMA 1Y9RA 4WHFA 4OJ4A 5DZIA 4RZFA 3R8AA 3VT6A 3W0IA 1FCXA 5KCUA 3W0CA 2AWHA 3A3ZX 2VV4A 4RUJA 3FEIA 1U3QA 2ZMJA 5C4SA 5APJA 2GPUA 4S15A 3B66A 3WT6A 2ZVTA 3IMYA 3OLSA 1RJKA 2AA2A 5EC9A 4EMAA 3A2IA 4RMDA 5L7HA 2ZLCA 4G1ZA 3WWRA 1XB7A 4ZO1B 5G43A 2QXSA 1EXAA 2W8YA 5DVSA 4IV4A 5JI0D 5E15A 1NQ1A 1TXIA 1YOKA 2HWQA 2PRGA 2Q1VA 4WVDA 4L98A 2QGTA 3AZ3A 5DXPA 4P6WA 1DB1A 1T74A 3CS6A 1XNXA 2Q5SA 2Q59B 5C4TA 2Q8SA 3HM1A 3G8IA 3X1HA 1FM6D 3AURA 2QABA 2BJ4B 1OSVA 4IW6A 3TY0A 5AAVB 1I38A 3DZUD 3B0RA 2J4AA 2YLYA 3D57A 3OMPA 5DUGA 1XDKB 5DRJA 4UDCA 3IPSA 1XQCA 2Q3YA 2ZY0A 5H1EA 2Q59A 4PP5A 3OSAA 1Z5XE 4G2HA 4CI5A 2A3IA 1PDUA 2I4PA 3KYTA 5AAVA 2P7GA 3R8IA 5GICA 2QA8B 1ZKYA 4F9MA 1XDKA 4OEDA 2GIUA 2HAMA 4DORA 5EHJA 5AWKA 1YOWA 4OEYA 3SZ1A 1YYEA 2JF9A 3D24A 3E94A 3ERDA 4PVUA 2QA8A 1FM6A 1EXXA 4OKXA 4PXMA 4ZJWA 4UDDA 5KCCA 3UP3A 3DZUA 2ZK6A 3DT3A 4WPFA 2Q61A 3K22A 3IXPD 5DL4A 2VSRA 4LBDA 2HARA 4OFRA 3KPZA 2P1TA 1X76A 3RLJA 3ET3A 1U3RA 3VJSA 2ZLAA 3W5PA 1N83A 2R40D 1KKQA 3OS9A 1RDTD 4HLWA 4IVYA 5GIDA 1ILHA 3ET0A 4IA3A 3FC6B 3A9EB 3L0LA 1Z5XU 3OZ0A 4LSJA 3VHWA 1P93A 5FQPA 4DOSA 3OGTA 5IXKA 5KRJA 5EI1A 4O8FA 1XNNA 4FHIA 4OKWA 4XAOA 4A4VA 3X1IA 3VRTA 2LBDA 5IAWA 1T73A 1RKHA 4Q0AC 4R6SA 3BC5A 3RVFA 3FC6A 3A9EA 5KR9A 1XIUA 4MGCA 4OILA 5AAUA 2HB8A 5DV6A 2NW4A 4ZI1A 1FM9D 3M7RA 2PIVA 4XUHA 4E4KA 3IXPA 4XT9A 5DTVA 3UU7B 5DI7A 3E00D 4L96A 3U9QA 4FN9A 4MG8B 3CTBA 1L2IA 4S14A 4OFUA 5DWIA 4OIVA 5DXKA 5IZ0A 3HODA 4QK4A 3AUNA 3UUDA 1NRLA 2POGA 2R40A 4G21A 4OEZA 1GWQA 2ZK3A 3FURA 3OSIA 1S0ZA 3O1DA 2H77A 2P4YA 3UU7A 3D5FA 4QE6A 1K4WA 1Y0SA 2PINA 4MG8A 1SJ0A 4TUZB 5DLRA 3VTCA 5JJMB 2YJDA 3E7CA 3RUUA 3VJIA 3UUCA 3VT7A 3PEQA 2ATHA 5KCTA 1T63A 3ZR7A 3A2JA 3OMOA 3KMRA 5KCEA 3VRVA 5DIDA 3WMHA 4IV2A 1H9UA 4RMEA 4TUZA 3P88A 5JJMA 2ZXZA 1FM9A 3UVVB 3E00A 2PITA 3ADSA 2HC4A 2I4ZA 2YHDA 1IE9A 5AVLA 1ZEOA 1S0XA 3ADVA 2YLPA 2AMAA 4JYIA 5KYJA 2J7YA 4XTAA 1XP1A 2XKWA 3UVVA 3OLFA 1XQ3A 1X7JA 4RUOX 1YMTA 4DQMA 3OMQA 1ERRA 2GP7A 2ZNQA 5L11A 3CS4A 1YJEA 1X7EA 1T5ZA 3ADUA 3IPUA 4MG7A 4OIUA 3HZFA 4PWLA 3VRUA 5FQSA 4OC7A 4OZRU 3VJHA 4E2JA 3CDSA 3L3XA 3K23A 3R2AA 2ZNOA 3UUAB 2J7XA 2VV0A 5DY8A 2YJAB 1YP0A 3KWYA 1PZLA 1ZAFA 3WT7A 2AX9A 3GYUA 4R06A 2AA5A 4PLEA 2HVCA 3TKCA 2HWRA 1XJ7A 2PIRA 3ADWA 3L0JA 4N1YA 5DXGA 5AVIA 3F5CB 4IA7A 3AX8A 3W0GA 4A2JA 3JZCA 5KRMA 4Q13A 1PQ9A 4J5WA 3IPQA 5G45A 3H0AA 3B0QA 3FS1A 3PO9A 5AWJA 3UUAA 3VJTA 3OOFA 4ONIA 2P7ZA 4G20A 5E19A 3VT3A 3WT5A 3ZQTA 1S19A 2QTUA 2JFAB 4S0TA 2AO6A 1XOWA 3GWXA 3WFFA 5FQVA 3QT0A 2EWPA 2I0GA 3F5CA 4MGBB 5E0WA 5KRAA 4MG9B 2AX7A 5G44A 3FXVA 4ZNWA 3W5QA 4DM6A 1ZDTA 1SKXA 4FHHA 4IUIA 4S0SA 4CSJA 4J5XC 1YINA 4PLDA 3Q95B 4YNKA 5DK9A 5F9BA 4ZJRA 5DMCA 3VTDA 5AZVA 2GPOA 2JFAA 4JYGA 1I37A 3OS8C 2P15A 1OVLB 4X1GA 3V9YA 4MGBA 2ZK5A 3B65A 3A40X 4MG9A 5DIGA 3WJ4A 1KV6A 3VT8A 2Q70A 4RE8A 5C4OA 3Q95A 1ZH7A 2AA7A 5KRCA 1FD0A 2XHSA 5KRLA 2HB7A 4RAKA 1OVLA 1T65A 1T7MA 3PLZA 4OZTE 4IQRA 4P6XA 3VI8A 2HASA 5JY3A 5DXRA 1XZXX 3H52A 2QZOB 1NAVA 2QSEA 4IVWA 3WFGA 3DZYD 1NHZA 2Q5GA 4A4WA 2NPAA 2PIPL 3B0TA 3JZBA 2Q6SA 3TX7B 2PJLA 2G5OA 1NUOA 2IOGA 1MVCA 2ZK4A 3R8DA 3T03A 4POJA 4RWVA 3CDPA 3HC5A 2AB2A 2POBA 2AX8A 5G42A 2QZOA 4IW8A 5E1CA 2Z4BA 2P1VA 4QJRA 3D90A 4MG6A 2Q7JA 2ZKCA 3B1MA 1KNUA 5KRHA 2XYJA 2ZK2A 3L3ZA 3VHUA 1XLSE 3OMKA 4N8RA 2ZXNA 1BSXA 5DYBA 5DV8A 4OH6A 2ZMIA 5DKBA 3A2HA 1M2ZA 3F7DA 5DWGA 4ITEA 3RUTA 5M96A 2ZASA 3UUDB 1NQ2A 2E2RA 3B67A 1U9EA 3V9TA 5B5BA 5LWPA 4KZIA 1UPWA 2OAXA 2QGWA 2REWA 4J26A 4LNXA 3GN8A 4OZTU 3VSPA 2QPYA 3DZYA 2B1ZA 2V0VA 4MGDB 5EGVA 5G3JA 5SYZA 2AA6A 1SR7A 3O1EA 3LBDA 2V7CA 3OZJA 2YLQA 1XLSA 2VSTA 5APHA 1FCYA 4K4JA 4XUMA 5DP0A 1R5KA 1A52A 2O4JA 1IE8A 5I4VA 3B3KA 4OKTA 4OLMA 5DWEA 4MGDA 2OVMA 5G46A 4HEEX 3AN4A 4JGVA 3VT5A 1NAXA 1EREA 2HCDA 2PIWA 3KFCA 4Q50A 4OZRE 3ADXA 4WHGA 1K74D 5HCVA 1NYXA 1R6GA 2IOKA 1E3GA 3EYBA 3VN2A 1NDEA 1YY4A 2NXXE 3W0JA 1XP9A 4FNEA 2OVHA 2G0GA 2ZL9A 2ZXMA 4IU7A 1G50A 2AMBA 2Q5PA 3SP6A 5HJPB 4LNWA 2B50A 4WLBA 3B5RA 1G1UA 2P54A 4QM0A 1ILGA 4PRGA 1OSHA 3KDUA 2GPPA 5DU5A 3VHVA 4OK1A 2O4RA 2PIXA 5G5WA 4OARA 1YIMA 2XYXA 5ICKA 1UPVA 4RMCA 3VSOA 4MG7B 5HJPA 4NUFA 2G0HA 2QW4A 5DMFA 3H0AD 3AN3A 1NQ7A 1Z95A 3VT4A 5HYKA 3OAPA 4REFA 2XYWA 4IS8A 5DKGA 4YMQA 3P89A 5HZCA 5DWLA 3RY9A 1XPCA 1LV2A 3L0EA 1K74A 3DCUA 4REEA 5HJSA 2GWXA 4PPPA 5DZHA 4IWCA 1WM0X 4N5GA 1GWXA 5E14A 3AUQA 2QNVA 1R20D 4RUPA 3KMGA 1LBDA 2FVJA 4K7AA 5DXBB 1K7LA 1SQNA 3OSWA 2ZFXA 3FLIA 3GYTA 3AFRA 3BEJA 3OOKA 1ZGYA 1XAPA 3ERTA 3OLLA 4MG5A 3UP0A 4IA2A 4OEAA 1QKTA 2QA6A 5DZ0A 3ET1A 3L1BA 5DWJA 4KZJA 5DX3B 3W0YA 1MV9A 5AK2A 5DXBA 2PIQA 1PK5A 4DM8A 4RZGA 2AM9A 3WGPA 1N46A 4EM9A 1Q4XA 4FGYA 5DUEA 2B23A
chains in the Genus database with same CATH topology
1RK3A 4OHAA 4PP6A 5DX3A 3CJWA 3FUGA 4IA1A 3ET2A 2BAWA 2ZK1A 4UDBA 1PQ6A 4ZO1X 2ZBSA 1R1KD 1R20A 1FCZA 3VTBA 3PCUA 3P0UA 4YPQA 3CLDA 5GIEA 1QKNA 4XI3A 2B1VA 3K8SA 1ZDUA 3HC6A 3P8XA 3V4AA 4Y29A 5KRKA 1A28A 1XVPB 1XV9B 4YT1A 5GT4A 2JJ3A 4DK8A 4MGAB 5K13A 5KROA 1T79A 5APKA 5AZTA 1X7BA 5EITA 1PRGA 4LTWA 4APUA 3A78A 5DXMA 3AZ1A 1FBYA 4NB6A 2P1UA 3KBAA 5DSHA 5L7EA 3CWDA 1X7RA 4TV1B 1HJ1A 4NIEA 4QE8A 3W5RA 1XVPA 1M7WA 5DV3A 1XV9A 3MNPA 3DCTA 2ABIA 2J14A 3HO0A 4MGAA 5DXEA 5KRFA 1R1KA 2R6WA 1GS4A 4OJBA 2F4BA 5DVVA 3KMZA 3X36A 2BJ4A 3ZRAA 1PCGA 5CJ6A 3HVLA 3W0AA 3K6PA 1T7FA 4ZNHA 1QKUA 5A86A 3IA6A 5C4UA 2Q6JA 1E3KA 2PNUA 4G1DA 3GZ9A 4TV1A 3WJ5A 5DZ1A 5ETHA 3G8OA 1ZUCA 4K6IA 3VRWA 1XP6A 2FAIA 2O9IA 3RLLA 2ZNNA 2YATA 3B68A 2I4JA 3MNOA 5B41A 3LMPA 4JYHA 3CS8A 3NSQA 4J5XA 5DKEA 3FALB 2AX6A 4OKBA 2VV1B 1QKMA 1PQCA 4OH5A 4WQPA 4JL4A 5LGAA 2YFEA 1G2NA 3V3QA 3D6DA 3HQ5A 3OS8A 5KCFA 5KCWA 4M8HA 1DKFB 4QL8A 2OCFA 3W0HA 3SP9A 4E4QA 3S9SA 2AYRA 1YUCA 1I7GA 2PKLA 4JAZA 4G1YA 2ZMHA 2Q7LA 4OGHA 2ZK0A 4RFWA 3FALA 3V49A 2VV1A 4B7WA 3V3EA 5AYGA 4KZMA 1N4HA 3ZRBA 4DK7A 2AAXA 2OUZA 1I7IA 5ACCA 1S9QA 1DKFA 2Q6RA 1T7RA 2Z4JA 5DUHA 5FQRA 3OKHA 5DXQA 3W5TA 1G5YA 2YLOA 2ZNPA 3R29A 2VV2A 4ZNUA 4RZEA 2QXMA 5DRMA 5KRIA 3KDTA 3DY6A 2Q1HA 3ILZA 2VV3A 1UHLB 2I0JA 2PIOA 5KD9A 3AZ2A 3G9EA 3B0WA 2G44A 3GBKA 3GWSX 1TFCA 5DYDA 4ZN9A 5KCDA 4X1FA 4NY9A 4M8EA 2QMVA 1VJBA 3L03A 2GTKA 1HG4A 2QR9A 5FQTA 2IHQA 3N00A 2OM9A 1UHLA 2Q60A 3G0WA 2QH6A 1Y0XX 1M13A 5EJVA 4ZOMA 4ZNSA 5DVCA 2GL8A 2P7AA 1RDTA 5HYRA 4J24A 5DKSA 2QE4A 3TKMA 4G2IA 1U3SA 4N73A 5L7GA 3ADTA 1RKGA 2NXXA 3CQVA 1UOMA 4XLDA 4R2UA 4ITFA 1T7TA 4CI4A 2PIUA 3BQDA 2OZ7A 1T76A 3NSPA 3PRGA 3FEJA 4PP3A 3PBAA 4J5WC 3V9VA 2R6YA 4BCRA 3DR1A 2H79A 4ZNTA 4NQAB 2ACLB 2Q7IA 1P8DA 3NOAA 5DIEA 2Q7KA 4PPSA 1X78A 3OKIA 5DZ3A 2GPVA 3R5MA 4ZNVA 3VT9A 4POHA 2AXAA 4IWFA 1NQ0A 5E7VA 5KYAA 1L2JA 4UDAA 3GD2A 2ACLA 2FSZA 4DMAA 2VV4B 2NV7A 3MNEA 4ZN7A 3X31A 1S9PA 2HFPA 3HLVA 3R5NA 4MDDA 4OJ9A 1YA3A 2HBHA 3WTQA 5E0XA 1GWRA 4PF3A 1MZNA 1OT7A 4XHDA 3OMMA 1Y9RA 4WHFA 4OJ4A 5DZIA 4RZFA 3R8AA 3VT6A 3W0IA 1FCXA 5KCUA 3W0CA 2AWHA 3A3ZX 2VV4A 4RUJA 3FEIA 1U3QA 2ZMJA 5C4SA 5APJA 2GPUA 4S15A 3B66A 3WT6A 2ZVTA 3IMYA 3OLSA 1RJKA 2AA2A 5EC9A 4EMAA 3A2IA 4RMDA 5L7HA 2ZLCA 4G1ZA 3WWRA 1XB7A 4ZO1B 5G43A 2QXSA 1EXAA 2W8YA 5DVSA 4IV4A 5JI0D 5E15A 1NQ1A 1TXIA 1YOKA 2HWQA 2PRGA 2Q1VA 4WVDA 4L98A 2QGTA 3AZ3A 5DXPA 4P6WA 1DB1A 1T74A 3CS6A 1XNXA 2Q5SA 2Q59B 5C4TA 2Q8SA 3HM1A 3G8IA 3X1HA 1FM6D 3AURA 2QABA 2BJ4B 1OSVA 4IW6A 3TY0A 5AAVB 1I38A 3DZUD 3B0RA 2J4AA 2YLYA 3D57A 3OMPA 5DUGA 1XDKB 5DRJA 4UDCA 3IPSA 1XQCA 2Q3YA 2ZY0A 5H1EA 2Q59A 4PP5A 3OSAA 1Z5XE 4G2HA 4CI5A 2A3IA 1PDUA 2I4PA 3KYTA 5AAVA 2P7GA 3R8IA 5GICA 2QA8B 1ZKYA 4F9MA 1XDKA 4OEDA 2GIUA 2HAMA 4DORA 5EHJA 5AWKA 1YOWA 4OEYA 3SZ1A 1YYEA 2JF9A 3D24A 3E94A 3ERDA 4PVUA 2QA8A 1FM6A 1EXXA 4OKXA 4PXMA 4ZJWA 4UDDA 5KCCA 3UP3A 3DZUA 2ZK6A 3DT3A 4WPFA 2Q61A 3K22A 3IXPD 5DL4A 2VSRA 4LBDA 2HARA 4OFRA 3KPZA 2P1TA 1X76A 3RLJA 3ET3A 1U3RA 3VJSA 2ZLAA 3W5PA 1N83A 2R40D 1KKQA 3OS9A 1RDTD 4HLWA 4IVYA 5GIDA 1ILHA 3ET0A 4IA3A 3FC6B 3A9EB 3L0LA 1Z5XU 3OZ0A 4LSJA 3VHWA 1P93A 5FQPA 4DOSA 3OGTA 5IXKA 5KRJA 5EI1A 4O8FA 1XNNA 4FHIA 4OKWA 4XAOA 4A4VA 3X1IA 3VRTA 2LBDA 5IAWA 1T73A 1RKHA 4Q0AC 4R6SA 3BC5A 3RVFA 3FC6A 3A9EA 5KR9A 1XIUA 4MGCA 4OILA 5AAUA 2HB8A 5DV6A 2NW4A 4ZI1A 1FM9D 3M7RA 2PIVA 4XUHA 4E4KA 3IXPA 4XT9A 5DTVA 3UU7B 5DI7A 3E00D 4L96A 3U9QA 4FN9A 4MG8B 3CTBA 1L2IA 4S14A 4OFUA 5DWIA 4OIVA 5DXKA 5IZ0A 3HODA 4QK4A 3AUNA 3UUDA 1NRLA 2POGA 2R40A 4G21A 4OEZA 1GWQA 2ZK3A 3FURA 3OSIA 1S0ZA 3O1DA 2H77A 2P4YA 3UU7A 3D5FA 4QE6A 1K4WA 1Y0SA 2PINA 4MG8A 1SJ0A 4TUZB 5DLRA 3VTCA 5JJMB 2YJDA 3E7CA 3RUUA 3VJIA 3UUCA 3VT7A 3PEQA 2ATHA 5KCTA 1T63A 3ZR7A 3A2JA 3OMOA 3KMRA 5KCEA 3VRVA 5DIDA 3WMHA 4IV2A 1H9UA 4RMEA 4TUZA 3P88A 5JJMA 2ZXZA 1FM9A 3UVVB 3E00A 2PITA 3ADSA 2HC4A 2I4ZA 2YHDA 1IE9A 5AVLA 1ZEOA 1S0XA 3ADVA 2YLPA 2AMAA 4JYIA 5KYJA 2J7YA 4XTAA 1XP1A 2XKWA 3UVVA 3OLFA 1XQ3A 1X7JA 4RUOX 1YMTA 4DQMA 3OMQA 1ERRA 2GP7A 2ZNQA 5L11A 3CS4A 1YJEA 1X7EA 1T5ZA 3ADUA 3IPUA 4MG7A 4OIUA 3HZFA 4PWLA 3VRUA 5FQSA 4OC7A 4OZRU 3VJHA 4E2JA 3CDSA 3L3XA 3K23A 3R2AA 2ZNOA 3UUAB 2J7XA 2VV0A 5DY8A 2YJAB 1YP0A 3KWYA 1PZLA 1ZAFA 3WT7A 2AX9A 3GYUA 4R06A 2AA5A 4PLEA 2HVCA 3TKCA 2HWRA 1XJ7A 2PIRA 3ADWA 3L0JA 4N1YA 5DXGA 5AVIA 3F5CB 4IA7A 3AX8A 3W0GA 4A2JA 3JZCA 5KRMA 4Q13A 1PQ9A 4J5WA 3IPQA 5G45A 3H0AA 3B0QA 3FS1A 3PO9A 5AWJA 3UUAA 3VJTA 3OOFA 4ONIA 2P7ZA 4G20A 5E19A 3VT3A 3WT5A 3ZQTA 1S19A 2QTUA 2JFAB 4S0TA 2AO6A 1XOWA 3GWXA 3WFFA 5FQVA 3QT0A 2EWPA 2I0GA 3F5CA 4MGBB 5E0WA 5KRAA 4MG9B 2AX7A 5G44A 3FXVA 4ZNWA 3W5QA 4DM6A 1ZDTA 1SKXA 4FHHA 4IUIA 4S0SA 4CSJA 4J5XC 1YINA 4PLDA 3Q95B 4YNKA 5DK9A 5F9BA 4ZJRA 5DMCA 3VTDA 5AZVA 2GPOA 2JFAA 4JYGA 1I37A 3OS8C 2P15A 1OVLB 4X1GA 3V9YA 4MGBA 2ZK5A 3B65A 3A40X 4MG9A 5DIGA 3WJ4A 1KV6A 3VT8A 2Q70A 4RE8A 5C4OA 3Q95A 1ZH7A 2AA7A 5KRCA 1FD0A 2XHSA 5KRLA 2HB7A 4RAKA 1OVLA 1T65A 1T7MA 3PLZA 4OZTE 4IQRA 4P6XA 3VI8A 2HASA 5JY3A 5DXRA 1XZXX 3H52A 2QZOB 1NAVA 2QSEA 4IVWA 3WFGA 3DZYD 1NHZA 2Q5GA 4A4WA 2NPAA 2PIPL 3B0TA 3JZBA 2Q6SA 3TX7B 2PJLA 2G5OA 1NUOA 2IOGA 1MVCA 2ZK4A 3R8DA 3T03A 4POJA 4RWVA 3CDPA 3HC5A 2AB2A 2POBA 2AX8A 5G42A 2QZOA 4IW8A 5E1CA 2Z4BA 2P1VA 4QJRA 3D90A 4MG6A 2Q7JA 2ZKCA 3B1MA 1KNUA 5KRHA 2XYJA 2ZK2A 3L3ZA 3VHUA 1XLSE 3OMKA 4N8RA 2ZXNA 1BSXA 5DYBA 5DV8A 4OH6A 2ZMIA 5DKBA 3A2HA 1M2ZA 3F7DA 5DWGA 4ITEA 3RUTA 5M96A 2ZASA 3UUDB 1NQ2A 2E2RA 3B67A 1U9EA 3V9TA 5B5BA 5LWPA 4KZIA 1UPWA 2OAXA 2QGWA 2REWA 4J26A 4LNXA 3GN8A 4OZTU 3VSPA 2QPYA 3DZYA 2B1ZA 2V0VA 4MGDB 5EGVA 5G3JA 5SYZA 2AA6A 1SR7A 3O1EA 3LBDA 2V7CA 3OZJA 2YLQA 1XLSA 2VSTA 5APHA 1FCYA 4K4JA 4XUMA 5DP0A 1R5KA 1A52A 2O4JA 1IE8A 5I4VA 3B3KA 4OKTA 4OLMA 5DWEA 4MGDA 2OVMA 5G46A 4HEEX 3AN4A 4JGVA 3VT5A 1NAXA 1EREA 2HCDA 2PIWA 3KFCA 4Q50A 4OZRE 3ADXA 4WHGA 1K74D 5HCVA 1NYXA 1R6GA 2IOKA 1E3GA 3EYBA 3VN2A 1NDEA 1YY4A 2NXXE 3W0JA 1XP9A 4FNEA 2OVHA 2G0GA 2ZL9A 2ZXMA 4IU7A 1G50A 2AMBA 2Q5PA 3SP6A 5HJPB 4LNWA 2B50A 4WLBA 3B5RA 1G1UA 2P54A 4QM0A 1ILGA 4PRGA 1OSHA 3KDUA 2GPPA 5DU5A 3VHVA 4OK1A 2O4RA 2PIXA 5G5WA 4OARA 1YIMA 2XYXA 5ICKA 1UPVA 4RMCA 3VSOA 4MG7B 5HJPA 4NUFA 2G0HA 2QW4A 5DMFA 3H0AD 3AN3A 1NQ7A 1Z95A 3VT4A 5HYKA 3OAPA 4REFA 2XYWA 4IS8A 5DKGA 4YMQA 3P89A 5HZCA 5DWLA 3RY9A 1XPCA 1LV2A 3L0EA 1K74A 3DCUA 4REEA 5HJSA 2GWXA 4PPPA 5DZHA 4IWCA 1WM0X 4N5GA 1GWXA 5E14A 3AUQA 2QNVA 1R20D 4RUPA 3KMGA 1LBDA 2FVJA 4K7AA 5DXBB 1K7LA 1SQNA 3OSWA 2ZFXA 3FLIA 3GYTA 3AFRA 3BEJA 3OOKA 1ZGYA 1XAPA 3ERTA 3OLLA 4MG5A 3UP0A 4IA2A 4OEAA 1QKTA 2QA6A 5DZ0A 3ET1A 3L1BA 5DWJA 4KZJA 5DX3B 3W0YA 1MV9A 5AK2A 5DXBA 2PIQA 1PK5A 4DM8A 4RZGA 2AM9A 3WGPA 1N46A 4EM9A 1Q4XA 4FGYA 5DUEA 2B23A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RK3 A;  4OHA A;  4PP6 A;  5DX3 A;  3CJW A;  3FUG A;  4IA1 A;  3ET2 A;  2BAW A;  2ZK1 A;  4UDB A;  1PQ6 A;  4ZO1 X;  2ZBS A;  1R1K D;  1R20 A;  1FCZ A;  3VTB A;  3PCU A;  3P0U A;  4YPQ A;  3CLD A;  5GIE A;  1QKN A;  4XI3 A;  2B1V A;  3K8S A;  1ZDU A;  3HC6 A;  3P8X A;  3V4A A;  4Y29 A;  5KRK A;  1A28 A;  1XVP B;  1XV9 B;  4YT1 A;  5GT4 A;  2JJ3 A;  4DK8 A;  4MGA B;  5K13 A;  5KRO A;  1T79 A;  5APK A;  5AZT A;  1X7B A;  5EIT A;  1PRG A;  4LTW A;  4APU A;  3A78 A;  5DXM A;  3AZ1 A;  1FBY A;  4NB6 A;  2P1U A;  3KBA A;  5DSH A;  5L7E A;  3CWD A;  1X7R A;  4TV1 B;  1HJ1 A;  4NIE A;  4QE8 A;  3W5R A;  1XVP A;  1M7W A;  5DV3 A;  1XV9 A;  3MNP A;  3DCT A;  2ABI A;  2J14 A;  3HO0 A;  4MGA A;  5DXE A;  5KRF A;  1R1K A;  2R6W A;  1GS4 A;  4OJB A;  2F4B A;  5DVV A;  3KMZ A;  3X36 A;  2BJ4 A;  3ZRA A;  1PCG A;  5CJ6 A;  3HVL A;  3W0A A;  3K6P A;  1T7F A;  4ZNH A;  1QKU A;  5A86 A;  3IA6 A;  5C4U A;  2Q6J A;  1E3K A;  2PNU A;  4G1D A;  3GZ9 A;  4TV1 A;  3WJ5 A;  5DZ1 A;  5ETH A;  3G8O A;  1ZUC A;  4K6I A;  3VRW A;  1XP6 A;  2FAI A;  2O9I A;  3RLL A;  2ZNN A;  2YAT A;  3B68 A;  2I4J A;  3MNO A;  5B41 A;  3LMP A;  4JYH A;  3CS8 A;  3NSQ A;  4J5X A;  5DKE A;  3FAL B;  2AX6 A;  4OKB A;  2VV1 B;  1QKM A;  1PQC A;  4OH5 A;  4WQP A;  4JL4 A;  5LGA A;  2YFE A;  1G2N A;  3V3Q A;  3D6D A;  3HQ5 A;  3OS8 A;  5KCF A;  5KCW A;  4M8H A;  1DKF B;  4QL8 A;  2OCF A;  3W0H A;  3SP9 A;  4E4Q A;  3S9S A;  2AYR A;  1YUC A;  1I7G A;  2PKL A;  4JAZ A;  4G1Y A;  2ZMH A;  2Q7L A;  4OGH A;  2ZK0 A;  4RFW A;  3FAL A;  3V49 A;  2VV1 A;  4B7W A;  3V3E A;  5AYG A;  4KZM A;  1N4H A;  3ZRB A;  4DK7 A;  2AAX A;  2OUZ A;  1I7I A;  5ACC A;  1S9Q A;  1DKF A;  2Q6R A;  1T7R A;  2Z4J A;  5DUH A;  5FQR A;  3OKH A;  5DXQ A;  3W5T A;  1G5Y A;  2YLO A;  2ZNP A;  3R29 A;  2VV2 A;  4ZNU A;  4RZE A;  2QXM A;  5DRM A;  5KRI A;  3KDT A;  3DY6 A;  2Q1H A;  3ILZ A;  2VV3 A;  1UHL B;  2I0J A;  2PIO A;  5KD9 A;  3AZ2 A;  3G9E A;  3B0W A;  2G44 A;  3GBK A;  3GWS X;  1TFC A;  5DYD A;  4ZN9 A;  5KCD A;  4X1F A;  4NY9 A;  4M8E A;  2QMV A;  1VJB A;  3L03 A;  2GTK A;  1HG4 A;  2QR9 A;  5FQT A;  2IHQ A;  3N00 A;  2OM9 A;  1UHL A;  2Q60 A;  3G0W A;  2QH6 A;  1Y0X X;  1M13 A;  5EJV A;  4ZOM A;  4ZNS A;  5DVC A;  2GL8 A;  2P7A A;  1RDT A;  5HYR A;  4J24 A;  5DKS A;  2QE4 A;  3TKM A;  4G2I A;  1U3S A;  4N73 A;  5L7G A;  3ADT A;  1RKG A;  2NXX A;  3CQV A;  1UOM A;  4XLD A;  4R2U A;  4ITF A;  1T7T A;  4CI4 A;  2PIU A;  3BQD A;  2OZ7 A;  1T76 A;  3NSP A;  3PRG A;  3FEJ A;  4PP3 A;  3PBA A;  4J5W C;  3V9V A;  2R6Y A;  4BCR A;  3DR1 A;  2H79 A;  4ZNT A;  4NQA B;  2ACL B;  2Q7I A;  1P8D A;  3NOA A;  5DIE A;  2Q7K A;  4PPS A;  1X78 A;  3OKI A;  5DZ3 A;  2GPV A;  3R5M A;  4ZNV A;  3VT9 A;  4POH A;  2AXA A;  4IWF A;  1NQ0 A;  5E7V A;  5KYA A;  1L2J A;  4UDA A;  3GD2 A;  2ACL A;  2FSZ A;  4DMA A;  2VV4 B;  2NV7 A;  3MNE A;  4ZN7 A;  3X31 A;  1S9P A;  2HFP A;  3HLV A;  3R5N A;  4MDD A;  4OJ9 A;  1YA3 A;  2HBH A;  3WTQ A;  5E0X A;  1GWR A;  4PF3 A;  1MZN A;  1OT7 A;  4XHD A;  3OMM A;  1Y9R A;  4WHF A;  4OJ4 A;  5DZI A;  4RZF A;  3R8A A;  3VT6 A;  3W0I A;  1FCX A;  5KCU A;  3W0C A;  2AWH A;  3A3Z X;  2VV4 A;  4RUJ A;  3FEI A;  1U3Q A;  2ZMJ A;  5C4S A;  5APJ A;  2GPU A;  4S15 A;  3B66 A;  3WT6 A;  2ZVT A;  3IMY A;  3OLS A;  1RJK A;  2AA2 A;  5EC9 A;  4EMA A;  3A2I A;  4RMD A;  5L7H A;  2ZLC A;  4G1Z A;  3WWR A;  1XB7 A;  4ZO1 B;  5G43 A;  2QXS A;  1EXA A;  2W8Y A;  5DVS A;  4IV4 A;  5JI0 D;  5E15 A;  1NQ1 A;  1TXI A;  1YOK A;  2HWQ A;  2PRG A;  2Q1V A;  4WVD A;  4L98 A;  2QGT A;  3AZ3 A;  5DXP A;  4P6W A;  1DB1 A;  1T74 A;  3CS6 A;  1XNX A;  2Q5S A;  2Q59 B;  5C4T A;  2Q8S A;  3HM1 A;  3G8I A;  3X1H A;  1FM6 D;  3AUR A;  2QAB A;  2BJ4 B;  1OSV A;  4IW6 A;  3TY0 A;  5AAV B;  1I38 A;  3DZU D;  3B0R A;  2J4A A;  2YLY A;  3D57 A;  3OMP A;  5DUG A;  1XDK B;  5DRJ A;  4UDC A;  3IPS A;  1XQC A;  2Q3Y A;  2ZY0 A;  5H1E A;  2Q59 A;  4PP5 A;  3OSA A;  1Z5X E;  4G2H A;  4CI5 A;  2A3I A;  1PDU A;  2I4P A;  3KYT A;  5AAV A;  2P7G A;  3R8I A;  5GIC A;  2QA8 B;  1ZKY A;  4F9M A;  1XDK A;  4OED A;  2GIU A;  2HAM A;  4DOR A;  5EHJ A;  5AWK A;  1YOW A;  4OEY A;  3SZ1 A;  1YYE A;  2JF9 A;  3D24 A;  3E94 A;  3ERD A;  4PVU A;  2QA8 A;  1FM6 A;  1EXX A;  4OKX A;  4PXM A;  4ZJW A;  4UDD A;  5KCC A;  3UP3 A;  3DZU A;  2ZK6 A;  3DT3 A;  4WPF A;  2Q61 A;  3K22 A;  3IXP D;  5DL4 A;  2VSR A;  4LBD A;  2HAR A;  4OFR A;  3KPZ A;  2P1T A;  1X76 A;  3RLJ A;  3ET3 A;  1U3R A;  3VJS A;  2ZLA A;  3W5P A;  1N83 A;  2R40 D;  1KKQ A;  3OS9 A;  1RDT D;  4HLW A;  4IVY A;  5GID A;  1ILH A;  3ET0 A;  4IA3 A;  3FC6 B;  3A9E B;  3L0L A;  1Z5X U;  3OZ0 A;  4LSJ A;  3VHW A;  1P93 A;  5FQP A;  4DOS A;  3OGT A;  5IXK A;  5KRJ A;  5EI1 A;  4O8F A;  1XNN A;  4FHI A;  4OKW A;  4XAO A;  4A4V A;  3X1I A;  3VRT A;  2LBD A;  5IAW A;  1T73 A;  1RKH A;  4Q0A C;  4R6S A;  3BC5 A;  3RVF A;  3FC6 A;  3A9E A;  5KR9 A;  1XIU A;  4MGC A;  4OIL A;  5AAU A;  2HB8 A;  5DV6 A;  2NW4 A;  4ZI1 A;  1FM9 D;  3M7R A;  2PIV A;  4XUH A;  4E4K A;  3IXP A;  4XT9 A;  5DTV A;  3UU7 B;  5DI7 A;  3E00 D;  4L96 A;  3U9Q A;  4FN9 A;  4MG8 B;  3CTB A;  1L2I A;  4S14 A;  4OFU A;  5DWI A;  4OIV A;  5DXK A;  5IZ0 A;  3HOD A;  4QK4 A;  3AUN A;  3UUD A;  1NRL A;  2POG A;  2R40 A;  4G21 A;  4OEZ A;  1GWQ A;  2ZK3 A;  3FUR A;  3OSI A;  1S0Z A;  3O1D A;  2H77 A;  2P4Y A;  3UU7 A;  3D5F A;  4QE6 A;  1K4W A;  1Y0S A;  2PIN A;  4MG8 A;  1SJ0 A;  4TUZ B;  5DLR A;  3VTC A;  5JJM B;  2YJD A;  3E7C A;  3RUU A;  3VJI A;  3UUC A;  3VT7 A;  3PEQ A;  2ATH A;  5KCT A;  1T63 A;  3ZR7 A;  3A2J A;  3OMO A;  3KMR A;  5KCE A;  3VRV A;  5DID A;  3WMH A;  4IV2 A;  1H9U A;  4RME A;  4TUZ A;  3P88 A;  5JJM A;  2ZXZ A;  1FM9 A;  3UVV B;  3E00 A;  2PIT A;  3ADS A;  2HC4 A;  2I4Z A;  2YHD A;  1IE9 A;  5AVL A;  1ZEO A;  1S0X A;  3ADV A;  2YLP A;  2AMA A;  4JYI A;  5KYJ A;  2J7Y A;  4XTA A;  1XP1 A;  2XKW A;  3UVV A;  3OLF A;  1XQ3 A;  1X7J A;  4RUO X;  1YMT A;  4DQM A;  3OMQ A;  1ERR A;  2GP7 A;  2ZNQ A;  5L11 A;  3CS4 A;  1YJE A;  1X7E A;  1T5Z A;  3ADU A;  3IPU A;  4MG7 A;  4OIU A;  3HZF A;  4PWL A;  3VRU A;  5FQS A;  4OC7 A;  4OZR U;  3VJH A;  4E2J A;  3CDS A;  3L3X A;  3K23 A;  3R2A A;  2ZNO A;  3UUA B;  2J7X A;  2VV0 A;  5DY8 A;  2YJA B;  1YP0 A;  3KWY A;  1PZL A;  1ZAF A;  3WT7 A;  2AX9 A;  3GYU A;  4R06 A;  2AA5 A;  4PLE A;  2HVC A;  3TKC A;  2HWR A;  1XJ7 A;  2PIR A;  3ADW A;  3L0J A;  4N1Y A;  5DXG A;  5AVI A;  3F5C B;  4IA7 A;  3AX8 A;  3W0G A;  4A2J A;  3JZC A;  5KRM A;  4Q13 A;  1PQ9 A;  4J5W A;  3IPQ A;  5G45 A;  3H0A A;  3B0Q A;  3FS1 A;  3PO9 A;  5AWJ A;  3UUA A;  3VJT A;  3OOF A;  4ONI A;  2P7Z A;  4G20 A;  5E19 A;  3VT3 A;  3WT5 A;  3ZQT A;  1S19 A;  2QTU A;  2JFA B;  4S0T A;  2AO6 A;  1XOW A;  3GWX A;  3WFF A;  5FQV A;  3QT0 A;  2EWP A;  2I0G A;  3F5C A;  4MGB B;  5E0W A;  5KRA A;  4MG9 B;  2AX7 A;  5G44 A;  3FXV A;  4ZNW A;  3W5Q A;  4DM6 A;  1ZDT A;  1SKX A;  4FHH A;  4IUI A;  4S0S A;  4CSJ A;  4J5X C;  1YIN A;  4PLD A;  3Q95 B;  4YNK A;  5DK9 A;  5F9B A;  4ZJR A;  5DMC A;  3VTD A;  5AZV A;  2GPO A;  2JFA A;  4JYG A;  1I37 A;  3OS8 C;  2P15 A;  1OVL B;  4X1G A;  3V9Y A;  4MGB A;  2ZK5 A;  3B65 A;  3A40 X;  4MG9 A;  5DIG A;  3WJ4 A;  1KV6 A;  3VT8 A;  2Q70 A;  4RE8 A;  5C4O A;  3Q95 A;  1ZH7 A;  2AA7 A;  5KRC A;  1FD0 A;  2XHS A;  5KRL A;  2HB7 A;  4RAK A;  1OVL A;  1T65 A;  1T7M A;  3PLZ A;  4OZT E;  4IQR A;  4P6X A;  3VI8 A;  2HAS A;  5JY3 A;  5DXR A;  1XZX X;  3H52 A;  2QZO B;  1NAV A;  2QSE A;  4IVW A;  3WFG A;  3DZY D;  1NHZ A;  2Q5G A;  4A4W A;  2NPA A;  2PIP L;  3B0T A;  3JZB A;  2Q6S A;  3TX7 B;  2PJL A;  2G5O A;  1NUO A;  2IOG A;  1MVC A;  2ZK4 A;  3R8D A;  3T03 A;  4POJ A;  4RWV A;  3CDP A;  3HC5 A;  2AB2 A;  2POB A;  2AX8 A;  5G42 A;  2QZO A;  4IW8 A;  5E1C A;  2Z4B A;  2P1V A;  4QJR A;  3D90 A;  4MG6 A;  2Q7J A;  2ZKC A;  3B1M A;  1KNU A;  5KRH A;  2XYJ A;  2ZK2 A;  3L3Z A;  3VHU A;  1XLS E;  3OMK A;  4N8R A;  2ZXN A;  1BSX A;  5DYB A;  5DV8 A;  4OH6 A;  2ZMI A;  5DKB A;  3A2H A;  1M2Z A;  3F7D A;  5DWG A;  4ITE A;  3RUT A;  5M96 A;  2ZAS A;  3UUD B;  1NQ2 A;  2E2R A;  3B67 A;  1U9E A;  3V9T A;  5B5B A;  5LWP A;  4KZI A;  1UPW A;  2OAX A;  2QGW A;  2REW A;  4J26 A;  4LNX A;  3GN8 A;  4OZT U;  3VSP A;  2QPY A;  3DZY A;  2B1Z A;  2V0V A;  4MGD B;  5EGV A;  5G3J A;  5SYZ A;  2AA6 A;  1SR7 A;  3O1E A;  3LBD A;  2V7C A;  3OZJ A;  2YLQ A;  1XLS A;  2VST A;  5APH A;  1FCY A;  4K4J A;  4XUM A;  5DP0 A;  1R5K A;  1A52 A;  2O4J A;  1IE8 A;  5I4V A;  3B3K A;  4OKT A;  4OLM A;  5DWE A;  4MGD A;  2OVM A;  5G46 A;  4HEE X;  3AN4 A;  4JGV A;  3VT5 A;  1NAX A;  1ERE A;  2HCD A;  2PIW A;  3KFC A;  4Q50 A;  4OZR E;  3ADX A;  4WHG A;  1K74 D;  5HCV A;  1NYX A;  1R6G A;  2IOK A;  1E3G A;  3EYB A;  3VN2 A;  1NDE A;  1YY4 A;  2NXX E;  3W0J A;  1XP9 A;  4FNE A;  2OVH A;  2G0G A;  2ZL9 A;  2ZXM A;  4IU7 A;  1G50 A;  2AMB A;  2Q5P A;  3SP6 A;  5HJP B;  4LNW A;  2B50 A;  4WLB A;  3B5R A;  1G1U A;  2P54 A;  4QM0 A;  1ILG A;  4PRG A;  1OSH A;  3KDU A;  2GPP A;  5DU5 A;  3VHV A;  4OK1 A;  2O4R A;  2PIX A;  5G5W A;  4OAR A;  1YIM A;  2XYX A;  5ICK A;  1UPV A;  4RMC A;  3VSO A;  4MG7 B;  5HJP A;  4NUF A;  2G0H A;  2QW4 A;  5DMF A;  3H0A D;  3AN3 A;  1NQ7 A;  1Z95 A;  3VT4 A;  5HYK A;  3OAP A;  4REF A;  2XYW A;  4IS8 A;  5DKG A;  4YMQ A;  3P89 A;  5HZC A;  5DWL A;  3RY9 A;  1XPC A;  1LV2 A;  3L0E A;  1K74 A;  3DCU A;  4REE A;  5HJS A;  2GWX A;  4PPP A;  5DZH A;  4IWC A;  1WM0 X;  4N5G A;  1GWX A;  5E14 A;  3AUQ A;  2QNV A;  1R20 D;  4RUP A;  3KMG A;  1LBD A;  2FVJ A;  4K7A A;  5DXB B;  1K7L A;  1SQN A;  3OSW A;  2ZFX A;  3FLI A;  3GYT A;  3AFR A;  3BEJ A;  3OOK A;  1ZGY A;  1XAP A;  3ERT A;  3OLL A;  4MG5 A;  3UP0 A;  4IA2 A;  4OEA A;  1QKT A;  2QA6 A;  5DZ0 A;  3ET1 A;  3L1B A;  5DWJ A;  4KZJ A;  5DX3 B;  3W0Y A;  1MV9 A;  5AK2 A;  5DXB A;  2PIQ A;  1PK5 A;  4DM8 A;  4RZG A;  2AM9 A;  3WGP A;  1N46 A;  4EM9 A;  1Q4X A;  4FGY A;  5DUE A;  2B23 A; 
#chains in the Genus database with same CATH topology
 1RK3 A;  4OHA A;  4PP6 A;  5DX3 A;  3CJW A;  3FUG A;  4IA1 A;  3ET2 A;  2BAW A;  2ZK1 A;  4UDB A;  1PQ6 A;  4ZO1 X;  2ZBS A;  1R1K D;  1R20 A;  1FCZ A;  3VTB A;  3PCU A;  3P0U A;  4YPQ A;  3CLD A;  5GIE A;  1QKN A;  4XI3 A;  2B1V A;  3K8S A;  1ZDU A;  3HC6 A;  3P8X A;  3V4A A;  4Y29 A;  5KRK A;  1A28 A;  1XVP B;  1XV9 B;  4YT1 A;  5GT4 A;  2JJ3 A;  4DK8 A;  4MGA B;  5K13 A;  5KRO A;  1T79 A;  5APK A;  5AZT A;  1X7B A;  5EIT A;  1PRG A;  4LTW A;  4APU A;  3A78 A;  5DXM A;  3AZ1 A;  1FBY A;  4NB6 A;  2P1U A;  3KBA A;  5DSH A;  5L7E A;  3CWD A;  1X7R A;  4TV1 B;  1HJ1 A;  4NIE A;  4QE8 A;  3W5R A;  1XVP A;  1M7W A;  5DV3 A;  1XV9 A;  3MNP A;  3DCT A;  2ABI A;  2J14 A;  3HO0 A;  4MGA A;  5DXE A;  5KRF A;  1R1K A;  2R6W A;  1GS4 A;  4OJB A;  2F4B A;  5DVV A;  3KMZ A;  3X36 A;  2BJ4 A;  3ZRA A;  1PCG A;  5CJ6 A;  3HVL A;  3W0A A;  3K6P A;  1T7F A;  4ZNH A;  1QKU A;  5A86 A;  3IA6 A;  5C4U A;  2Q6J A;  1E3K A;  2PNU A;  4G1D A;  3GZ9 A;  4TV1 A;  3WJ5 A;  5DZ1 A;  5ETH A;  3G8O A;  1ZUC A;  4K6I A;  3VRW A;  1XP6 A;  2FAI A;  2O9I A;  3RLL A;  2ZNN A;  2YAT A;  3B68 A;  2I4J A;  3MNO A;  5B41 A;  3LMP A;  4JYH A;  3CS8 A;  3NSQ A;  4J5X A;  5DKE A;  3FAL B;  2AX6 A;  4OKB A;  2VV1 B;  1QKM A;  1PQC A;  4OH5 A;  4WQP A;  4JL4 A;  5LGA A;  2YFE A;  1G2N A;  3V3Q A;  3D6D A;  3HQ5 A;  3OS8 A;  5KCF A;  5KCW A;  4M8H A;  1DKF B;  4QL8 A;  2OCF A;  3W0H A;  3SP9 A;  4E4Q A;  3S9S A;  2AYR A;  1YUC A;  1I7G A;  2PKL A;  4JAZ A;  4G1Y A;  2ZMH A;  2Q7L A;  4OGH A;  2ZK0 A;  4RFW A;  3FAL A;  3V49 A;  2VV1 A;  4B7W A;  3V3E A;  5AYG A;  4KZM A;  1N4H A;  3ZRB A;  4DK7 A;  2AAX A;  2OUZ A;  1I7I A;  5ACC A;  1S9Q A;  1DKF A;  2Q6R A;  1T7R A;  2Z4J A;  5DUH A;  5FQR A;  3OKH A;  5DXQ A;  3W5T A;  1G5Y A;  2YLO A;  2ZNP A;  3R29 A;  2VV2 A;  4ZNU A;  4RZE A;  2QXM A;  5DRM A;  5KRI A;  3KDT A;  3DY6 A;  2Q1H A;  3ILZ A;  2VV3 A;  1UHL B;  2I0J A;  2PIO A;  5KD9 A;  3AZ2 A;  3G9E A;  3B0W A;  2G44 A;  3GBK A;  3GWS X;  1TFC A;  5DYD A;  4ZN9 A;  5KCD A;  4X1F A;  4NY9 A;  4M8E A;  2QMV A;  1VJB A;  3L03 A;  2GTK A;  1HG4 A;  2QR9 A;  5FQT A;  2IHQ A;  3N00 A;  2OM9 A;  1UHL A;  2Q60 A;  3G0W A;  2QH6 A;  1Y0X X;  1M13 A;  5EJV A;  4ZOM A;  4ZNS A;  5DVC A;  2GL8 A;  2P7A A;  1RDT A;  5HYR A;  4J24 A;  5DKS A;  2QE4 A;  3TKM A;  4G2I A;  1U3S A;  4N73 A;  5L7G A;  3ADT A;  1RKG A;  2NXX A;  3CQV A;  1UOM A;  4XLD A;  4R2U A;  4ITF A;  1T7T A;  4CI4 A;  2PIU A;  3BQD A;  2OZ7 A;  1T76 A;  3NSP A;  3PRG A;  3FEJ A;  4PP3 A;  3PBA A;  4J5W C;  3V9V A;  2R6Y A;  4BCR A;  3DR1 A;  2H79 A;  4ZNT A;  4NQA B;  2ACL B;  2Q7I A;  1P8D A;  3NOA A;  5DIE A;  2Q7K A;  4PPS A;  1X78 A;  3OKI A;  5DZ3 A;  2GPV A;  3R5M A;  4ZNV A;  3VT9 A;  4POH A;  2AXA A;  4IWF A;  1NQ0 A;  5E7V A;  5KYA A;  1L2J A;  4UDA A;  3GD2 A;  2ACL A;  2FSZ A;  4DMA A;  2VV4 B;  2NV7 A;  3MNE A;  4ZN7 A;  3X31 A;  1S9P A;  2HFP A;  3HLV A;  3R5N A;  4MDD A;  4OJ9 A;  1YA3 A;  2HBH A;  3WTQ A;  5E0X A;  1GWR A;  4PF3 A;  1MZN A;  1OT7 A;  4XHD A;  3OMM A;  1Y9R A;  4WHF A;  4OJ4 A;  5DZI A;  4RZF A;  3R8A A;  3VT6 A;  3W0I A;  1FCX A;  5KCU A;  3W0C A;  2AWH A;  3A3Z X;  2VV4 A;  4RUJ A;  3FEI A;  1U3Q A;  2ZMJ A;  5C4S A;  5APJ A;  2GPU A;  4S15 A;  3B66 A;  3WT6 A;  2ZVT A;  3IMY A;  3OLS A;  1RJK A;  2AA2 A;  5EC9 A;  4EMA A;  3A2I A;  4RMD A;  5L7H A;  2ZLC A;  4G1Z A;  3WWR A;  1XB7 A;  4ZO1 B;  5G43 A;  2QXS A;  1EXA A;  2W8Y A;  5DVS A;  4IV4 A;  5JI0 D;  5E15 A;  1NQ1 A;  1TXI A;  1YOK A;  2HWQ A;  2PRG A;  2Q1V A;  4WVD A;  4L98 A;  2QGT A;  3AZ3 A;  5DXP A;  4P6W A;  1DB1 A;  1T74 A;  3CS6 A;  1XNX A;  2Q5S A;  2Q59 B;  5C4T A;  2Q8S A;  3HM1 A;  3G8I A;  3X1H A;  1FM6 D;  3AUR A;  2QAB A;  2BJ4 B;  1OSV A;  4IW6 A;  3TY0 A;  5AAV B;  1I38 A;  3DZU D;  3B0R A;  2J4A A;  2YLY A;  3D57 A;  3OMP A;  5DUG A;  1XDK B;  5DRJ A;  4UDC A;  3IPS A;  1XQC A;  2Q3Y A;  2ZY0 A;  5H1E A;  2Q59 A;  4PP5 A;  3OSA A;  1Z5X E;  4G2H A;  4CI5 A;  2A3I A;  1PDU A;  2I4P A;  3KYT A;  5AAV A;  2P7G A;  3R8I A;  5GIC A;  2QA8 B;  1ZKY A;  4F9M A;  1XDK A;  4OED A;  2GIU A;  2HAM A;  4DOR A;  5EHJ A;  5AWK A;  1YOW A;  4OEY A;  3SZ1 A;  1YYE A;  2JF9 A;  3D24 A;  3E94 A;  3ERD A;  4PVU A;  2QA8 A;  1FM6 A;  1EXX A;  4OKX A;  4PXM A;  4ZJW A;  4UDD A;  5KCC A;  3UP3 A;  3DZU A;  2ZK6 A;  3DT3 A;  4WPF A;  2Q61 A;  3K22 A;  3IXP D;  5DL4 A;  2VSR A;  4LBD A;  2HAR A;  4OFR A;  3KPZ A;  2P1T A;  1X76 A;  3RLJ A;  3ET3 A;  1U3R A;  3VJS A;  2ZLA A;  3W5P A;  1N83 A;  2R40 D;  1KKQ A;  3OS9 A;  1RDT D;  4HLW A;  4IVY A;  5GID A;  1ILH A;  3ET0 A;  4IA3 A;  3FC6 B;  3A9E B;  3L0L A;  1Z5X U;  3OZ0 A;  4LSJ A;  3VHW A;  1P93 A;  5FQP A;  4DOS A;  3OGT A;  5IXK A;  5KRJ A;  5EI1 A;  4O8F A;  1XNN A;  4FHI A;  4OKW A;  4XAO A;  4A4V A;  3X1I A;  3VRT A;  2LBD A;  5IAW A;  1T73 A;  1RKH A;  4Q0A C;  4R6S A;  3BC5 A;  3RVF A;  3FC6 A;  3A9E A;  5KR9 A;  1XIU A;  4MGC A;  4OIL A;  5AAU A;  2HB8 A;  5DV6 A;  2NW4 A;  4ZI1 A;  1FM9 D;  3M7R A;  2PIV A;  4XUH A;  4E4K A;  3IXP A;  4XT9 A;  5DTV A;  3UU7 B;  5DI7 A;  3E00 D;  4L96 A;  3U9Q A;  4FN9 A;  4MG8 B;  3CTB A;  1L2I A;  4S14 A;  4OFU A;  5DWI A;  4OIV A;  5DXK A;  5IZ0 A;  3HOD A;  4QK4 A;  3AUN A;  3UUD A;  1NRL A;  2POG A;  2R40 A;  4G21 A;  4OEZ A;  1GWQ A;  2ZK3 A;  3FUR A;  3OSI A;  1S0Z A;  3O1D A;  2H77 A;  2P4Y A;  3UU7 A;  3D5F A;  4QE6 A;  1K4W A;  1Y0S A;  2PIN A;  4MG8 A;  1SJ0 A;  4TUZ B;  5DLR A;  3VTC A;  5JJM B;  2YJD A;  3E7C A;  3RUU A;  3VJI A;  3UUC A;  3VT7 A;  3PEQ A;  2ATH A;  5KCT A;  1T63 A;  3ZR7 A;  3A2J A;  3OMO A;  3KMR A;  5KCE A;  3VRV A;  5DID A;  3WMH A;  4IV2 A;  1H9U A;  4RME A;  4TUZ A;  3P88 A;  5JJM A;  2ZXZ A;  1FM9 A;  3UVV B;  3E00 A;  2PIT A;  3ADS A;  2HC4 A;  2I4Z A;  2YHD A;  1IE9 A;  5AVL A;  1ZEO A;  1S0X A;  3ADV A;  2YLP A;  2AMA A;  4JYI A;  5KYJ A;  2J7Y A;  4XTA A;  1XP1 A;  2XKW A;  3UVV A;  3OLF A;  1XQ3 A;  1X7J A;  4RUO X;  1YMT A;  4DQM A;  3OMQ A;  1ERR A;  2GP7 A;  2ZNQ A;  5L11 A;  3CS4 A;  1YJE A;  1X7E A;  1T5Z A;  3ADU A;  3IPU A;  4MG7 A;  4OIU A;  3HZF A;  4PWL A;  3VRU A;  5FQS A;  4OC7 A;  4OZR U;  3VJH A;  4E2J A;  3CDS A;  3L3X A;  3K23 A;  3R2A A;  2ZNO A;  3UUA B;  2J7X A;  2VV0 A;  5DY8 A;  2YJA B;  1YP0 A;  3KWY A;  1PZL A;  1ZAF A;  3WT7 A;  2AX9 A;  3GYU A;  4R06 A;  2AA5 A;  4PLE A;  2HVC A;  3TKC A;  2HWR A;  1XJ7 A;  2PIR A;  3ADW A;  3L0J A;  4N1Y A;  5DXG A;  5AVI A;  3F5C B;  4IA7 A;  3AX8 A;  3W0G A;  4A2J A;  3JZC A;  5KRM A;  4Q13 A;  1PQ9 A;  4J5W A;  3IPQ A;  5G45 A;  3H0A A;  3B0Q A;  3FS1 A;  3PO9 A;  5AWJ A;  3UUA A;  3VJT A;  3OOF A;  4ONI A;  2P7Z A;  4G20 A;  5E19 A;  3VT3 A;  3WT5 A;  3ZQT A;  1S19 A;  2QTU A;  2JFA B;  4S0T A;  2AO6 A;  1XOW A;  3GWX A;  3WFF A;  5FQV A;  3QT0 A;  2EWP A;  2I0G A;  3F5C A;  4MGB B;  5E0W A;  5KRA A;  4MG9 B;  2AX7 A;  5G44 A;  3FXV A;  4ZNW A;  3W5Q A;  4DM6 A;  1ZDT A;  1SKX A;  4FHH A;  4IUI A;  4S0S A;  4CSJ A;  4J5X C;  1YIN A;  4PLD A;  3Q95 B;  4YNK A;  5DK9 A;  5F9B A;  4ZJR A;  5DMC A;  3VTD A;  5AZV A;  2GPO A;  2JFA A;  4JYG A;  1I37 A;  3OS8 C;  2P15 A;  1OVL B;  4X1G A;  3V9Y A;  4MGB A;  2ZK5 A;  3B65 A;  3A40 X;  4MG9 A;  5DIG A;  3WJ4 A;  1KV6 A;  3VT8 A;  2Q70 A;  4RE8 A;  5C4O A;  3Q95 A;  1ZH7 A;  2AA7 A;  5KRC A;  1FD0 A;  2XHS A;  5KRL A;  2HB7 A;  4RAK A;  1OVL A;  1T65 A;  1T7M A;  3PLZ A;  4OZT E;  4IQR A;  4P6X A;  3VI8 A;  2HAS A;  5JY3 A;  5DXR A;  1XZX X;  3H52 A;  2QZO B;  1NAV A;  2QSE A;  4IVW A;  3WFG A;  3DZY D;  1NHZ A;  2Q5G A;  4A4W A;  2NPA A;  2PIP L;  3B0T A;  3JZB A;  2Q6S A;  3TX7 B;  2PJL A;  2G5O A;  1NUO A;  2IOG A;  1MVC A;  2ZK4 A;  3R8D A;  3T03 A;  4POJ A;  4RWV A;  3CDP A;  3HC5 A;  2AB2 A;  2POB A;  2AX8 A;  5G42 A;  2QZO A;  4IW8 A;  5E1C A;  2Z4B A;  2P1V A;  4QJR A;  3D90 A;  4MG6 A;  2Q7J A;  2ZKC A;  3B1M A;  1KNU A;  5KRH A;  2XYJ A;  2ZK2 A;  3L3Z A;  3VHU A;  1XLS E;  3OMK A;  4N8R A;  2ZXN A;  1BSX A;  5DYB A;  5DV8 A;  4OH6 A;  2ZMI A;  5DKB A;  3A2H A;  1M2Z A;  3F7D A;  5DWG A;  4ITE A;  3RUT A;  5M96 A;  2ZAS A;  3UUD B;  1NQ2 A;  2E2R A;  3B67 A;  1U9E A;  3V9T A;  5B5B A;  5LWP A;  4KZI A;  1UPW A;  2OAX A;  2QGW A;  2REW A;  4J26 A;  4LNX A;  3GN8 A;  4OZT U;  3VSP A;  2QPY A;  3DZY A;  2B1Z A;  2V0V A;  4MGD B;  5EGV A;  5G3J A;  5SYZ A;  2AA6 A;  1SR7 A;  3O1E A;  3LBD A;  2V7C A;  3OZJ A;  2YLQ A;  1XLS A;  2VST A;  5APH A;  1FCY A;  4K4J A;  4XUM A;  5DP0 A;  1R5K A;  1A52 A;  2O4J A;  1IE8 A;  5I4V A;  3B3K A;  4OKT A;  4OLM A;  5DWE A;  4MGD A;  2OVM A;  5G46 A;  4HEE X;  3AN4 A;  4JGV A;  3VT5 A;  1NAX A;  1ERE A;  2HCD A;  2PIW A;  3KFC A;  4Q50 A;  4OZR E;  3ADX A;  4WHG A;  1K74 D;  5HCV A;  1NYX A;  1R6G A;  2IOK A;  1E3G A;  3EYB A;  3VN2 A;  1NDE A;  1YY4 A;  2NXX E;  3W0J A;  1XP9 A;  4FNE A;  2OVH A;  2G0G A;  2ZL9 A;  2ZXM A;  4IU7 A;  1G50 A;  2AMB A;  2Q5P A;  3SP6 A;  5HJP B;  4LNW A;  2B50 A;  4WLB A;  3B5R A;  1G1U A;  2P54 A;  4QM0 A;  1ILG A;  4PRG A;  1OSH A;  3KDU A;  2GPP A;  5DU5 A;  3VHV A;  4OK1 A;  2O4R A;  2PIX A;  5G5W A;  4OAR A;  1YIM A;  2XYX A;  5ICK A;  1UPV A;  4RMC A;  3VSO A;  4MG7 B;  5HJP A;  4NUF A;  2G0H A;  2QW4 A;  5DMF A;  3H0A D;  3AN3 A;  1NQ7 A;  1Z95 A;  3VT4 A;  5HYK A;  3OAP A;  4REF A;  2XYW A;  4IS8 A;  5DKG A;  4YMQ A;  3P89 A;  5HZC A;  5DWL A;  3RY9 A;  1XPC A;  1LV2 A;  3L0E A;  1K74 A;  3DCU A;  4REE A;  5HJS A;  2GWX A;  4PPP A;  5DZH A;  4IWC A;  1WM0 X;  4N5G A;  1GWX A;  5E14 A;  3AUQ A;  2QNV A;  1R20 D;  4RUP A;  3KMG A;  1LBD A;  2FVJ A;  4K7A A;  5DXB B;  1K7L A;  1SQN A;  3OSW A;  2ZFX A;  3FLI A;  3GYT A;  3AFR A;  3BEJ A;  3OOK A;  1ZGY A;  1XAP A;  3ERT A;  3OLL A;  4MG5 A;  3UP0 A;  4IA2 A;  4OEA A;  1QKT A;  2QA6 A;  5DZ0 A;  3ET1 A;  3L1B A;  5DWJ A;  4KZJ A;  5DX3 B;  3W0Y A;  1MV9 A;  5AK2 A;  5DXB A;  2PIQ A;  1PK5 A;  4DM8 A;  4RZG A;  2AM9 A;  3WGP A;  1N46 A;  4EM9 A;  1Q4X A;  4FGY A;  5DUE A;  2B23 A; 
#chains in the Genus database with same CATH homology
 1RK3 A;  4OHA A;  4PP6 A;  5DX3 A;  3CJW A;  3FUG A;  4IA1 A;  3ET2 A;  2BAW A;  2ZK1 A;  4UDB A;  1PQ6 A;  4ZO1 X;  2ZBS A;  1R1K D;  1R20 A;  1FCZ A;  3VTB A;  3PCU A;  3P0U A;  4YPQ A;  3CLD A;  5GIE A;  1QKN A;  4XI3 A;  2B1V A;  3K8S A;  1ZDU A;  3HC6 A;  3P8X A;  3V4A A;  4Y29 A;  5KRK A;  1A28 A;  1XVP B;  1XV9 B;  4YT1 A;  5GT4 A;  2JJ3 A;  4DK8 A;  4MGA B;  5K13 A;  5KRO A;  1T79 A;  5APK A;  5AZT A;  1X7B A;  5EIT A;  1PRG A;  4LTW A;  4APU A;  3A78 A;  5DXM A;  3AZ1 A;  1FBY A;  4NB6 A;  2P1U A;  3KBA A;  5DSH A;  5L7E A;  3CWD A;  1X7R A;  4TV1 B;  1HJ1 A;  4NIE A;  4QE8 A;  3W5R A;  1XVP A;  1M7W A;  5DV3 A;  1XV9 A;  3MNP A;  3DCT A;  2ABI A;  2J14 A;  3HO0 A;  4MGA A;  5DXE A;  5KRF A;  1R1K A;  2R6W A;  1GS4 A;  4OJB A;  2F4B A;  5DVV A;  3KMZ A;  3X36 A;  2BJ4 A;  3ZRA A;  1PCG A;  5CJ6 A;  3HVL A;  3W0A A;  3K6P A;  1T7F A;  4ZNH A;  1QKU A;  5A86 A;  3IA6 A;  5C4U A;  2Q6J A;  1E3K A;  2PNU A;  4G1D A;  3GZ9 A;  4TV1 A;  3WJ5 A;  5DZ1 A;  5ETH A;  3G8O A;  1ZUC A;  4K6I A;  3VRW A;  1XP6 A;  2FAI A;  2O9I A;  3RLL A;  2ZNN A;  2YAT A;  3B68 A;  2I4J A;  3MNO A;  5B41 A;  3LMP A;  4JYH A;  3CS8 A;  3NSQ A;  4J5X A;  5DKE A;  3FAL B;  2AX6 A;  4OKB A;  2VV1 B;  1QKM A;  1PQC A;  4OH5 A;  4WQP A;  4JL4 A;  5LGA A;  2YFE A;  1G2N A;  3V3Q A;  3D6D A;  3HQ5 A;  3OS8 A;  5KCF A;  5KCW A;  4M8H A;  1DKF B;  4QL8 A;  2OCF A;  3W0H A;  3SP9 A;  4E4Q A;  3S9S A;  2AYR A;  1YUC A;  1I7G A;  2PKL A;  4JAZ A;  4G1Y A;  2ZMH A;  2Q7L A;  4OGH A;  2ZK0 A;  4RFW A;  3FAL A;  3V49 A;  2VV1 A;  4B7W A;  3V3E A;  5AYG A;  4KZM A;  1N4H A;  3ZRB A;  4DK7 A;  2AAX A;  2OUZ A;  1I7I A;  5ACC A;  1S9Q A;  1DKF A;  2Q6R A;  1T7R A;  2Z4J A;  5DUH A;  5FQR A;  3OKH A;  5DXQ A;  3W5T A;  1G5Y A;  2YLO A;  2ZNP A;  3R29 A;  2VV2 A;  4ZNU A;  4RZE A;  2QXM A;  5DRM A;  5KRI A;  3KDT A;  3DY6 A;  2Q1H A;  3ILZ A;  2VV3 A;  1UHL B;  2I0J A;  2PIO A;  5KD9 A;  3AZ2 A;  3G9E A;  3B0W A;  2G44 A;  3GBK A;  3GWS X;  1TFC A;  5DYD A;  4ZN9 A;  5KCD A;  4X1F A;  4NY9 A;  4M8E A;  2QMV A;  1VJB A;  3L03 A;  2GTK A;  1HG4 A;  2QR9 A;  5FQT A;  2IHQ A;  3N00 A;  2OM9 A;  1UHL A;  2Q60 A;  3G0W A;  2QH6 A;  1Y0X X;  1M13 A;  5EJV A;  4ZOM A;  4ZNS A;  5DVC A;  2GL8 A;  2P7A A;  1RDT A;  5HYR A;  4J24 A;  5DKS A;  2QE4 A;  3TKM A;  4G2I A;  1U3S A;  4N73 A;  5L7G A;  3ADT A;  1RKG A;  2NXX A;  3CQV A;  1UOM A;  4XLD A;  4R2U A;  4ITF A;  1T7T A;  4CI4 A;  2PIU A;  3BQD A;  2OZ7 A;  1T76 A;  3NSP A;  3PRG A;  3FEJ A;  4PP3 A;  3PBA A;  4J5W C;  3V9V A;  2R6Y A;  4BCR A;  3DR1 A;  2H79 A;  4ZNT A;  4NQA B;  2ACL B;  2Q7I A;  1P8D A;  3NOA A;  5DIE A;  2Q7K A;  4PPS A;  1X78 A;  3OKI A;  5DZ3 A;  2GPV A;  3R5M A;  4ZNV A;  3VT9 A;  4POH A;  2AXA A;  4IWF A;  1NQ0 A;  5E7V A;  5KYA A;  1L2J A;  4UDA A;  3GD2 A;  2ACL A;  2FSZ A;  4DMA A;  2VV4 B;  2NV7 A;  3MNE A;  4ZN7 A;  3X31 A;  1S9P A;  2HFP A;  3HLV A;  3R5N A;  4MDD A;  4OJ9 A;  1YA3 A;  2HBH A;  3WTQ A;  5E0X A;  1GWR A;  4PF3 A;  1MZN A;  1OT7 A;  4XHD A;  3OMM A;  1Y9R A;  4WHF A;  4OJ4 A;  5DZI A;  4RZF A;  3R8A A;  3VT6 A;  3W0I A;  1FCX A;  5KCU A;  3W0C A;  2AWH A;  3A3Z X;  2VV4 A;  4RUJ A;  3FEI A;  1U3Q A;  2ZMJ A;  5C4S A;  5APJ A;  2GPU A;  4S15 A;  3B66 A;  3WT6 A;  2ZVT A;  3IMY A;  3OLS A;  1RJK A;  2AA2 A;  5EC9 A;  4EMA A;  3A2I A;  4RMD A;  5L7H A;  2ZLC A;  4G1Z A;  3WWR A;  1XB7 A;  4ZO1 B;  5G43 A;  2QXS A;  1EXA A;  2W8Y A;  5DVS A;  4IV4 A;  5JI0 D;  5E15 A;  1NQ1 A;  1TXI A;  1YOK A;  2HWQ A;  2PRG A;  2Q1V A;  4WVD A;  4L98 A;  2QGT A;  3AZ3 A;  5DXP A;  4P6W A;  1DB1 A;  1T74 A;  3CS6 A;  1XNX A;  2Q5S A;  2Q59 B;  5C4T A;  2Q8S A;  3HM1 A;  3G8I A;  3X1H A;  1FM6 D;  3AUR A;  2QAB A;  2BJ4 B;  1OSV A;  4IW6 A;  3TY0 A;  5AAV B;  1I38 A;  3DZU D;  3B0R A;  2J4A A;  2YLY A;  3D57 A;  3OMP A;  5DUG A;  1XDK B;  5DRJ A;  4UDC A;  3IPS A;  1XQC A;  2Q3Y A;  2ZY0 A;  5H1E A;  2Q59 A;  4PP5 A;  3OSA A;  1Z5X E;  4G2H A;  4CI5 A;  2A3I A;  1PDU A;  2I4P A;  3KYT A;  5AAV A;  2P7G A;  3R8I A;  5GIC A;  2QA8 B;  1ZKY A;  4F9M A;  1XDK A;  4OED A;  2GIU A;  2HAM A;  4DOR A;  5EHJ A;  5AWK A;  1YOW A;  4OEY A;  3SZ1 A;  1YYE A;  2JF9 A;  3D24 A;  3E94 A;  3ERD A;  4PVU A;  2QA8 A;  1FM6 A;  1EXX A;  4OKX A;  4PXM A;  4ZJW A;  4UDD A;  5KCC A;  3UP3 A;  3DZU A;  2ZK6 A;  3DT3 A;  4WPF A;  2Q61 A;  3K22 A;  3IXP D;  5DL4 A;  2VSR A;  4LBD A;  2HAR A;  4OFR A;  3KPZ A;  2P1T A;  1X76 A;  3RLJ A;  3ET3 A;  1U3R A;  3VJS A;  2ZLA A;  3W5P A;  1N83 A;  2R40 D;  1KKQ A;  3OS9 A;  1RDT D;  4HLW A;  4IVY A;  5GID A;  1ILH A;  3ET0 A;  4IA3 A;  3FC6 B;  3A9E B;  3L0L A;  1Z5X U;  3OZ0 A;  4LSJ A;  3VHW A;  1P93 A;  5FQP A;  4DOS A;  3OGT A;  5IXK A;  5KRJ A;  5EI1 A;  4O8F A;  1XNN A;  4FHI A;  4OKW A;  4XAO A;  4A4V A;  3X1I A;  3VRT A;  2LBD A;  5IAW A;  1T73 A;  1RKH A;  4Q0A C;  4R6S A;  3BC5 A;  3RVF A;  3FC6 A;  3A9E A;  5KR9 A;  1XIU A;  4MGC A;  4OIL A;  5AAU A;  2HB8 A;  5DV6 A;  2NW4 A;  4ZI1 A;  1FM9 D;  3M7R A;  2PIV A;  4XUH A;  4E4K A;  3IXP A;  4XT9 A;  5DTV A;  3UU7 B;  5DI7 A;  3E00 D;  4L96 A;  3U9Q A;  4FN9 A;  4MG8 B;  3CTB A;  1L2I A;  4S14 A;  4OFU A;  5DWI A;  4OIV A;  5DXK A;  5IZ0 A;  3HOD A;  4QK4 A;  3AUN A;  3UUD A;  1NRL A;  2POG A;  2R40 A;  4G21 A;  4OEZ A;  1GWQ A;  2ZK3 A;  3FUR A;  3OSI A;  1S0Z A;  3O1D A;  2H77 A;  2P4Y A;  3UU7 A;  3D5F A;  4QE6 A;  1K4W A;  1Y0S A;  2PIN A;  4MG8 A;  1SJ0 A;  4TUZ B;  5DLR A;  3VTC A;  5JJM B;  2YJD A;  3E7C A;  3RUU A;  3VJI A;  3UUC A;  3VT7 A;  3PEQ A;  2ATH A;  5KCT A;  1T63 A;  3ZR7 A;  3A2J A;  3OMO A;  3KMR A;  5KCE A;  3VRV A;  5DID A;  3WMH A;  4IV2 A;  1H9U A;  4RME A;  4TUZ A;  3P88 A;  5JJM A;  2ZXZ A;  1FM9 A;  3UVV B;  3E00 A;  2PIT A;  3ADS A;  2HC4 A;  2I4Z A;  2YHD A;  1IE9 A;  5AVL A;  1ZEO A;  1S0X A;  3ADV A;  2YLP A;  2AMA A;  4JYI A;  5KYJ A;  2J7Y A;  4XTA A;  1XP1 A;  2XKW A;  3UVV A;  3OLF A;  1XQ3 A;  1X7J A;  4RUO X;  1YMT A;  4DQM A;  3OMQ A;  1ERR A;  2GP7 A;  2ZNQ A;  5L11 A;  3CS4 A;  1YJE A;  1X7E A;  1T5Z A;  3ADU A;  3IPU A;  4MG7 A;  4OIU A;  3HZF A;  4PWL A;  3VRU A;  5FQS A;  4OC7 A;  4OZR U;  3VJH A;  4E2J A;  3CDS A;  3L3X A;  3K23 A;  3R2A A;  2ZNO A;  3UUA B;  2J7X A;  2VV0 A;  5DY8 A;  2YJA B;  1YP0 A;  3KWY A;  1PZL A;  1ZAF A;  3WT7 A;  2AX9 A;  3GYU A;  4R06 A;  2AA5 A;  4PLE A;  2HVC A;  3TKC A;  2HWR A;  1XJ7 A;  2PIR A;  3ADW A;  3L0J A;  4N1Y A;  5DXG A;  5AVI A;  3F5C B;  4IA7 A;  3AX8 A;  3W0G A;  4A2J A;  3JZC A;  5KRM A;  4Q13 A;  1PQ9 A;  4J5W A;  3IPQ A;  5G45 A;  3H0A A;  3B0Q A;  3FS1 A;  3PO9 A;  5AWJ A;  3UUA A;  3VJT A;  3OOF A;  4ONI A;  2P7Z A;  4G20 A;  5E19 A;  3VT3 A;  3WT5 A;  3ZQT A;  1S19 A;  2QTU A;  2JFA B;  4S0T A;  2AO6 A;  1XOW A;  3GWX A;  3WFF A;  5FQV A;  3QT0 A;  2EWP A;  2I0G A;  3F5C A;  4MGB B;  5E0W A;  5KRA A;  4MG9 B;  2AX7 A;  5G44 A;  3FXV A;  4ZNW A;  3W5Q A;  4DM6 A;  1ZDT A;  1SKX A;  4FHH A;  4IUI A;  4S0S A;  4CSJ A;  4J5X C;  1YIN A;  4PLD A;  3Q95 B;  4YNK A;  5DK9 A;  5F9B A;  4ZJR A;  5DMC A;  3VTD A;  5AZV A;  2GPO A;  2JFA A;  4JYG A;  1I37 A;  3OS8 C;  2P15 A;  1OVL B;  4X1G A;  3V9Y A;  4MGB A;  2ZK5 A;  3B65 A;  3A40 X;  4MG9 A;  5DIG A;  3WJ4 A;  1KV6 A;  3VT8 A;  2Q70 A;  4RE8 A;  5C4O A;  3Q95 A;  1ZH7 A;  2AA7 A;  5KRC A;  1FD0 A;  2XHS A;  5KRL A;  2HB7 A;  4RAK A;  1OVL A;  1T65 A;  1T7M A;  3PLZ A;  4OZT E;  4IQR A;  4P6X A;  3VI8 A;  2HAS A;  5JY3 A;  5DXR A;  1XZX X;  3H52 A;  2QZO B;  1NAV A;  2QSE A;  4IVW A;  3WFG A;  3DZY D;  1NHZ A;  2Q5G A;  4A4W A;  2NPA A;  2PIP L;  3B0T A;  3JZB A;  2Q6S A;  3TX7 B;  2PJL A;  2G5O A;  1NUO A;  2IOG A;  1MVC A;  2ZK4 A;  3R8D A;  3T03 A;  4POJ A;  4RWV A;  3CDP A;  3HC5 A;  2AB2 A;  2POB A;  2AX8 A;  5G42 A;  2QZO A;  4IW8 A;  5E1C A;  2Z4B A;  2P1V A;  4QJR A;  3D90 A;  4MG6 A;  2Q7J A;  2ZKC A;  3B1M A;  1KNU A;  5KRH A;  2XYJ A;  2ZK2 A;  3L3Z A;  3VHU A;  1XLS E;  3OMK A;  4N8R A;  2ZXN A;  1BSX A;  5DYB A;  5DV8 A;  4OH6 A;  2ZMI A;  5DKB A;  3A2H A;  1M2Z A;  3F7D A;  5DWG A;  4ITE A;  3RUT A;  5M96 A;  2ZAS A;  3UUD B;  1NQ2 A;  2E2R A;  3B67 A;  1U9E A;  3V9T A;  5B5B A;  5LWP A;  4KZI A;  1UPW A;  2OAX A;  2QGW A;  2REW A;  4J26 A;  4LNX A;  3GN8 A;  4OZT U;  3VSP A;  2QPY A;  3DZY A;  2B1Z A;  2V0V A;  4MGD B;  5EGV A;  5G3J A;  5SYZ A;  2AA6 A;  1SR7 A;  3O1E A;  3LBD A;  2V7C A;  3OZJ A;  2YLQ A;  1XLS A;  2VST A;  5APH A;  1FCY A;  4K4J A;  4XUM A;  5DP0 A;  1R5K A;  1A52 A;  2O4J A;  1IE8 A;  5I4V A;  3B3K A;  4OKT A;  4OLM A;  5DWE A;  4MGD A;  2OVM A;  5G46 A;  4HEE X;  3AN4 A;  4JGV A;  3VT5 A;  1NAX A;  1ERE A;  2HCD A;  2PIW A;  3KFC A;  4Q50 A;  4OZR E;  3ADX A;  4WHG A;  1K74 D;  5HCV A;  1NYX A;  1R6G A;  2IOK A;  1E3G A;  3EYB A;  3VN2 A;  1NDE A;  1YY4 A;  2NXX E;  3W0J A;  1XP9 A;  4FNE A;  2OVH A;  2G0G A;  2ZL9 A;  2ZXM A;  4IU7 A;  1G50 A;  2AMB A;  2Q5P A;  3SP6 A;  5HJP B;  4LNW A;  2B50 A;  4WLB A;  3B5R A;  1G1U A;  2P54 A;  4QM0 A;  1ILG A;  4PRG A;  1OSH A;  3KDU A;  2GPP A;  5DU5 A;  3VHV A;  4OK1 A;  2O4R A;  2PIX A;  5G5W A;  4OAR A;  1YIM A;  2XYX A;  5ICK A;  1UPV A;  4RMC A;  3VSO A;  4MG7 B;  5HJP A;  4NUF A;  2G0H A;  2QW4 A;  5DMF A;  3H0A D;  3AN3 A;  1NQ7 A;  1Z95 A;  3VT4 A;  5HYK A;  3OAP A;  4REF A;  2XYW A;  4IS8 A;  5DKG A;  4YMQ A;  3P89 A;  5HZC A;  5DWL A;  3RY9 A;  1XPC A;  1LV2 A;  3L0E A;  1K74 A;  3DCU A;  4REE A;  5HJS A;  2GWX A;  4PPP A;  5DZH A;  4IWC A;  1WM0 X;  4N5G A;  1GWX A;  5E14 A;  3AUQ A;  2QNV A;  1R20 D;  4RUP A;  3KMG A;  1LBD A;  2FVJ A;  4K7A A;  5DXB B;  1K7L A;  1SQN A;  3OSW A;  2ZFX A;  3FLI A;  3GYT A;  3AFR A;  3BEJ A;  3OOK A;  1ZGY A;  1XAP A;  3ERT A;  3OLL A;  4MG5 A;  3UP0 A;  4IA2 A;  4OEA A;  1QKT A;  2QA6 A;  5DZ0 A;  3ET1 A;  3L1B A;  5DWJ A;  4KZJ A;  5DX3 B;  3W0Y A;  1MV9 A;  5AK2 A;  5DXB A;  2PIQ A;  1PK5 A;  4DM8 A;  4RZG A;  2AM9 A;  3WGP A;  1N46 A;  4EM9 A;  1Q4X A;  4FGY A;  5DUE A;  2B23 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...